spacer

EBI Dbfetch

ID   AM422974; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM422974;
XX
DT   18-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-C gene for MHC Class I antigen, HLA-Cw*04new
DE   allele, isolate 277012, exons 2-3
XX
KW   allele HLA-Cw*04new; HLA-C gene; human leucocyte antigen C;
KW   major histocompatibility complex; MHC Class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Lebedeva T.V.;
RT   ;
RL   Submitted (16-JAN-2007) to the INSDC.
RL   Lebedeva T.V., Hla Laboratory, American Red Cross, 180 Rustcraft Rd, MA,
RL   02026, USA.
XX
RN   [2]
RA   Lebedeva T.V., Zanelly G., Mastromarino S., Alosco S., Ohashi M., Yu N.;
RT   "New HLA-C alleles identified in minority populations";
RL   Unpublished.
XX
DR   MD5; 6ad161d58d82356246b642f2d4d1a129.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="277012"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="whole blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /product="MHC Class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A2BCX0"
FT                   /db_xref="IMGT/HLA:C*04:27"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2BCX0"
FT                   /protein_id="CAM23867.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDRSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*04new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 167 C; 199 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtttggct gcgacctggg gccggacggg       420
     cgcctcctcc gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer