Dbfetch

ID   AM410969; SV 1; linear; genomic DNA; STD; HUM; 1666 BP.
XX
AC   AM410969;
XX
DT   15-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I, allele HLA-A*33new
XX
KW   HLA-A gene; HLA-A*33new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1666
RA   Altermann W.W.;
RT   ;
RL   Submitted (08-NOV-2006) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00857.x.
RX   PUBMED; 17559584.
RA   Altermann W.W., Erhuma M., Seliger B., Schlaf G.;
RT   "A novel HLA-A*33 (A*3309) allele in a Caucasian family that differs at
RT   protein position 66 from HLA-A*3308";
RL   Tissue Antigens 70(1):69-70(2007).
XX
DR   MD5; b536e031f2a612cd40e938cf7dba0ff4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1666
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(7..79,209..478,720..995,1335..>1610)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /product="MHC class I"
FT                   /function="antigen presentation"
FT                   /db_xref="IMGT/HLA:A*33:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0JKD2"
FT                   /protein_id="CAL69526.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRNVKAHSQIDRVDLGT
FT                   LRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            7..79
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=1
FT   intron          80..208
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=1
FT   exon            209..478
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=2
FT   intron          479..719
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=2
FT   exon            720..995
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=3
FT   intron          996..1334
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=3
FT   gap             1037..1136
FT                   /estimated_length=unknown
FT   exon            1335..1610
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=4
FT   intron          1611..>1666
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33new"
FT                   /number=4
XX
SQ   Sequence 1666 BP; 285 A; 482 C; 536 G; 263 T; 100 other;
     ccgaggatgg ccgtcatggc gccccgaacc ctcctcctgc tactcttggg ggccctggcc        60
     ctgacccaga cctgggcggg tgagtgcggg gtcgtgggga aaccgcctct gcggggagaa       120
     gcaaggggcc cgcccggcgg gggcgcagga cccgggtagc cgcgccggga ggagggtcgg       180
     gcggatctca gccactcctc gcccccaggc tcccactcca tgaggtattt caccacatcc       240
     gtgtcccggc ccggccgcgg ggagccccgc ttcatcgccg tgggctacgt ggacgacacg       300
     cagttcgtgc ggttcgacag cgacgccgcg agccagagga tggagccgcg ggcgccgtgg       360
     atagagcagg agggtccgga gtattgggac ggggagacac ggaatgtgaa ggcccactca       420
     cagattgacc gagtggacct ggggaccctg cgcggctact acaaccagag cgaggccggt       480
     gagtgacccc agcccggggc gcaggtcacg acctctcatc ccccacggac gggccaggtc       540
     acccacagtc tccgggtccg agatccaccc cgaagccgcg ggaccccgag acccttgccc       600
     cgggagaggc ccaggcgcct ttacccggtt tcattttcag tttaggccaa aaatcccccc       660
     gggttggtcg gggccggacg gggctcgggg gactgggctg accgtggggt cggggccagg       720
     ttctcacacc atccagatga tgtatggctg cgacgtgggg tcggacgggc gcttcctccg       780
     cgggtaccag caggacgcct acgacggcaa ggattacatc gccttgaacg aggacctgcg       840
     ctcttggacc gcggcggaca tggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgtggcggag cagttgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cacgggtacc aggggccacg gggcgcctcc      1020
     ctgatcgcct gtagatnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnctgt      1140
     tccctcttca gggactagaa ttttccacgg aataggagat tatcccaggt gcctgtgtcc      1200
     aggctggtgt ctgggttctg tgctcccttc cccatcccag gtgtcctgtc cattctcaag      1260
     atagccacat gtgtgctgga ggagtgtccc attacagatg caaaatgcct gaatgttctg      1320
     actcttcctg acagaccccc ccaagacgca tatgactcac cacgctgtct ctgaccatga      1380
     ggccaccctg aggtgctggg ccctgagctt ctaccctgcg gagatcacac tgacctggca      1440
     gcgggatggg gaggaccaga cccaggacac ggagctcgtg gagaccaggc ctgcagggga      1500
     tggaaccttc cagaagtggg cgtctgtggt ggtgccttct ggacaggagc agagatacac      1560
     ctgccatgtg cagcatgagg gtctccccaa gcccctcacc ctgagatggg gtaaggaggg      1620
     agatgggggt gtcatgtctt ttagggaaag caggagcctc tctgac                     1666
//