Dbfetch

ID   AM408787; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AM408787;
XX
DT   24-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-DPB1 gene for MHC class II antigen, HLA-DPB1*66new
DE   allele, exon 2
XX
KW   HLA-DPB1 gene; HLA-DPB1*66new allele; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Cox S.T.;
RT   ;
RL   Submitted (23-OCT-2006) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of HLA-DPB1*66new";
RL   Unpublished.
XX
DR   MD5; 1efc5bac20dfb40fcae3e06ce53260dd.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="DPB1*6601 variant"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /allele="DPB1*66new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*117:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="CAL64063.1"
FT                   /translation="ENYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVT
FT                   ELGRPAAEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
XX
SQ   Sequence 267 BP; 62 A; 67 C; 99 G; 39 T; 0 other;
     cagagaatta cgtgtaccag ttacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agtacgcgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgctgcgga gtactggaac agccagaagg       180
     acatcctgga ggaggagcgg gcagtgccgg acaggatgtg cagacacaac tacgagctgg       240
     gcgggcccat gaccctgcag cgccgag                                           267
//