spacer

EBI Dbfetch

ID   AM408338; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM408338;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Golunda ellioti mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Golunda ellioti (Indian bush rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Golunda.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; bce59f39ddd34bc00b6ae5267fb763f1.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3815218; 24223730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Golunda ellioti"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="India:Mudumalai, Tamil Nadu"
FT                   /collected_by="F. Catzeflis"
FT                   /tissue_lib="T-843"
FT                   /db_xref="taxon:121585"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A7DWA0"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A7DWA0"
FT                   /protein_id="CAL64045.1"
FT                   /translation="MTNIRKTHPLMKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   MTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYMFLETWNIGVVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   MWGGFSVDKATLTRFFAFHFILPFIIAAFVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLIMLVILMMLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLMFRPITQTLYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFTIILILMPISGMIEDKMLKWS"
XX
SQ   Sequence 1140 BP; 355 A; 318 C; 141 G; 326 T; 0 other;
     atgacaaaca tccgaaaaac ccacccacta ataaaaatta ttaatcactc atttatcgac        60
     ctacctgctc catccaatat ctcatcatgg tgaaattttg gttccctcct aggaatttgc       120
     ctaataattc aaatcataac aggcctattt ctagccatac attacacatc agacacaact       180
     acagcattct catcagtaac ccacatctgc cgagacgtaa attacggatg actaatccgc       240
     tacatacacg caaacggagc ctcaatattt ttcatctgcc ttttcctaca cgtagggcga       300
     ggtatatact acggatctta tatattccta gaaacatgaa acattggagt agtgttatta       360
     tttgcagtta tagctactgc attcataggc tacgtcctac catgaggaca aatatcattc       420
     tgaggagcta cagtaattac taatcttctc tcagccatcc catatattgg aacaacccta       480
     gtagagtgaa tatgaggagg cttctcagtt gataaagcca ctttaacacg cttcttcgca       540
     ttccacttta ttctcccatt catcatcgca gcattcgtta tcgtccattt acttttcctc       600
     cacgaaacag gttcaaacaa tccaacaggc cttaactcag acgcagacaa aatcccattt       660
     cacccatatt atactatcaa agacattcta ggtgtactta ttatgctagt tatcttaata       720
     atactagtct tattttcccc agacctacta ggagacccag ataactacac accagccaac       780
     cccctcaaca ccccaccaca cattaaaccc gaatgatact ttctattcgc ctacgctatc       840
     cttcgctcaa tccctaacaa actaggaggt gtactagccc taatcttatc aattcttatt       900
     ctagccctcc tcccatttct ccacacctcc aaacaacgta gcctaatatt ccgcccaatt       960
     acccaaacct tatattgaat cctagtagcc aacctccttg tcctaacctg aattggaggt      1020
     caaccagttg aacacccatt cattattatt ggccaactag cctccatcag ctactttact      1080
     attatcctca tcctcatacc aatctcagga ataatcgagg acaaaatatt aaaatgaagc      1140
//


spacer
spacer