spacer

EBI Dbfetch

ID   AM408330; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408330;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Aethomys namaquensis partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Micaelamys namaquensis (Namaqua Micaelamys)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Micaelamys.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 6f45cefa485780f08e3c4c2ca8cb45ec.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Micaelamys namaquensis"
FT                   /mol_type="genomic DNA"
FT                   /country="South Africa:Natal Van Reenen Wyford Farm"
FT                   /collected_by="G. Bronner"
FT                   /tissue_lib="T-1425"
FT                   /db_xref="taxon:472707"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW92"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW92"
FT                   /protein_id="CAL64037.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGITDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPWQAPALTNLTREELLAQIQKNIRHEVLEDNVGYLRLDDLPGQEVLSELE
FT                   EFLVSHVWEQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVKVTGPRETSSRPETGPNDPPAATPEVPKEEDARRAVVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLGPYVLQQVWEP"
XX
SQ   Sequence 1262 BP; 274 A; 357 C; 369 G; 262 T; 0 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     acagatcctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgat       120
     ccacgtctct tcatctccta tgagcccagc accctcgagg ctccctggca agcaccagcg       180
     ctcaccaacc tcacccggga agaactgctg gcccagatac agaagaacat ccgtcatgag       240
     gttcttgagg acaacgtagg ctacctacga ctggatgacc tccctggcca ggaggtactg       300
     agtgagcttg aggagttctt agtgagccat gtgtgggagc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctgtgctggt ggccatgtct ctggcatccc ttatgtcatc       420
     tcctacttgc accctggaaa cactgtcatg cacgtagata ccatctacga tcgtccctct       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgatccttac cagtggacat actgggggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacggaggg tggtgccctg       660
     gacctccaga agctgagaat aggtcagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg cagtgtcgga ggatcccagg      1020
     ctcctggtga aagtcactgg gcctagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagctacccc tgaggtgccc aaggaggaag atgcccggag ggccgtagtg      1140
     gactctgtgt ttcaagtgtc cgtgctgcca ggcaatgtgg gctacctacg cttcgacaga      1200
     tttgcagacg cctctgtgct gaagacactg ggtccttatg tgctgcagca agtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer