Dbfetch

ID   AM412763; SV 2; linear; genomic DNA; STD; HUM; 3348 BP.
XX
AC   AM412763;
XX
DT   29-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-C gene for MHC class I antigen, HLA-Cw*120301new allele,
DE   exons 1-8
XX
KW   HLA-C gene; HLA-Cw*120301new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by author [14-DEC-2006]
RP   1-3348
RA   Jiang W.;
RT   ;
RL   Submitted (29-NOV-2006) to the INSDC.
RL   Jiang W., Genetics and Development Biology, Southeast University Medical
RL   School, 87 Ding Jia Qiao Road, Nanjing, Jiangsu, 210009, CHINA.
XX
RN   [2]
RA   Jiang W.;
RT   "Identification of a novel HLA-C allele";
RL   Unpublished.
XX
DR   MD5; ff3c56a68534ef6adbf0622ea691498c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3348
FT                   /organism="Homo sapiens"
FT                   /map="6p23-1"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="BGC"
FT                   /note="human gastric carcinoma cell line"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..283
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT   CDS             join(284..356,487..756,1002..1277,1856..2140,2262..2381,
FT                   2821..2853,2961..3008,3173..3177)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A4H284"
FT                   /db_xref="IMGT/HLA:C*12:03:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4H284"
FT                   /protein_id="CAL85437.2"
FT                   /translation="MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAVPSEHPKTHVTHHPVS
FT                   DHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEE
FT                   QRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKS
FT                   SGGKGGSCSQAASSNSAQGSDESLIACKA"
FT   exon            284..356
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=1
FT   intron          357..486
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=1
FT   exon            487..756
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=2
FT   intron          757..1001
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=2
FT   exon            1002..1277
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=3
FT   intron          1278..1855
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=3
FT   exon            1856..2140
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=4
FT   intron          2141..2261
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=4
FT   exon            2262..2381
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=5
FT   intron          2382..2820
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=5
FT   exon            2821..2853
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=6
FT   intron          2854..2960
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=6
FT   exon            2961..3008
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=7
FT   intron          3009..3172
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=7
FT   exon            3173..3177
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
FT                   /number=8
FT   3'UTR           3178..3348
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*120301new"
XX
SQ   Sequence 3348 BP; 621 A; 984 C; 1044 G; 699 T; 0 other;
     gatcaggacg aagtcccagg tcccgggcgg ggctctcagg gtctcaggct ccaagggccg        60
     tgtctgcact ggggaggcgc cgcgttgagg attctccact cccctgagtt tcacttcttc       120
     tcccaacctg cgtcgggtcc ttcttcctga atactcatga cgcgtcccca attcccactc       180
     ccattgggtg tcgggttcta gagaagccaa tcagcgtctc cgcagtcccg gttctaaagt       240
     ccccagtcac ccacccggac tcggattctc cccagacgcc gagatgcggg tcatggcgcc       300
     ccgaaccctc atcctgctgc tctcgggagc cctggccctg accgagacct gggcctgtga       360
     gtgcggggtt gggagggaaa cggcctctgc ggagaggagc gaggggcccg cccggcgagg       420
