Dbfetch

ID   AM400970; SV 1; linear; genomic DNA; STD; HUM; 771 BP.
XX
AC   AM400970;
XX
DT   21-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*03new
DE   allele, exon 2 and 3
XX
KW   HLA-DQB1 gene; HLA-DQB1*03new allele; human leucocyte antigen DQB1;
KW   major histocompatibility complex; MHC class II anitgen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-771
RA   Witter K.;
RT   ;
RL   Submitted (18-SEP-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   Max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00848.x.
RX   PUBMED; 17559588.
RA   Witter K., Mautner J., Albert T., Zahn R., Kauke T.;
RT   "HLA-DQB1*0319, a novel HLA-DQB1 allele, shows strong haplotype association
RT   to HLA-DRB1*1102";
RL   Tissue Antigens 70(1):73-75(2007).
XX
DR   MD5; bb8203888febdbb50e8091bc2db61dd8.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..771
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,490..>771)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /product="MHC class II anitgen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:19"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="CAL47037.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHG
FT                   DVYTCHVEHPSLQNPIIVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=2
FT   intron          271..389
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=2
FT   gap             390..489
FT                   /estimated_length=unknown
FT   exon            490..>771
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03new"
FT                   /number=3
FT   variation       760
FT                   /replace="c"
FT                   /compare=L34096.1
XX
SQ   Sequence 771 BP; 143 A; 205 C; 207 G; 116 T; 100 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     aggtgtaccg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag gtgagcgtcg tcgccccgct gcgaggccca       300
     ctcttggccg gggccccgag tctctgcgct aggagggacg aggggggcga agcctctgga       360
     acctgagccg cgttcgttcc accccagggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnt ggagcccaca gtgaccatct ccccatccag gacagaggcc ctcaaccacc       540
     acaacctgct ggtctgctca gtgacagatt tctatccagc ccagatcaaa gtccggtggt       600
     ttcggaatga ccaggaggag acaaccggcg ttgtgtccac cccccttatt aggaacggtg       660
     actggacctt ccagatcctg gtgatgctgg aaatgactcc ccagcatgga gacgtctaca       720
     cctgccacgt ggagcacccc agcctccaga accccatcat cgtggagtgg c                771
//