Dbfetch

ID   AM491587; SV 1; linear; genomic DNA; STD; HUM; 1529 BP.
XX
AC   AM491587;
XX
DT   06-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24new
DE   allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*24new allele; human leucocyte A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1529
RA   Dormoy A.;
RT   ;
RL   Submitted (05-FEB-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Soreau E., Schell A., Froelich N.;
RT   "The new HLA-A*24 allele is identical to the current HLA-A*24020101 allele
RT   except a substitution at position 650 leading to the change of codon 193:
RT   CCC(Pro)-> CTC(Leu)";
RL   Unpublished.
XX
DR   MD5; 52585998ff51f14b7c36a0ed006bc002.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1529
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala A-1, fwd_seq:
FT                   tgacccagacctgggca, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<131..400,628..903,1254..>1529)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /function="anitgen presenting molecule"
FT                   /db_xref="GOA:A2RQE0"
FT                   /db_xref="IMGT/HLA:A*24:76"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2RQE0"
FT                   /protein_id="CAM33241.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHLISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <131..400
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   intron          401..627
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   exon            628..903
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
FT   intron          904..1253
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
FT   exon            1254..>1529
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=4
XX
SQ   Sequence 1529 BP; 306 A; 470 C; 513 G; 240 T; 0 other;
     gtgagtgcgg ggtcgggagg gaaacggcct ctgcggggag aagcaagggg cccgcctggc        60
     gggggcgcaa gacccgggaa gccgcgccgg gaggagggtc gggcgggtct cagccactcc       120
     tcgtccccag gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc       180
     ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac       240
     agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg       300
     gagtattggg acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac       360
     ctgcggatcg cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccgac       420
     ccctcatccc ccacggacgg gccgggtcgc ccacagtctc cgggtccgag atccaccccg       480
     aagccgcggg accccgagac ccttgccccg ggagaggccc aggcgcctta acccggtttc       540
     attttcagtt taggccaaaa atccccccgg gttggtcggg gccgggcggg gctcggggga       600
     ctgggctgac cgcggggtcg gggccaggtt ctcacaccct ccagatgatg tttggctgcg       660
     acgtggggtc ggacgggcgc ttcctccgcg ggtaccacca gtacgcctac gacggcaagg       720
     attacatcgc cctgaaagag gacctgcgct cttggaccgc ggcggacatg gcggctcaga       780
     tcaccaagcg caagtgggag gcggcccatg tggcggagca gcagagagcc tacctggagg       840
     gcacgtgcgt ggacgggctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgca       900
     cgggtaccag gggccacggg gcgcctacct gatcgcctgt aggtctcccg ggctggcctc       960
     ccacaaggag gggagacaat tgggaccaac actagaatat cgccctccct ctggtcctga      1020
     gggagaggaa tcctcctggg tttccagatc ctgtaccaga gagtgactct gaggttccgc      1080
     cctgctctct gacacaatta agggataaaa tctctgacgg aatgacggaa agacgatccc      1140
     tcgaatactg atgactggtt ccctttgaca ccggccaaga tggccacatg catgctggtg      1200
     gagtgtccca tgacagatgc aaaatgcctg aattttctga ctcttcccgt cagacccccc      1260
     caagacacat atgacccacc acctcatctc tgaccatgag gccactctga gatgctgggc      1320
     cctgggcttc taccctgcgg agatcacact gacctggcag cgggatgggg aggaccagac      1380
     ccaggacacg gagcttgtgg agaccaggcc tgcaggggat ggaaccttcc agaagtgggc      1440
     agctgtggtg gtaccttctg gagaggagca gagatacacc tgccatgtgc agcatgaggg      1500
     tctgcccaag cccctcaccc tgagatggg                                        1529
//