spacer

EBI Dbfetch

ID   AM408342; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM408342;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Oenomys hypoxanthus mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Oenomys hypoxanthus (rufous-nosed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Oenomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; e26510a8f5c985bd363fcabd1c4fdbc8.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Oenomys hypoxanthus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Democratic Republic of the Congo:Menengue"
FT                   /collected_by="L. Granjon"
FT                   /tissue_lib="T-788"
FT                   /db_xref="taxon:332668"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A7DWA4"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A7DWA4"
FT                   /protein_id="CAL64049.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLVRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGVILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLIMITLLMMLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILAFLPFLHTSKQRSLIFRPITQALYWALVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 355 A; 281 C; 143 G; 360 T; 1 other;
     atgacaaaca tccgaaaaac tcatccccta ctaaaaatta ttaatcactc atttattgac        60
     ctccctgctc catctaatat ctcatcctga tgaaattttg gctctctact aggaatttgc       120
     ctgatagtac aaatcattac aggcctcttt ctagcaatac actatacgtc agatacaata       180
     acagcattct catcagttac ccatatctgc cgagacgtaa actacggctg attagttcga       240
     tayatacacg caaacggggc ttctatattt tttatctgcc tatttctcca tgtgggtcga       300
     ggaatgtact acggatcata tactttccta gaaacatgaa atattggagt catcttgcta       360
     ttcacagtta tagctacagc attcataggc tatgttctcc catgaggaca aatatcattt       420
     tgaggggcaa cagtaattac aaatttactt tcagccatcc cctatattgg aactacctta       480
     gtcgaatgaa tttgaggcgg cttctcagta gacaaagcta ctctgactcg attttttgca       540
     ttccatttca ttttaccatt tattattaca gcccttgtaa ttgttcatct acttttcctt       600
     cacgaaactg gctcaaataa tccaacaggc ctaaactcag acgctgacaa aatcccattt       660
     cacccatatt atactattaa agacattcta ggagtactaa tcataattac actactaata       720
     atactagtat tgttcttccc tgatttacta ggagaccccg acaactatac accagccaac       780
     ccacttaaca cccctccaca tatcaaacca gaatggtatt ttctatttgc ctacgctatt       840
     cttcgttcaa tccctaataa actaggaggt gtactagctc taatcctatc tattttaatc       900
     ctagcatttc taccattcct tcacacttca aaacaacgta gcttaatttt ccgcccaatc       960
     actcaagctt tatattgagc cctagtagca aacttactaa tcttaacctg aattggcgga      1020
     caaccagtag aacatccatt catcattatt ggacaactag cctccatcag ctacttttcc      1080
     attatcctta ttttaatacc aatctcagga atcattgaag acaaaatact aaaatgaaac      1140
//


spacer
spacer