spacer

EBI Dbfetch

ID   AM408323; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408323;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Niviventer niviventer partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Niviventer niviventer (white-bellied rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Niviventer.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 3da49d3737d155ba109f48ed4bb91979.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Niviventer niviventer"
FT                   /mol_type="genomic DNA"
FT                   /country="Viet Nam:Cao Phong, Province Hoa, Binh"
FT                   /collected_by="Cao Van Sung"
FT                   /tissue_lib="T-1086"
FT                   /db_xref="taxon:83757"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW85"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW85"
FT                   /protein_id="CAL64030.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQTPALTNLTREELLAQIQRNIRHDVLEGNVGYLRVDDLPGQEVLSXLG
FT                   EFLVSHVWKQLMDTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVLHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATGPRETPSRPETVPNDPPAVTPEVPKEEAARRALVDSVFQVSVLPGNVGYLRFD
FT                   SFADASVLRTLGPYVLQQVWEP"
XX
SQ   Sequence 1262 BP; 263 A; 364 C; 373 G; 255 T; 7 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagaccctc agacgctggc ccacgtgctg acagctggag tccagagctc tctgaatgac       120
     ccacgtctct tcatttccta tgaaccyagc accctcgagg ctccccagca aacaccagca       180
     ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat ccgccatgat       240
     gttcttgagg gtaacgtggg ctacctacga gtggatgatc tccctggcca ggaggtactg       300
     agtgakctgg gggagttcct ggtgagccat gtgtggaagc agctcatgga cacctcttcc       360
     ttggtgctag atctccggca ctgtgctggm ggccatgtct cygggatccc ttatgtcatc       420
     tcctacttgc accctgggaa cacagtcttg cacgtggata ccatctatga ccggccctcc       480
     aacaccacca cagagatctg gaccttgcct aaggtcctgg gggagagata cagtgctgac       540
     aaggacgtgg tggtcctcac cagtggacac accgggggag tagctgagga tatagcctac       600
     attcttaagc agatgcgaag ggccatcgtg gtgggtgagc ggacggaggg tggcgccctg       660
     gacctccaga agctgagaat aggccagtcc aacttcttcc tcacggtgcc tgtttccagg       720
     tctctggggc ccctgggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggatac ctgcagagca agccctagaa aaggccctgg ccattctcac cctgcgccgt       840
     gccctgcctg gggttgtcct ccgacttcag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc ctggcctgct gcaccacttg gccagcatgg actactcggc cgtggtctcc       960
     gaagaggacc tggtgacaaa gctcaatgct ggtttgcagg ctgtgtcrga ggaccccagg      1020
     ctcctggtga gagccaccgg acccagagaa accccctcaa gacctgagac tgtacctaat      1080
     gaccctccag cagtcacccc tgaggtgccc aaggaagaag ctgcccggag ggccctagtg      1140
     gactctgtgt tycaggtgtc cgtgctgcca ggcaacgtgg gctacctgcg ctttgacagc      1200
     tttgcagacg cctctgtgct gaggacactg ggyccttatg tgctgcagca ggtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer