spacer

EBI Dbfetch

ID   AM410904; SV 1; linear; genomic DNA; STD; HUM; 1010 BP.
XX
AC   AM410904;
XX
DT   09-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*29 new
DE   allele, exons 2-3
XX
KW   HLA-A gene; HLA-A*29 new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1010
RA   Erhuma M.E.;
RT   ;
RL   Submitted (08-NOV-2006) to the INSDC.
RL   Erhuma M.E., Interbranch HLA-Lab, Martin-Luther-University, Medical School,
RL   Magdeburger Str. 16, D-06097 Halle, GERMANY.
XX
RN   [2]
RA   Erhuma M.E., Radam C., Schlaf G., Seliger B., Altermann W.W.;
RT   "A novel HLA-A*29 allele of a Caucasian relative to an ALL patient
RT   containing a mutation in a highly polymorphic region which was identified
RT   through the loss of a specific amplificate in a low resolution SSP-PCR
RT   kit";
RL   Unpublished.
XX
DR   MD5; bab8167bca87e15cd614386355f15547.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1010
FT                   /organism="Homo sapiens"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..72
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /number=1
FT                   /inference="similar to DNA sequence:INSD:AJ303359.3"
FT   CDS             join(<73..342,584..>859)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0JKC0"
FT                   /db_xref="IMGT/HLA:A*29:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0JKC0"
FT                   /protein_id="CAL69123.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCHVGS
FT                   DGRFLRGYRQDAYDGKDYIALNQDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            73..342
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /number=2
FT   intron          343..583
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /number=2
FT   exon            584..>859
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /number=3
FT   intron          860..>1010
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29 new"
FT                   /number=3
FT                   /inference="similar to DNA sequence:INSD:AJ303359.3"
XX
SQ   Sequence 1010 BP; 178 A; 324 C; 358 G; 150 T; 0 other;
     gcggggacgc aggacccggg tagccgcgcc gggaggaggg tcgggtgggt ctcagccact        60
     cctcgccccc aggctcccac tccatgaggt atttcaccac atccgtgtcc cggcccggcc       120
     gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggtttg       180
     acagcgacgc cgcgagccag aggatggagc cgcgggcacc gtggatagag caggaggggc       240
     cggagtattg ggacctgcag acacggaatg tgaaggccca gtcacagact gaccgagcga       300
     acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg       360
     gggcgcaggt cacgacctct catcccccac ggacgggccg ggtcgcccac agtctccggg       420
     tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag aggcccaggc       480
     gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg gtcggggccg       540
     gacggggctc gggggactgg gctgaccgtg gggtcggggc caggttctca caccatccag       600
     atgatgtatg gctgccacgt ggggtcggac gggcgcttcc tccgcgggta ccggcaggac       660
     gcctacgacg gcaaggatta catcgccttg aaccaggacc tgcgctcttg gaccgcggcg       720
     gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagttg       780
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       840
     gagacgctgc agcgcacggg taccgggggc cacggggcgc ctccctgatc gcctgtagat       900
     ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta gaatatcgcc       960
     ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt                 1010
//


spacer
spacer