spacer

EBI Dbfetch

ID   AM400237; SV 1; linear; genomic DNA; STD; HUM; 388 BP.
XX
AC   AM400237;
XX
DT   15-SEP-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*06new
DE   allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*06new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-388
RA   Witter K.;
RT   ;
RL   Submitted (15-SEP-2006) to the INSDC.
RL   Witter K., University of Munich, Laboratory of Immunogenetics,
RL   max-Lebsche-Platz 32, 81377 Munich, GERMANY.
XX
RN   [2]
RA   Witter K.;
RT   "2 novel DQB1-06 alleles,DQB1*0628 and DQB1*060302 are found in routine
RT   HLA-DQB1 SBT typing";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.2006.00733.x.
RX   PUBMED; 17212715.
RA   Witter K., Albert T., Zahn R., Kauke T.;
RT   "A novel HLA-DQB1*06 allele, DQB1*0628, found through routine
RT   sequence-based HLA typing and confirmation of DQB1*060302";
RL   Tissue Antigens 69(1):102-103(2007).
XX
DR   MD5; 4cfbf7be46c67a17da25a3fe21fe2760.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..388
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>283
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0E4W4"
FT                   /db_xref="IMGT/HLA:DQB1*06:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0E4W4"
FT                   /protein_id="CAL45572.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRGERRR"
FT   exon            1..283
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*06new"
FT                   /number=2
XX
SQ   Sequence 388 BP; 78 A; 105 C; 138 G; 67 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag gtgagcgtcg tcgcccctcc gtgaggccca       300
     cccttggccg agaccccgag tttctgtgcc gggaggggcg atgggggcga ggtctctgaa       360
     atctgagccc agttcattcc accccagg                                          388
//


spacer
spacer