spacer

EBI Dbfetch

ID   AM422778; SV 1; linear; genomic DNA; STD; HUM; 1195 BP.
XX
AC   AM422778;
XX
DT   12-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, exons 1-4,
DE   HLA-A*7407 allele
XX
KW   HLA-A gene; HLA-A*7407 allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I anitgen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1195
RA   Dormoy A.;
RT   ;
RL   Submitted (02-JAN-2007) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang - Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Froelich N.;
RT   "The HLA-A*7407 allele is identical to the A*7402 allele except at position
RT   290 of exon 2";
RL   Unpublished.
XX
DR   MD5; 06dc5edc07afe5d85207c33ff7a72c9f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1..73,174..443,544..819,920..>1195)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*7407"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A1KWT0"
FT                   /db_xref="IMGT/HLA:A*74:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1KWT0"
FT                   /protein_id="CAM12538.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*7407"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*7407"
FT                   /number=2
FT   variation       390
FT                   /replace="c"
FT                   /compare=AJ223060.1
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*7407"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*7407"
FT                   /number=4
XX
SQ   Sequence 1195 BP; 172 A; 275 C; 309 G; 139 T; 300 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcttca catccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttt gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccagga       360
     gacacggaat gtgaaggccc actcacagat tgaccgagtg gacctgggga ccctgcgcgg       420
     ctactacaac cagagcgagg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnngttctca caccatccag atgatgtatg gctgcgacgt ggggccggac gggcgcctcc       600
     tccgcgggta ccagcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc       660
     tgcgctcttg gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg       720
     cccgtgtggc ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcacggn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna cgcccccaag acgcatatga ctcaccacgc tgtctctgac       960
     catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca      1080
     ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca ggagcagaga      1140
     tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggg           1195
//


spacer
spacer