spacer

EBI Dbfetch

ID   AM408917; SV 1; linear; genomic DNA; STD; HUM; 908 BP.
XX
AC   AM408917;
XX
DT   20-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-Cw gene for MHC class I antigen, allele
DE   HLA-Cw*0302new
XX
KW   HLA-Cw gene; HLA-Cw*0302new allele; human leucocyte antigen Cw;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-908
RA   Minevich G.;
RT   ;
RL   Submitted (20-OCT-2006) to the INSDC.
RL   Minevich G., Pediatrics, Columbia University, Black Building room 448, 630
RL   W 168th Street, NY 10032, USA.
XX
RN   [2]
RA   Minevich G., Nuara J., Kuhn L., Winchester R.;
RT   "Description of two new HLA-Cw alleles in a South African Population";
RL   Unpublished.
XX
DR   MD5; 1d204043c6fc80f9761a5778b1fc5021.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..908
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="patient M268N (Columbia University)"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa"
FT                   /collection_date="10-Sep-1997"
FT                   /identified_by="Gregory Minevich"
FT                   /sex="female"
FT                   /haplotype="B*5801-Cw*0302new"
FT                   /clone="TOPO TA clone F05"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   intron          <1..90
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /number=1
FT   CDS             join(<91..360,606..>881)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /note="HLA-Cw*0302new haplotype in infant of proband"
FT                   /db_xref="GOA:A0PFJ8"
FT                   /db_xref="IMGT/HLA:C*03:33"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0PFJ8"
FT                   /protein_id="CAL64132.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGCYNQSEAGSHILQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            91..360
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /number=2
FT   intron          361..605
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /number=2
FT   exon            606..881
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /number=3
FT   intron          882..>908
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0302new"
FT                   /number=3
XX
SQ   Sequence 908 BP; 154 A; 298 C; 338 G; 118 T; 0 other;
     tagcgagggg cccgcccggc gagggcgcag gacccgggga gccgcgcagg gaggagggtc        60
     gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat ttctacaccg       120
     ctgtgtcccg gcccggccgc ggggagcccc acttcatcgc agtgggctac gtggacgaca       180
     cgcagttcgt gcggttcgac agcgacgccg cgagtccgag aggggagccg cgggcgccgt       240
     gggtggagca ggaggggccg gagtattggg accgggagac acagaagtac aagcgccagg       300
     cacagactga ccgagtgagc ctgcggaacc tgcgcggctg ctacaaccag agcgaggccg       360
     gtgagtgacc ccggcccggg gcgcaggtca cgacccctcc tcatccccca cggacggccc       420
     gggtcgcccc aagtctcccg gtctgagatc caccccgagg ctgcggaacc cgcccagacc       480
     ctcgaccgga gagagcccca gtcaccttta cccggtttca ttttcagttt aggccaaaat       540
     ccccgcgggt tggtcggggc ggggcggggc tcgggggacg gggctgaccg cgggggcggg       600
     gccagggtct cacatcctcc agaggatgta tggctgcgac gtggggcccg acgggcgcct       660
     cctccgcggg tatgaccagt ccgcctacga cggcaaggat tacatcgccc tgaacgagga       720
     tctgcgctcc tggaccgccg cggacacggc ggctcagatc acccagcgca agtgggaggc       780
     ggcccgtgag gcggagcagc tgagagccta cctggagggc ctgtgcgtgg agtggctccg       840
     cagatacctg aagaatggga aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga       900
     gccttccc                                                                908
//


spacer
spacer