spacer

EBI Dbfetch

ID   AM408324; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408324;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Oenomys hypoxanthus partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Oenomys hypoxanthus (rufous-nosed rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Oenomys.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; d061ed9ba54b6dd9614ce17372009f0a.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Oenomys hypoxanthus"
FT                   /mol_type="genomic DNA"
FT                   /country="Republic of the Congo:Menengue"
FT                   /collected_by="L. Granjon"
FT                   /tissue_lib="T-788"
FT                   /db_xref="taxon:332668"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW86"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW86"
FT                   /protein_id="CAL64031.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAQVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALNNLTREELLAQIQKNIHHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EFLVSHVWEQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSGHTRGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPREASSRPETGPNDPPAATPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTLGPYVLQQVWEP"
XX
SQ   Sequence 1262 BP; 276 A; 362 C; 367 G; 257 T; 0 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagatcctc agacgctggc ccaagtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctct tcatctccta tgagcccagc accctcgagg ctccccagca agcaccagcg       180
     ctcaacaacc tcacccggga agaactgctg gcccagatac agaagaacat ccatcatgag       240
     gttcttgagg gcaacgtagg ctacctacga gtggatgacc tccctggcca ggaggtactg       300
     agtgagcttg gggagttctt agtgagccat gtgtgggagc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctgtgctggt ggccatgtct ctggcatccc ttatgtcatc       420
     tcctacttgc accctggaaa cactgtcatg cacgtggata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgat       540
     aaggatgtgg tgatcctcac cagtggacat actaggggag tggctgagga catcgcctac       600
     atcctcaagc agatgcgcag ggccatcgtg gtgggtgagc gaacggaggg tggtgccctg       660
     gatctccaga agctgagaat aggtcagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt tctgccctgt       780
     gtgggaacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgc       840
     gccctgccag gggttgtcct ccgacttcaa gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg cggtgtcaga ggatcccagg      1020
     ctcctggtga gagccactgg gcccagagaa gcctcctcaa gacccgagac tgggcctaat      1080
     gaccccccag cagccacccc tgaggtgccc aaggaagaag atgcccggag ggccctagta      1140
     gactctgtgt ttcaagtgtc cgtgctgcca ggcaatgtgg gctacctgcg cttcgacaga      1200
     tttgcagatg cctctgtgct gaagacactg ggcccttatg tgctgcagca ggtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer