spacer

EBI Dbfetch

ID   AM408337; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AM408337;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Berylmys bowersi mitochondrial partial cytb gene for cytochrome b
XX
KW   cytb gene; cytochrome b.
XX
OS   Berylmys bowersi (Bower's white-toothed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Berylmys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 5fd80b7e21aea94cdcc9b3e23cbc9803.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Berylmys bowersi"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Mochan"
FT                   /collected_by="Cao Van Sung"
FT                   /tissue_lib="T-861"
FT                   /db_xref="taxon:83759"
FT   CDS             1..>1140
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:A7DW99"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW99"
FT                   /protein_id="CAL64044.1"
FT                   /translation="MTNIRKSHPLLKIINHSFIDLPAPSNISSWWNFGSLLGVCLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIATLAIVHLLFLHETGSNNPTGLNPDADKIPFHP
FT                   YYTIKDLLGVFILLLILMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVVALVLSILILALLPFLHTSKQRTLMFRPITQILYWILTANLLILTWIGG
FT                   QPVEHPFIIIGQMASISYFSIILVLMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 359 A; 335 C; 136 G; 310 T; 0 other;
     atgacaaaca tccgaaaatc ccaccctcta ctcaaaatta tcaaccactc tttcattgac        60
     cttcccgccc catccaacat ctcatcatga tgaaacttcg gctccctctt aggagtctgc       120
     ctaataatcc aaattatcac aggactattc ctagcaatac actatacatc cgacaccata       180
     acagcattct catcagtcac ccatatctgc cgagacgtaa actacggctg attaatccga       240
     tacttacatg ccaacggagc ctcaatattt ttcatctgct tatttctcca cgtaggacga       300
     ggcatatatt atggatccta caccttctta gaaacatgaa acattggaat tatcctccta       360
     ttcgcagtaa tagcaaccgc atttataggc tacgtactac catgaggaca aatatcattc       420
     tgaggagcca cagtaattac aaatttacta tcagctattc catacattgg gaccaccctc       480
     gttgaatgaa tctgaggagg attctcagta gacaaagcaa ccctaacacg cttcttcgca       540
     ttccacttta tcctcccatt cattattgcc accctcgcaa tcgtacatct tctattcctt       600
     cacgaaacag gatcaaacaa ccccacagga ctaaaccctg acgcagacaa aattccattc       660
     cacccatatt atacaatcaa agacctccta ggagtattta ttctgctact aattctaata       720
     accctagttt tattcttccc agacctccta ggagacccag ataattacac acccgccaac       780
     cccctaaaca ccccacctca tattaaacca gaatgatatt tcctcttcgc ttacgccatc       840
     ttacgttcca tccccaacaa actaggagga gtagtagccc tagtcctatc aatcttaatt       900
     ttagccctcc taccattcct acatacctca aaacaacgca ccctaatatt tcgcccaatc       960
     acccaaatcc tatactgaat tctcacagcc aacctactta ttctaacatg aatcggaggt      1020
     cagccggtag agcatccatt cattattatt ggccaaatag catccatcag ttatttttca      1080
     attatcctag tcctaatacc aatctccgga atcattgaag acaaaatact aaaatgaaat      1140
//


spacer
spacer