Dbfetch

ID   AM422979; SV 1; linear; genomic DNA; STD; HUM; 644 BP.
XX
AC   AM422979;
XX
DT   18-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*06new
DE   allele, isolate 279827, exons 2-3
XX
KW   allele HLA-Cw*06new; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-644
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (16-JAN-2007) to the INSDC.
RL   Lebedeva T.V., Hla Laboratory, American Red Cross, 180 Rustcraft Rd, MA,
RL   02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Zanelly G., Mastromarino S., Alosco S., Ohashi M., Yu N.;
RT   "New HLA-C alleles identified in minority populations";
RL   Unpublished.
XX
DR   MD5; bfda1b524e63ead593942a603176a322.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..644
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="279827"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..552)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="premature stop codon in exon 3 due to an uneven
FT                   recombination"
FT                   /db_xref="IMGT/HLA:C*06:16N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:A2BCX5"
FT                   /protein_id="CAM23872.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQGPAQVGGGP"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..552
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*06new"
FT                   /number=3
XX
SQ   Sequence 644 BP; 104 A; 168 C; 203 G; 69 T; 100 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccc cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagtgg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc aggggccagc gcaagtggga       540
     ggcggcccgt gaggcggagc agtggagagc ctacctggag ggcacgtgcg tggagtggct       600
     ccgcagatac ctggagaacg ggaaggagac gctgcagcgc gcgg                        644
//