spacer

EBI Dbfetch

ID   AM409256; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM409256;
XX
DT   31-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*03
DE   allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*03 allele; human leucocyte antigen DQB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Velickovic Z.;
RT   ;
RL   Submitted (31-OCT-2006) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.;
RT   "Novel HLA-DQB1* 03 allele";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Velickovic Z.;
RT   ;
RL   Submitted (03-NOV-2006) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
DR   MD5; 64d46f39996ede1e7514971b8602857b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0AQY9"
FT                   /db_xref="IMGT/HLA:DQB1*03:02:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0AQY9"
FT                   /protein_id="CAL64838.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03"
FT                   /number=2
XX
SQ   Sequence 270 BP; 59 A; 70 C; 94 G; 47 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataatcgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer