spacer

EBI Dbfetch

ID   AM408341; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM408341;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Malacomys longipes mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Malacomys longipes (big-eared swamp rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Malacomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; a68cf1c451ac0796356a928bfbb02dcf.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Malacomys longipes"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Gabon:M'Passa"
FT                   /collected_by="V. Nance"
FT                   /tissue_lib="T-424"
FT                   /db_xref="taxon:112226"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A7DWA3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A7DWA3"
FT                   /protein_id="CAL64048.1"
FT                   /translation="MTNMRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMVQI
FT                   ITGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGIYY
FT                   GSYTFLETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAVPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIVLALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGLFIMISLLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILVLALLPFLHTSKQRSLTFRPITQILYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIENKMLKLN"
XX
SQ   Sequence 1140 BP; 366 A; 346 C; 133 G; 295 T; 0 other;
     atgacaaaca tacgaaaatc ccacccatta cttaaaatca tcaaccattc ttttattgac        60
     ctccccgccc catctaacat ctcatcatga tgaaacttcg gatcactcct aggaatttgc       120
     ctcatagtac aaatcattac aggcctattt ctagctatac attatacatc agatacaaca       180
     acagcattct catcagtcac acacatctgc cgagacgtaa attacggatg actaattcga       240
     tacttacacg caaacggggc ctcaatattc ttcatctgcc tattccttca cgtcggacga       300
     ggaatttact acggatccta caccttccta gaaacatgaa acattggagt aatcttacta       360
     ttcgcagtca tagccaccgc attcataggc tacgtactcc catgaggaca aatatcattc       420
     tgaggagcca cagtcatcac aaatctactc tcagcagtac cctacatcgg aaccacccta       480
     gtagaatgaa tctgaggggg attctcagta gacaaagcca ccctaacacg cttcttcgca       540
     ttccacttta tcctcccatt catcgtccta gccctcgtaa tcgtccacct cctattcctc       600
     catgagacag gttcaaacaa ccctacagga cttaactcag actcagacaa aatcccattt       660
     cacccatact acactattaa agacattcta ggattattca ttataatttc acttttaata       720
     acattagtac tattcttccc agacctctta ggagacccag acaactacac accagccaat       780
     ccactaaaca ctccaccaca catcaaacca gaatgatatt tcctattcgc ctacgcaatc       840
     ctacgatcta tcccaaacaa actaggaggc gtactagccc taatcctatc aatcctggta       900
     ctagcactcc tccccttcct ccacacctca aaacaacgca gcttaacatt ccgaccaatc       960
     acacaaatcc tttactgaat cctagtagca aacctcctca ttctaacatg aattggagga      1020
     caacccgtag aacacccctt catcatcatc ggccaactag cctcaatctc ctacttctct      1080
     attatcctaa tccttatacc aatctcagga atcattgaaa acaaaatatt aaaattaaac      1140
//


spacer
spacer