spacer

EBI Dbfetch

ID   AM422702; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM422702;
XX
DT   12-JAN-2007 (Rel. 90, Created)
DT   18-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*32XX allele,
DE   exons 2-3
XX
KW   HLA-A gene; HLA-A*32XX allele; human leukocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Tran H.;
RT   ;
RL   Submitted (12-JAN-2007) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00958.x.
RX   PUBMED; 17990990.
RA   Heinold A., Bauer M., Opelz G., Scherer S., Schmidt A.H., Tran T.H.;
RT   "Identification and characterization of three novel HLA alleles,
RT   HLA-A*240214, HLA-A*3215 and HLA-DQB1*060302";
RL   Tissue Antigens 70(6):511-514(2007).
XX
DR   MD5; 7aaae9fc1fd143c64dddc606bb7165f9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*32XX"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*32XX"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A1KWS8"
FT                   /db_xref="IMGT/HLA:A*32:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1KWS8"
FT                   /protein_id="CAM12504.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRESLRIALRYYNQSEAGSHTIQMMYGCDVGP
FT                   DGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 165 C; 195 G; 79 T; 100 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagagagc ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca gcaggacgcc tacgacggca aggattacat cgccttgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer