spacer

EBI Dbfetch

ID   AM410967; SV 1; linear; genomic DNA; STD; HUM; 1920 BP.
XX
AC   AM410967;
XX
DT   15-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I, allele HLA-B*35new
XX
KW   HLA-B gene; HLA-B*35new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1920
RA   Altermann W.W.;
RT   ;
RL   Submitted (08-NOV-2006) to the INSDC.
RL   Altermann W.W., Interbranch HLA-Lab, Martin-Luther-University, Medical
RL   School, Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00845.x.
RX   PUBMED; 17559587.
RA   Schlaf G., Erhuma M.E., Seliger B., Foell J., Altermann W.W.;
RT   "A novel HLA-B*35 (B*3570) allele of a Caucasian family differing with one
RT   amino acid mismatch from HLA-B*3503 allele in exon 4";
RL   Tissue Antigens 70(1):72-73(2007).
XX
DR   MD5; 78ac4c484f09a69cd6e29796893f5ed8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1920
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(52..124,254..523,769..1044,1570..>1845)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:A0JKD1"
FT                   /db_xref="IMGT/HLA:B*35:70"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0JKD1"
FT                   /protein_id="CAL69527.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTRVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            52..124
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=1
FT   intron          125..253
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=1
FT   exon            254..523
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=2
FT   intron          524..768
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=2
FT   exon            769..1044
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=3
FT   intron          1045..1569
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=3
FT   gap             1261..1360
FT                   /estimated_length=unknown
FT   exon            1570..1845
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=4
FT   intron          1846..>1920
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35new"
FT                   /number=4
XX
SQ   Sequence 1920 BP; 352 A; 564 C; 610 G; 294 T; 100 other;
     tctaaagtcc ccacgcaccc acccggactc agaatctcct cagacgccga gatgcgggtc        60
     acggcgcccc gaaccgtcct cctgctgctc tggggggcag tggccctgac cgagacctgg       120
     gccggtgagt gcggggtcgg gagggaaatg gcctctgtgg ggaggagcga ggggaccgca       180
     ggcgggggcg caggacctga ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc       240
     tcctcgcccc caggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       300
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       360
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       420
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac ttaccgagag       480
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccc       540
     ggggcgcagg tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg       600
     gtccgagatc cgcctccctg aggccgcggg acccgcccag accctcgacc ggcgagagcc       660
     ccaggcgcgt ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg       720
     ggcggggcgg ggctcggggg acggggctga ccgcggggcc ggggccaggg tctcacatca       780
     tccagaggat gtatggctgc gacctggggc ccgacgggcg cctcctccgc gggcatgacc       840
     agttcgccta cgacggcaag gattacatcg ccctgaacga ggacctgagc tcctggaccg       900
     cggcggacac cgcggctcag atcacccagc gcaagtggga ggcggcccgt gtggcggagc       960
     agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac ctggagaacg      1020
     ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc ccatctccta      1080
     taggtcgccg gggatggcct cccacgagaa gaggaggaaa atgggatcag cgctagaatg      1140
     tcgccctccc ttgaatggag aatggcatga gttttcctga gtttcctctg agggccccct      1200
     cttctctcta ggacaattaa gggatgacgt ctctgaggaa atggagggga agacagtccc      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn gagcagaagt ccctgttccc      1380
     cgctcagaga ctcgaacttt ccaatgaata ggagattatc ccaggtgcct gcgtccaggc      1440
     tggtgtctgg gttctgtgcc ccttccccac accaggtgtc ctgtccattc tcaggctggt      1500
     cacatgggtg gtcctagggt gtcccatgag agatgcaaag cgcctgaatt ttctgactct      1560
     tcccatcaga ccccccaaag acacgcgtga cccaccaccc cgtctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca ggagatagaa      1740
     ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga tacacatgcc      1800
     atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggggtaag gagggggatg      1860
     aggggtcata tctcttctca gggaaagcag gagcccttct ggagcccttc agcagggtca      1920
//


spacer
spacer