spacer

EBI Dbfetch

ID   AM408326; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408326;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Praomys jacksoni partial IRBP gene for interphotoreceptor retinoid binding
DE   protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Praomys jacksoni
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Praomys.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; f2cdc9a2267ffa882152a919f5910b60.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Praomys jacksoni"
FT                   /mol_type="genomic DNA"
FT                   /country="Burundi:Ruvubu"
FT                   /collected_by="T. Maddalena"
FT                   /tissue_lib="T-457"
FT                   /db_xref="taxon:209866"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW88"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW88"
FT                   /protein_id="CAL64033.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTNLTREELLAQIQRNIHHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWKQLMGTSSLVLDLRHCTGGHVSGIPYVISYLNPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRQA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETSSRPETGPNDPPAXTPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLRTLGPYVLQQVWEP"
XX
SQ   Sequence 1262 BP; 268 A; 365 C; 373 G; 255 T; 1 other;
     ctgatgggaa tgcaagcagc catcgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag tacagagttc cttgaatgac       120
     ccacgtctct tcatctccta tgagcccagt acccttgagg ctccccagca agcaccagcg       180
     ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat ccaccatgag       240
     gttcttgagg gcaacgtggg ctacctacga gtggatgacc tcccaggcca ggaggtactg       300
     agcgagctgg gggagttttt agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttggtgctcg atctccggca ctgcactggt ggccatgtct ctgggatccc ttatgtcatc       420
     tcttacttga accctgggaa cactgtcatg cacgtggata ccatctacga tcggccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gggagagata cagtgctgac       540
     aaggatgtgg tggtcctcac cagtggacat actgggggag tcgctgagga catcgcctac       600
     atcctcaagc agatgcgccg ggccatcgtg gtgggtgagc ggacggaggg tggtgccctg       660
     gacctccaga agctgagaat aggccagtcc aacttcttcc ttaccgtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaagccctgg ccatcctcac cctgcgtcaa       840
     gccctgccag gggttgttct ccgacttcag gaagccttac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgtt gcaccacctg gccagcatgg actattcggc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaacgct ggcttgcagg ctgtgtccga agatcccagg      1020
     ctcctggtga gagccaccgg acccagagaa acctcctcaa gacctgagac tggacctaat      1080
     gatcccccag carccacccc tgaggtgccc aaggaagaag atgcccggag ggccctggtg      1140
     gattctgtgt ttcaggtgtc cgtgctgcca ggcaatgtgg gctacctgcg ctttgacaga      1200
     tttgcagacg cctctgtgct gaggacgctg ggcccttatg tgctgcagca ggtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer