Dbfetch

ID   AM412363; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM412363;
XX
DT   02-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*04
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*04 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hau F.;
RT   ;
RL   Submitted (23-NOV-2006) to the INSDC.
RL   Hau F., Laboratoire HLA, Efs Normandie, 609 Chemin de la Breteque BP 558,
RL   Rouen 76000, FRANCE.
XX
RN   [2]
RA   Hau F., Mercier B., Cavelier B., Waller M., Vannier J.;
RT   "Identification of a new HLA-DRB1 allele in a French Guiana Family";
RL   Unpublished.
XX
DR   MD5; b492c68302b7d8a8b77bd18ad26ce3b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /country="French Guiana"
FT                   /tissue_type="lymphocytes"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0PFV9"
FT                   /db_xref="IMGT/HLA:DRB1*04:63"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0PFV9"
FT                   /protein_id="CAL85404.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 64 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//