spacer

EBI Dbfetch

ID   AM295982; SV 1; linear; genomic DNA; STD; HUM; 3306 BP.
XX
AC   AM295982;
XX
DT   04-AUG-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*5711 allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*5711 allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3306
RA   Cox S.T.;
RT   ;
RL   Submitted (03-AUG-2006) to the INSDC.
RL   Cox S.T., The Royal Free Hospital, Anthony Nolan Research Institute, Pond
RL   Street, Hampstead, London, NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   Cox S.T.;
RT   "Sequence of B*5711";
RL   Unpublished.
XX
DR   MD5; 66b4e723563c1e4a79cc9233cbc2d5fb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3306
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(285..357,486..755,1002..1277,1853..2128,2233..2349,
FT                   2791..2823,2930..2973)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0VJ75"
FT                   /db_xref="IMGT/HLA:B*57:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VJ75"
FT                   /protein_id="CAL30081.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHTLQWMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   exon            285..357
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=1
FT   intron          358..485
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=1
FT   exon            486..755
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=2
FT   intron          756..1001
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=2
FT   exon            1002..1277
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=3
FT   variation       1011
FT                   /allele="HLA-B*5701"
FT                   /replace="t"
FT   variation       1013
FT                   /allele="HLA-B*5701"
FT                   /replace="a"
FT   variation       1019
FT                   /allele="HLA-B*5701"
FT                   /replace="g"
FT   variation       1020
FT                   /allele="HLA-B*5701"
FT                   /replace="t"
FT   intron          1278..1852
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=3
FT   exon            1853..2128
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=4
FT   intron          2129..2232
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=4
FT   exon            2233..2349
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=5
FT   intron          2350..2790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=5
FT   exon            2791..2823
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=6
FT   intron          2824..2929
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=6
FT   exon            2930..2973
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5711"
FT                   /number=7
XX
SQ   Sequence 3306 BP; 607 A; 962 C; 1049 G; 688 T; 0 other;
     gatcaggacg aagtcccagg tcccggacgg ggctctcagg gtctcaggct ccgagagcct        60
     tgtctgcatt ggggaggcgc agcgttgggg attccccact cccacgagtt tcacttcttc       120
     tcccaacctg tgtcgggtcc ttcttccagg atactcgtga cgcgtcccca tttcccactc       180
     ccattgggtg tcgggtgtct agagaagcca atcagcgtcg ccgcggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagaatct cctcagacgc cgagatgcgg gtcacggcac       300
     cccgaaccgt cctcctgctg ctctgggggg cagtggccct gaccgagacc tgggccggtg       360
     agtgcgggtc ggcagggaaa tggcctctgt agggaggagc aaggggaccg caggcggggg       420
     cgcaggaccc ggggagccgc gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcta caccgccatg tcccggcccg gccgcgggga       540
     gccccgcttc atcgcagtgg gctacgtgga cgacacccag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgaggatgg cgccccgggc gccatggata gagcaggagg ggccggagta       660
     ttgggacggg gagacacgga acatgaaggc ctccgcgcag acttaccgag agaacctgcg       720
     gatcgcgctc cgctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacgtacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccacccccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc agggcggggc       960
     ggggctcggg gggacggggc tgaccgcggg gccggggcca gggtctcaca ccctccagtg      1020
     gatgtatggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcatg accagtccgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga      1140
     cacggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagctgag      1200
     agcctacctg gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1260
     gacgctgcag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctaggacaat taagggatga cgtctctgag gaaatggagg ggaagacagt ccctagaata      1500
     ctgatcaggg gtcccctttg acccctgcag cagccttggg aaccgtgact tttcctctca      1560
     ggccttgttc tctgcctcac actcagtgtg tttggggctc tgattccagc acttctgagt      1620
     cactttacct ccactcagat caggagcaga agtccctgtt ccccgctcag agactcgaac      1680
     tttccaatga ataggagatt atcccaggtg cctgcgtcca ggctggtgtc tgggttctgt      1740
     gccccttccc caccccaggt gtcctgccca ttctcaggct ggtcacatgg gtggtcctag      1800
     ggtgtcccat gagagatgca aagcgcctga attttctgac tcttcccatc agacccccca      1860
     aagacacatg tgacccacca ccccatctct gaccatgagg ccaccctgag gtgctgggcc      1920
     ctgggcttct accctgcgga gatcacactg acctggcagc gggatggcga ggaccaaact      1980
     caggacaccg agcttgtgga gaccagacca gcaggagata gaaccttcca gaagtgggca      2040
     gctgtggtgg tgccttctgg agaagagcag agatacacat gccatgtaca gcatgagggg      2100
     ctgccaaagc ccctcaccct gagatggggt aaggaggggg atgaggggtc atatctcttc      2160
     tcagggaaag caggagccct tctggagccc ttcagcaggg tcagggcccc tcatcttccc      2220
     ctcctttccc agagccatct tcccaatcca ccgtccccat cgtgggcatt gttgctggcc      2280
     tggctgtcct agcagttgtg gtcatcggag ctgtggtcgc tgctgtgatg tgtaggagga      2340
     agagctcagg tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt      2400
     ttcaagcccc aggtagaagt gttccctgcc tcattactgg gaagcagcat gcacacaggg      2460
     gctaacgcag cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca      2520
     atgaaggacg gatgtatcac ctcgatggtt gtggtgttgg ggtcctgatt ccagcattca      2580
     tgagtcaggg gaaggtccct gctaaggaca gaccttagga gagcagttgg tccaggaccc      2640
     acacttgctt tcctcgtgtt tcctgatcct gccctgggtc tgtagtcata cttctggaaa      2700
     ttccttttgg gtccaagacg aggaggttcc tctaagatct catggccctg cttcctccca      2760
     gtcccctcac aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg      2820
     cgtgtaagtg gtgggggtgg gagtgtggag gagctcaccc accccataat tcctcctgtc      2880
     ccacgtctcc tgcgggctct gaccaggtcc tgtttttgtt ctactccagg cagcgacagt      2940
     gcccagggct ctgatgtgtc tctcacagct tgaaaaggtg agattcttgg ggtctagagt      3000
     gggtgggggt ggcgggtctg gggcggggtg gggcagaggg gaaaggcctg ggtaatggag      3060
     attctttgat tgggatgttt cgcgtgtgtg gtgggctgtt cagagtgtca tcacttacca      3120
     tgactcacca gaatttgttc atgactgttg ttttctgtag cctgagacag ctgtcttgtg      3180
     agggactgag atgcaggatt tcttcacgcc tcccctttgt gacttcaaga gcctctggca      3240
     tctctttctg caaaggcacc tgaatgtgtc tgcgtccctg ttagcctaat gtgaggaggt      3300
     ggagag                                                                 3306
//


spacer
spacer