     gcgcaggacc cggggagccg cgcagggagg agggtcgggc gggtctcagc ccctcctcgc       480
     ccccaggctc ccactccatg aggtatttct acaccgccgt gtcccggccc ggccgcggag       540
     agccccgctt catcgcagtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg       600
     acgccgcgag tccaagaggg gagccgcggg cgccgtgggt ggagcaggag gggccggagt       660
     attgggaccg ggagacacag aagtacaagc gccaggcaca ggctgaccga gtgagcctgc       720
     ggaacctgcg cggctactac aaccagagcg aggccggtga gtgaccccgg cccggggcgc       780
     aggtcacgac ccctccccat cccccacgga cggcccgggt cgccccgagt ctcccggtct       840
     gagatccacc ccgaggctgc ggaacccgcc cagaccctcg accggagaga gccccagtca       900
     cctttacccg gtttcatttt cagtttaggc caaaatcccc gcgggttggt cggggctggg       960
     gcggggctcg ggggacgggc tgaccacggg ggcggggcca gggtctcaca ccctccagtg      1020
     gatgtatggc tgcgacctgg ggcccgacgg gcgcctcctc cgcgggtatg accagtccgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ctgccgcgga      1140
     cacggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagtggag      1200
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctgtagatct      1320
     cccgggatgg cctcccacga ggaggggagg aaaatgggat cagcgctaga atatcgccct      1380
     cccttgaatg gagaatggga tgagttttcc tgagtttcct ctgagggccc cctctgctct      1440
     ctaggacaat taagggatga agtccttgag gaaatggagg ggaagacagt ccctggaata      1500
     ctgatcaggg gtcccctttg accactttga ccactgcagc agctgtggtc aggctgctga      1560
     cctttctctc aggccttgtt ctctgcctca cgctcaatgt gtttaaaggt ttgattccag      1620
     cttttctgag tccttcggcc tccactcagg tcaggaccag aagtcgctgt tcctccctca      1680
     gagactagaa ctttccaatg aataggagat tatcccaggt gcctgtgtcc aggctggcgt      1740
     ctgggttctg tgcccccttc cccaccccag gtgtcctgtc cattctcagg atggtcacat      1800
     gggcgctgtt ggagtgtcgc aagagagata caaagtgtct gaattttctg actcttcccg      1860
     tcagaacacc caaagacaca cgtgacccac catcccgtct ctgaccatga ggccaccctg      1920
     aggtgctggg ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggc      1980
     gaggaccaaa ctcaggacac cgagcttgtg gagaccaggc cagcaggaga tggaaccttc      2040
     cagaagtggg cagctgtggt ggtgccttct ggagaagagc agagatacac gtgccatgtg      2100
     cagcacgagg ggctgccaga gcccctcacc ctgagatggg gtaaggaggg ggatgagggg      2160
     tcatgtgtct tctcagggaa agcagaagtc ctggagccct tcagccgggt cagggctgag      2220
     gcttgggggt cagggcccct caccttcccc tcctttccca gagccatctt cccagcccac      2280
     catccccatc gtgggcatcg ttgctggcct ggctgtcctg gctgtcctag ctgtcctagg      2340
     agctgtgatg gctgttgtga tgtgtaggag gaagagctca ggtagggaag gggtgaggag      2400
     tggggtctgg gttttcttgt cccactggga gtttcaagcc ccaggtagaa gtgtgcccca      2460
     cctcgttact ggaagcacca tccacacatg ggccatccca gcctgggacc ctgtgtgcta      2520
     gcacttactc tgttgtgaag cacatgacaa tgaaggacag atgtatcacc ttgatgatta      2580
     tggtgttggg gtccttgatt ccagcattca tgagtcaggg gaaggtccct gctaaggaca      2640
     gaccttagga gggcagttgc tccagaaccc acagctgctt tccccgtgtt tcctgatcct      2700
     gccctgggtc tgcagtcata gttctggaaa cttctcttgg gtccaagact aggaggttcc      2760
     cctaagatcg catggccctg cctcctccct gtcccctcac agggcatttt cttcccacag      2820
     gtggaaaagg agggagctgc tctcaggctg cgtgtaagtg atggcggtgg gcgtgtggag      2880
     gagctcaccc accccataat tcctcttgtc ccacatctcc tgcgggctct gaccaggtct      2940
     ttttttttgt tctaccccag ccagcaacag tgcccagggc tctgatgagt ctctcatcgc      3000
     ttgtaaaggt gagattctgg ggagctgaag tggtctgggg tggggcagag ggaaaaggcc      3060
     taggtaatgg ggatcctttg attgggacgt ttcgaatgtg tggtgagctg ttcagagtgt      3120
     catcacttac catgactgac ctgaatttgt tcatgactat tgtgttctgt agcctgagac      3180
     agctgcctgt gtgggactga gatgcaggat ttcttcacac ctctcctttg tgacttcaag      3240
     agcctctggc atctctttct gcaaaggcat ctgaatgtgt ctgcgttcct gttagcataa      3300
     tgtgaggagg tggagagaca gcccaccccc gtgtccaccg tgacccct                   3348
//