spacer

EBI Dbfetch

ID   AM408320; SV 1; linear; genomic DNA; STD; ROD; 1256 BP.
XX
AC   AM408320;
XX
DT   26-JUL-2007 (Rel. 92, Created)
DT   26-JUL-2007 (Rel. 92, Last updated, Version 1)
XX
DE   Hylomyscus stella partial IRBP gene for interphotoreceptor retinoid binding
DE   protein
XX
KW   interphotoreceptor retinoid binding protein; IRBP gene.
XX
OS   Hylomyscus stella (Stella wood mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Hylomyscus.
XX
RN   [1]
RP   1-1256
RA   Chevret P.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Chevret P., Equipe Laudet, LBMC (UMR 5161), Ecole Normale Superieure de
RL   Lyon, 46 Allee d'Italie, 69364 Lyon CEDEX 07, FRANCE.
XX
RN   [2]
RA   Michaux J., Chevret P., Renaud S.;
RT   "Morphological diversity of Old World rats and mice (Rodentia, Muridae)
RT   mandible in relation with phylogeny and adaptation";
RL   J. Zool. Syst. Evol. Res. 45(3):263-279(2007).
XX
DR   MD5; 53824564d736f0aee3d652c6314da76d.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1256
FT                   /organism="Hylomyscus stella"
FT                   /mol_type="genomic DNA"
FT                   /country="Burundi:Teza"
FT                   /collected_by="T. Maddalena"
FT                   /tissue_lib="T-477"
FT                   /db_xref="taxon:41265"
FT   CDS             <1..>1256
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:A7DW82"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A7DW82"
FT                   /protein_id="CAL64027.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQEPALTNLTREELLAQIQRNIHHEVLEGNVGYLRVDDLPGQEVLSELG
FT                   EVLVSHVWKQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSAEKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRATEPRETSSRPETGDPPAATPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFDRF
FT                   ADASVLRTLGPYVLQQVWEP"
XX
SQ   Sequence 1256 BP; 267 A; 361 C; 375 G; 253 T; 0 other;
     ctgatgggaa tgcaggcagc catcgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagaccctc agacgctggc ccatgtgctg acagctggag tacagagttc cttgaatgac       120
     ccacgtctct tcatctccta tgagcccagt accctcgagg ctccccagca agaaccagca       180
     ctcaccaacc tcacccgaga agaactgctg gcccagatac agaggaacat ccaccatgag       240
     gttcttgagg gcaacgtggg ctacctacga gtggatgacc tcccgggcca ggaggtactg       300
     agcgagctgg gggaggtttt agtgagccat gtgtggaagc agctcatggg cacctcctcc       360
     ttagtgctcg atctccggca ctgtgctggt ggccatgttt ctgggatccc ttatgtcatc       420
     tcttacttgc accctgggaa cactgtcatg cacgtggata ccatctatga tcggccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gggagagata cagtgctgag       540
     aaggatgtgg tggtcctcac cagtggacat actgggggag tcgctgagga catcgcctac       600
     atcctcaagc agatgcgccg ggccattgtg gtgggtgagc ggacagaagg tggtgccctg       660
     gacctccaga agctgagaat aggccagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagcggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccttgg ccatcctcac cctgcgtcgg       840
     gccctgccag gggttgtcct ccgacttcag gaagccctac aggactatta cacattagtg       900
     gaccgagtgc cgggcctgct gcaccacctg gccagcatgg actattcagc tgtggtctct       960
     gaagaggacc tggtgacaaa gctcaacgct ggcttgcagg ctgtgtccga agatcccagg      1020
     ctcctggtga gagccaccga acccagagaa acctcctcaa gacctgagac tggagatccc      1080
     ccagcagcca cccctgaggt gcccaaggaa gaagatgccc gcagggccct agtggattct      1140
     gtgtttcagg tgtctgtgct gccgggcaat gtgggctacc tgcgctttga cagatttgca      1200
     gacgcctctg tgctgaggac gctgggccct tatgtgctgc agcaggtgtg ggagcc          1256
//


spacer
spacer