spacer

EBI Dbfetch

ID   AM491357; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM491357;
XX
DT   01-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo Sapiens partial HLA-DRB1 gene for MHC class II antigen,
DE   HLA-DRB1*1104new allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*1104new; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Poli F.;
RT   ;
RL   Submitted (01-FEB-2007) to the INSDC.
RL   Poli F., Medicina Rigenerativa, Ospedale Maggiore Policlinico di Milano,
RL   Via Francesco Sforza, 35 - Milano, 20122, ITALY.
XX
RN   [2]
RA   Poli F.;
RT   "Identification of a new HLA-DRB1*1104 by sequence base typing";
RL   Unpublished.
XX
DR   MD5; 7a8588677d42fe186aa0015ec288b826.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Italy"
FT                   /tissue_type="cord blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1104new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4VAP8"
FT                   /db_xref="IMGT/HLA:DRB1*11:04:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A4VAP8"
FT                   /protein_id="CAM33006.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="DRB1*1104new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 62 C; 98 G; 53 T; 1 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatga ggagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacrgtg cagcggcgag                                        270
//


spacer
spacer