spacer

EBI Dbfetch

ID   AM421131; SV 1; linear; genomic DNA; STD; HUM; 825 BP.
XX
AC   AM421131;
XX
DT   22-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*06new
DE   allele, exons 2-3
XX
KW   HLA-DQB1 gene; HLA-DQB1*06new allele; human leucocyte antigen DQB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-825
RA   Witter K.;
RT   ;
RL   Submitted (19-DEC-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01021.x.
RX   PUBMED; 18331527.
RA   Witter K., Albert T., Zahn R., Kauke T.;
RT   "HLA-DQB1*0634, a novel DQB1 allele found by high-resolution HLA typing of
RT   a sibling pair for potential bone marrow transplantation";
RL   Tissue Antigens 71(5):486-488(2008).
XX
DR   MD5; 57650e730dcb05b360b2c390e124bcb2.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..825
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,544..>825)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT   CDS             join(<1..270,544..>825)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /protein_id="CAM07104.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLERTRAELDTVCRHNYEVGYRGILQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPGQIKVQWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQSPITVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
FT   intron          271..543
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
FT   gap             382..481
FT                   /estimated_length=unknown
FT   exon            544..825
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=3
XX
SQ   Sequence 825 BP; 147 A; 206 C; 226 G; 146 T; 100 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggggtaccg cgggatcctg cagaggagag gtgagcgtcg tcgcccctcc gtgaggcgca       300
     cccttggccg ggaccccgag tctctgtgcc gggaggggcg atgggggcga ggtctctgaa       360
     atctgagccc agttcattcc annnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nagacgtggt gtgtgttctc acatctcact cctatgtctt ttcctgtctg ttactgccct       540
     cagtggagcc cacagtgacc atctccccat ccaggacaga ggccctcaac caccacaacc       600
     tgctggtctg ctcggtgaca gatttctatc caggccagat caaagtccag tggtttcgga       660
     atgatcagga ggagacagcc ggcgttgtgt ccacccccct tattaggaat ggtgactgga       720
     ctttccagat cctggtgatg ctggaaatga ctccccagcg tggagatgtc tacacctgcc       780
     acgtggagca ccccagcctc cagagcccca tcaccgtgga gtggt                       825
//


spacer
spacer