spacer

EBI Dbfetch

ID   AM408321; SV 1; linear; genomic DNA; STD; ROD; 1262 BP.
XX
AC   AM408321;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Lemniscomys striatus partial IRBP gene for interphotoreceptor retinoid
DE   binding protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Lemniscomys striatus (typical striped grass mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Lemniscomys.
XX
RN   [1]
RP   1-1262
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 009cf19451a5465a96f0f1f36d9df3cb.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1262
FT                   /organism="Lemniscomys striatus"
FT                   /mol_type="genomic DNA"
FT                   /country="Democratic Republic of the Congo:Tchissanga"
FT                   /collected_by="L. Granjon"
FT                   /tissue_lib="T-789"
FT                   /db_xref="taxon:121567"
FT   CDS             <1..>1262
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW83"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW83"
FT                   /protein_id="CAL64028.1"
FT                   /translation="LMGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQAPALTNLTLEELLTQLQKNIHHEVLEGNVGYLRMDDLPGQEILSELE
FT                   EFLVSHMWGQLMGTSSLVLDLRHCAGGHVSGIPYIISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSRHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQKALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRVTGPRETSSRPETGPNDPPAAMPELPKEEDARRALVDAVFQVSVLPGNVGYLRFD
FT                   GFADASVLTTLGPYLLQQVWEP"
XX
SQ   Sequence 1262 BP; 280 A; 361 C; 357 G; 264 T; 0 other;
     ctgatgggaa tgcaagccgc cattgagcag gctatgaaga gtcatgagat tctggacatc        60
     tcagatcctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctct tcatctccta cgagcccagc accctcgagg ctccccagca agcaccagcg       180
     ctcaccaacc tcaccctgga agaactgctg acccagctac agaagaacat ccatcatgag       240
     gttcttgagg gcaacgtagg ctacctacga atggatgacc tccctggcca ggagatactg       300
     agtgagcttg aggagttttt agtgagccat atgtgggggc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctgtgctggt ggccatgtct ctggcatccc ttacatcatc       420
     tcttacttgc accctggaaa cactgtcatg cacgtagata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgatccttac cagtagacat actgggggag tggctgagga cattgcctac       600
     atcctcaagc agatgcgcag ggccattgtg gtaggtgagc ggacggaggg tggtgccctg       660
     gacctccaga agctcagaat aggtcagtcc aacttcttcc tcacagtgcc tgtatccagg       720
     tccctaggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgccgt       840
     gccctgccag gggttgtcct ccgacttcag aaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gctagcatgg actactcagc tgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg cggtgtcaga ggatcccagg      1020
     ctcctggtga gagtcactgg gcccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagccatgcc tgaattgccc aaggaagaag atgcccggag ggccctagtg      1140
     gacgctgtgt ttcaagtgtc cgtgctgcca ggcaatgtgg gctacttgcg cttcgatgga      1200
     tttgcagacg cctctgtgct gacgacactg ggcccttatc tgctgcagca agtgtgggag      1260
     cc                                                                     1262
//


spacer
spacer