spacer

EBI Dbfetch

ID   AM409252; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM409252;
XX
DT   31-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*0439
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*0439 allele; human leucocyte antigen DRB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Velickovic Z.;
RT   ;
RL   Submitted (31-OCT-2006) to the INSDC.
RL   Velickovic Z., Tissue Typing, Molecular Genetics, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, AUSTRALIA.
XX
RN   [2]
RA   Velickovic Z.;
RT   "Confirmatory sequence for the HLA-DRB1*0439 allele";
RL   Unpublished.
XX
DR   MD5; b599a14cf74dfdd66b5e856d8ed823d3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Australia"
FT                   /tissue_type="Blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0439"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:A0AQY5"
FT                   /db_xref="IMGT/HLA:DRB1*04:39"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0AQY5"
FT                   /protein_id="CAL64834.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGDYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0439"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 65 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggactaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer