spacer

EBI Dbfetch

ID   AM408331; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408331;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Bandicota bengalensis partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Bandicota bengalensis (lesser bandicoot rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Bandicota.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; ccec6e416c3d841ce6395a845c5c0d54.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Bandicota bengalensis"
FT                   /mol_type="genomic DNA"
FT                   /country="Pakistan:Islamabad"
FT                   /collected_by="Waheedud Din"
FT                   /tissue_lib="T-0656"
FT                   /db_xref="taxon:69079"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW93"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW93"
FT                   /protein_id="CAL64038.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTVGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTDLTREELLAQIQRNIRHEVLEDNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSDFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALDKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETPSRPETGPNDPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLGPYVLRQVWEP"
XX
SQ   Sequence 1262 BP; 261 A; 369 C; 377 G; 254 T; 1 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tctgaccctc agacgctggc ccatgtgctg acagttggag tccagagctc tttgaatgac       120
     ccacgtctct tcatctccta tgagcccagt accctcgagg ctccccagca agcaccagca       180
     ctcaccgacc tcacccgaga agagctgctg gcccagatac agaggaacat ccgccatgag       240
     gttcttgarg ataatgtggg ctacctacga gtggatgatc tccctggaca agaggtactg       300
     agtgagctgg gggagttcct agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgctag atctccgtca ctgtgctggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cacagtcttg cacgtggata ccatctacga tcggccctcc       480
     aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacac actgggggag tagccgagga catcgcttac       600
     atccttaagc agatgcgcag ggccatcgtg gtgggtgagc ggacggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtcc gacttcttcc ttacagtgcc tgtgtccagg       720
     tccctggggc ccctaggtgg aggtggccaa acatgggaag gcagcggggt gctgccctgt       780
     gtggggatac ctgcagagca agccctagac aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gcgttgtcct ccgactccaa gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccatctg gccagcatgg actactcggc cgtggtctcc       960
     gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctggtga gagccaccgg gcccagagaa accccctcaa gacctgagac tggccctaac      1080
     gacccaccag cagtcacccc tgaggtgccc aaggaagaag ctgcccgaag ggccctagtg      1140
     gactccgtgt ttcaggtgtc cgtgctgccg ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagacg cctccgtgct gaagacactg ggcccttatg tgctgcggca ggtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer