spacer

EBI Dbfetch

ID   AM408328; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408328;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Rattus rattus partial IRBP gene for interphotoreceptor retinoid binding
DE   protein XX
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Rattus rattus (black rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; d99af0ea05efe1c80854958f8c9bb99a.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Rattus rattus"
FT                   /mol_type="genomic DNA"
FT                   /country="Pakistan:Islamabad"
FT                   /collected_by="Waheedud Din"
FT                   /tissue_lib="T-660"
FT                   /db_xref="taxon:10117"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW90"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW90"
FT                   /protein_id="CAL64035.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTVGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTDLTREELLAQIQRNIRHEVLEDNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWEQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSDFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETPSRPETGPNEPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLGPYVLRQVWEP"
XX
SQ   Sequence 1262 BP; 259 A; 369 C; 384 G; 250 T; 0 other;
     ctgatgggaa tgcaagcagc gattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcggaccctc agacgctggc ccatgtgctg acagttggag tccagagctc tttgaatgac       120
     ccacgtctct tcatctccta tgagcccagc accctcgagg ccccccagca agcaccagca       180
     ctcaccgacc tcacccgaga agagctgctg gcccagatac agaggaacat ccgccatgag       240
     gttcttgagg ataacgtggg ctacctacga gtggatgatc tccctggaca ggaggtactg       300
     agtgagctgg gggagttcct agtgagccat gtgtgggagc agctcatggg cacctcctcc       360
     ttggtactag atctccgtca ctgtgctggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cacagtcttg catgtggata ccatctacga tcggccctcc       480
     aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacac actgggggag tagccgagga catcgcttac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc ggacggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtcc gactttttcc ttacagtgcc tgtgtccagg       720
     tccctggggc ccctaggtgg aggcggccaa acgtgggaag gcagcggggt gctgccctgt       780
     gtggggatac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gcgttgtcct ccgactccag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gccagcatgg actactcggc cgtggtctcc       960
     gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctggtga gagccaccgg acccagagaa accccctcaa gacctgagac tggccctaac      1080
     gagccaccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     gactccgtgt ttcaggtgtc cgtgctgccg ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagatg cctctgtgct gaagacactg ggcccctatg tgctgcggca ggtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer