spacer

EBI Dbfetch

ID   AM422976; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM422976;
XX
DT   18-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*03new
DE   allele, isolate 277287, exons 2-3
XX
KW   allele HLA-Cw*03new; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (16-JAN-2007) to the INSDC.
RL   Lebedeva T.V., Hla Laboratory, American Red Cross, 180 Rustcraft Rd, MA,
RL   02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Zanelly G., Mastromarino S., Alosco S., Ohashi M., Yu N.;
RT   "New HLA-C alleles identified in minority populations";
RL   Unpublished.
XX
DR   MD5; f5e35fdc7617d29b0a5cc8ea0d158926.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="277287"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A2BCX2"
FT                   /db_xref="IMGT/HLA:C*03:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2BCX2"
FT                   /protein_id="CAM23869.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHILQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*03new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 104 A; 167 C; 200 G; 75 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat cctccagagg atgtatggct gcgacgtggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctgaagaa tgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer