spacer

EBI Dbfetch

ID   AM408343; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM408343;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Otomys angoniensis mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Otomys angoniensis (Angoni vlei rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Otomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 81ee469d6fb8d177d5d35215c8c78d40.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Otomys angoniensis"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa"
FT                   /collected_by="G. Contraffato"
FT                   /tissue_lib="T-718"
FT                   /db_xref="taxon:109681"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A7DWA5"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A7DWA5"
FT                   /protein_id="CAL64050.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMLQI
FT                   LTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVFIMIILLMILVLFFPDALGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLIFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNLLKWS"
XX
SQ   Sequence 1140 BP; 357 A; 304 C; 135 G; 344 T; 0 other;
     atgacaaaca tccgaaaaac ccacccccta cttaaaatta ttaatcactc atttattgac        60
     ctccctgcac catcaaacat ctcatcatga tgaaacttcg gctctctact aggaatttgc       120
     cttatgctac aaatccttac aggcctattt ctagcaatac actatacatc agacacaaca       180
     acagcattct catcagtaac ccatatttgc cgagacgtta actacggctg actaatccga       240
     tatttacatg caaacggagc atcaatattt ttcatctgcc tattcttaca tgtaggacga       300
     ggtatatatt acgggtccta cacattccta gaaacatgaa atattggagt aattctctta       360
     tttaccgtaa tagccactgc atttataggc tatgtcctcc catgaggaca aatatcattc       420
     tgaggagcaa cagttattac aaatttactt tctgctatcc cctacattgg cactacccta       480
     gtagaatgaa tctgaggagg tttctcagta gacaaagcta ccctaacacg ctttttcgca       540
     ttccacttta ttttaccatt tatcatcaca gccttagtaa tcgtccatct actattcctc       600
     cacgaaacag gctcaaacaa ccctacagga ctaaattcag acgcagataa aattccattc       660
     cacccatatt acaccattaa agacatctta ggtgtattca tcataattat cctactaatg       720
     attctagtac ttttctttcc agatgcacta ggagacccag acaactatac acccgccaac       780
     ccacttaaca ctcccccaca tatcaaacca gaatgatatt tcttattcgc ctacgctatc       840
     cttcgttcta ttccaaataa actaggagga gtcttagcct taatcctatc tatcttaatt       900
     ttagccctac taccctttct ccacacctca aaacaacgta gccttatttt tcgtccaatt       960
     acacaaaccc tctactgaat tctagtagca aacctattaa tcctaacttg aattggagga      1020
     cagcccgtag aacatccatt tattatcatt ggccaattag cctccatcag ctacttctct      1080
     attattctta tcctcatacc aatttcagga attatcgaag acaatcttct aaaatgaagc      1140
//


spacer
spacer