Dbfetch

ID   AM422607; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AM422607;
XX
DT   15-JAN-2007 (Rel. 90, Created)
DT   08-AUG-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA*02new allele,
DE   exon 3, isolate 4214678
XX
KW   HLA*02new allele; HLA-A gene; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Hammond L.;
RT   ;
RL   Submitted (11-JAN-2007) to the INSDC.
RL   Hammond L., Tissue Typing, Molecular Genetics, New Zealand Blood Service,
RL   Private Bag 92071 Auckland Mail Centre, Auckland 1142, NEW ZEALAND.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01080.x.
RX   PUBMED; 18721279.
RA   Hammond L., Limmer M., Dyer C.R., Rantes C.H., Dunn P.P.J.;
RT   "A new HLA-A*02 null allele, HLA-A*9213N";
RL   Tissue Antigens 72(2):176-177(2008).
XX
DR   MD5; 9b7baa442653a52305c3dab6cafafca1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="4214678"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mixed leucocytes"
FT                   /tissue_type="peripheral blood"
FT                   /note="new HLA-A*02null allele resulting from G-A at nt251
FT                   resulting in premature stop at codon 60 in exon 2"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA*02new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="No HLA-A2 antigen detected by serology on two
FT                   occasions"
FT                   /db_xref="IMGT/HLA:A*02:113:01N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A2BCQ4"
FT                   /protein_id="CAM12702.1"
FT                   /translation="SHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="A*02new"
FT                   /number=3
XX
SQ   Sequence 276 BP; 58 A; 79 C; 98 G; 41 T; 0 other;
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//