spacer

EBI Dbfetch

ID   AM408332; SV 1; linear; genomic DNA; STD; ROD; 746 BP.
XX
AC   AM408332;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Golunda ellioti partial IRBP gene for interphotoreceptor retinoid binding
DE   protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Golunda ellioti (Indian bush rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Golunda.
XX
RN   [1]
RP   1-746
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; cf8c8f3b5468d93081bb910e4ca0ea33.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..746
FT                   /organism="Golunda ellioti"
FT                   /mol_type="genomic DNA"
FT                   /country="India:Mudumalai, Tamild nadu"
FT                   /collected_by="F. Catzeflis"
FT                   /tissue_lib="T-0843"
FT                   /db_xref="taxon:121585"
FT   CDS             <1..>746
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW94"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW94"
FT                   /protein_id="CAL64039.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQXPALTNLTQEELLAQIQKNIRHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWEQLMGTSSLVLDLRHCTGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSGHTGGVAEDITYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGG"
XX
SQ   Sequence 746 BP; 171 A; 209 C; 205 G; 158 T; 3 other;
     ctgatgggaa tgcaagcagc cattgaacag gctatgaaga gtcatgagat tctgggcatc        60
     tcagatcctc agacactggc ccatgtgctg acagctggag tgcagagttc cttraatgac       120
     ccacgtctct tcatctccta tgagcccagc accctcgagg ctccccagca akcaccagcg       180
     ctcaccaacc tcacccagga agaactgctg gcccagatac agaagaacat ccgtcatgag       240
     gttcttgagg gcaacgtagg ctacctacga gtggatgacc tccctggcca ggaggtactg       300
     agtgagcttg gggagttctt agtgagccat gtgtgggagc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctgtacyggt ggccatgtct ctggcatccc ttacgtcatc       420
     tcctacttgc accctggaaa cactgtcatg catgtggaca ccatctatga tcgtccctcc       480
     aacacaacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgatcctcac cagtggacat actgggggag tggctgagga catcacctat       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacagaagg tggtgccctg       660
     gacctccaga agctgagaat aggtcagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtgg                                            746
//


spacer
spacer