spacer

EBI Dbfetch

ID   AM408329; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408329;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Grammomys gazellae partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Grammomys gazellae
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Grammomys.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 946e4a6372e234c8fdf8e19dd97ccd00.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Grammomys gazellae"
FT                   /mol_type="genomic DNA"
FT                   /country="Central African Republic"
FT                   /collected_by="L. Granjon"
FT                   /tissue_lib="T-1092"
FT                   /db_xref="taxon:408722"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW91"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW91"
FT                   /protein_id="CAL64036.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTNLTREELLAQIQKNIRHEVLEGNVGYLRVDDLPGQEVLSELE
FT                   EFLVSHVWEQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRHA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRVTGPRETSSRPETGPNDPPAATPEVPKEEDARRALVESVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLGPYVLQQVWEP"
XX
SQ   Sequence 1262 BP; 278 A; 359 C; 361 G; 259 T; 5 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tytgggcatc        60
     tcagatcctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctct tcatctccta tgagcccagc acccttgagg ctccccagca agcaccagcg       180
     ctcaccaacc tcacccggga agaactgctg gcccagatac agaagaacat ccgtcatgag       240
     gttcttgagg gcaacgtagg ctacctacga gtggatgacc tccctggcca ggaggtactg       300
     agtgagcttg aggagttctt agtgagccat gtgtgggagc agctcatggg cacatcctcc       360
     ctggtgctag atctccggca ctgtgctggt ggccacgtct cgggcatccc ctacgtcatc       420
     tcctacttgc accctggaaa cactgtcatg cacgtagata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgatccttac cagtggacat actgggggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggaccgargg tggtgccctg       660
     gacctccaga agctgagaat aggtcagtcc aacttcttcc tcacagtgcc tgtgtccagr       720
     tccctgggac ccttaggtgg aggtggccag acttgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcat       840
     gccctgccag gagttgttct ccgacttcag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctatt gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggact tggtgacaaa actcaatgct ggcttacagg cagtgtcaga ggatcccagg      1020
     ctcctggtga gagtcactgg gcccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagccacccc tgaggtgccc aargaagaag atgcccggag ggccctagtg      1140
     gagtctgtgt ttcaagtgtc cgtgctrcca ggcaatgtgg gctacctgcg cttcgacaga      1200
     tttgcagacg cctctgtgct gaagacactg ggcccttatg tgctgcagca agtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer