spacer

EBI Dbfetch

ID   AM295793; SV 1; linear; genomic DNA; STD; PRO; 648 BP.
XX
AC   AM295793;
XX
DT   08-JAN-2007 (Rel. 90, Created)
DT   25-FEB-2009 (Rel. 99, Last updated, Version 2)
XX
DE   Mycobacterium fortuitum porM2 gene for porin M2 precursor, isolate 10860/03
XX
KW   porin M2; porM2 gene.
XX
OS   Mycobacterium fortuitum
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Corynebacterineae; Mycobacteriaceae; Mycobacterium.
XX
RN   [1]
RP   1-648
RA   Sharbati-Tehrani S.;
RT   ;
RL   Submitted (03-AUG-2006) to the INSDC.
RL   Sharbati-Tehrani S., Institute of Veterinary Biochemistry, Freie
RL   Universitaet Berlin, Oertzenweg 19b, 14163 Berlin, GERMANY.
XX
RN   [2]
RX   DOI; 10.1186/1471-2180-9-31.
RA   Sharbati S., Schramm K., Rempel S., Wang H., Andrich R., Tykiel V.,
RA   Kunisch R., Lewin A.;
RT   "Characterisation of porin genes from Mycobacterium fortuitum and their
RT   impact on growth";
RL   BMC Microbiol. 0:0-0(2009).
XX
DR   MD5; c755a24c702cec06409ed8273f64d9a8.
DR   EuropePMC; PMC2651896; 19203364.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..648
FT                   /organism="Mycobacterium fortuitum"
FT                   /isolate="10860/03"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="human patient"
FT                   /db_xref="taxon:1766"
FT   CDS             1..648
FT                   /transl_table=11
FT                   /gene="porM2"
FT                   /product="porin M2 precursor"
FT                   /db_xref="GOA:A1JUJ1"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR016183"
FT                   /db_xref="UniProtKB/TrEMBL:A1JUJ1"
FT                   /experiment="2D-PAGE"
FT                   /protein_id="CAL29811.1"
FT                   /translation="MLAFSRVLVALVTAMAGVFASLFVGTGVSHAGLDNELSLVDGQDR
FT                   TLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYTVAGPGADEFEGTLELGYQIGFPWS
FT                   LGVGINFSYTTPNILIDDGDITGPPFGLESVITPNLFPGVSISADLGNGPGIQEVATFS
FT                   VDVKGAAGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN"
FT   sig_peptide     1..93
FT                   /gene="porM2"
FT   mat_peptide     94..645
FT                   /gene="porM2"
FT                   /product="porin M2"
XX
SQ   Sequence 648 BP; 101 A; 209 C; 208 G; 130 T; 0 other;
     atgttggcat tcagtcgggt gctggtcgca ttggtgaccg cgatggcagg ggtcttcgca        60
     agcctcttcg tcggcacggg cgtatctcat gcgggtctgg acaatgaact gagcctggtt       120
     gatggtcagg atcggaccct gaccgttcag cagtgggaca ccttcctcaa cggtgtgttc       180
     cccctggacc gcaaccggct gacccgtgag tggttccatt ccggccgggc caagtacacc       240
     gtggccggcc cgggcgccga tgagttcgag ggcaccttgg agctgggcta tcagatcggc       300
     ttcccctggt cgctgggtgt cgggatcaac ttctcctaca ccacccccaa catcctgatc       360
     gacgacggtg acatcaccgg cccgcccttc ggcctggagt cggtcatcac gccgaacctt       420
     ttcccgggtg tgtcgatcag tgcggatctg ggcaacggcc cgggtatcca ggaagtcgcc       480
     accttctcgg tcgacgtcaa gggcgcggcc ggtggtgtgg cggtgtccaa cgcgcacggc       540
     accgtgaccg gtgcggccgg tggcgtgctg ctgcgtccgt tcgcccgcct gatcgcctcc       600
     accggtgaca gtgtcaccac ctacggcgaa ccctggaaca tgaactaa                    648
//


spacer
spacer