spacer

EBI Dbfetch

ID   AM409257; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM409257;
XX
DT   31-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*15
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*15 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Velickovic Z.;
RT   ;
RL   Submitted (31-OCT-2006) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.;
RT   "Novel HLA-DRB1* 15 allele";
RL   Unpublished.
XX
DR   MD5; 37f6d36fff3669fe3babe650374b8243.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0AQZ0"
FT                   /db_xref="IMGT/HLA:DRB1*15:02:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0AQZ0"
FT                   /protein_id="CAL64839.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*15"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 65 C; 101 G; 49 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactatgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer