Dbfetch

ID   AM408111; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   AM408111;
XX
DT   12-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24new
DE   allele, isolate 166914, exons 2-3
XX
KW   HLA-A gene; HLA-A*24new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Witter K.;
RT   ;
RL   Submitted (10-OCT-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "A novel HLA-A24, A*24xx was found in HLA routine typing";
RL   Unpublished.
XX
DR   MD5; 503e99a0620cc3008dda0a704a96f168.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /isolate="166914"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="IMGT/HLA:A*24:67"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q05FZ4"
FT                   /protein_id="CAL59585.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   intron          271..511
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
XX
SQ   Sequence 787 BP; 144 A; 256 C; 278 G; 109 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       720
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//