spacer

EBI Dbfetch

ID   AM295007; SV 1; circular; genomic DNA; STD; PRO; 1841271 BP.
XX
AC   AM295007;
XX
PR   Project:PRJNA270;
XX
DT   05-FEB-2007 (Rel. 90, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Streptococcus pyogenes Manfredo complete genome
XX
KW   complete genome.
XX
OS   Streptococcus pyogenes str. Manfredo
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-1841271
RA   Holden M.T.G.;
RT   ;
RL   Submitted (26-JUL-2006) to the INSDC.
RL   Holden M.T.G., Pathogen Sequencing Unit, Sanger Institute Wellcome Trust,
RL   Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1128/JB.01227-06.
RX   PUBMED; 17012393.
RA   Holden M.T.G., Scott A., Cherevach I., Chillingworth T., Churcher C.,
RA   Cronin A., Dowd L., Feltwell T., Hamlin N., Holroyd S., Jagels K.,
RA   Moule S., Mungall K., Quail M.A., Price C., Rabbinowitsch E., Sharp S.,
RA   Skelton J., Whitehead S., Barrell B.G., Kehoe M., Parkhill J.;
RT   "Complete genome of acute rheumatic fever-associated serotype M5
RT   Streptococcus pyogenes strain manfredo";
RL   J. Bacteriol. 189(4):1473-1477(2007).
XX
DR   MD5; c168b44171b93fee3a12c1235e208583.
DR   BioSample; SAMEA1705956.
DR   EuropePMC; PMC1797351; 17012393.
DR   EuropePMC; PMC2583620; 18820018.
DR   EuropePMC; PMC2657157; 19175920.
DR   EuropePMC; PMC2705793; 19603075.
DR   EuropePMC; PMC2884548; 20433696.
DR   EuropePMC; PMC3034890; 21103900.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02099; rivX.
DR   SILVA-LSU; AM295007.
DR   SILVA-SSU; AM295007.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1841271
FT                   /organism="Streptococcus pyogenes str. Manfredo"
FT                   /strain="Manfredo"
FT                   /serotype="M5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:160491"
FT   CDS             202..1557
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SpyM50001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="GOA:A2RBX3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29345.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVDKHIATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQISVDYVFEEDLMIEQNQTKINQKPKQQALNS
FT                   LPTVTSDLNSKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   IAAEAIRARKQDGPKMTVIPIEEIQAQVGKFYGVTVKEIKATKRTQNIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   misc_feature    535..1488
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SpyM50001"
FT                   /note="HMMPfam hit to PF00308, Bacterial dnaA protein,score
FT                   1.7e-156"
FT                   /inference="protein motif:HMMPfam:PF00308"
FT   misc_feature    655..678
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SpyM50001"
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    1429..1488
FT                   /gene="dnaA"
FT                   /gene_synonym="dnaH"
FT                   /locus_tag="SpyM50001"
FT                   /note="PS01008 DnaA protein signature."
FT                   /inference="protein motif:Prosite:PS01008"
FT   CDS             1712..2848
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM50002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GOA:A2RBX4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBX4"
FT                   /protein_id="CAM29346.1"
FT                   /translation="MIQFSINRTLFIHALNATKRAISTKNAIPILSSIKIEVTPTGVTL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGAILLEASFFINIISSLPDISINVKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDEEESFIQLITPVRTN"
FT   misc_feature    1715..2092
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM50002"
FT                   /note="HMMPfam hit to PF00712, DNA polymerase III beta
FT                   subunit, N-te, score 2.1e-26"
FT                   /inference="protein motif:HMMPfam:PF00712"
FT   misc_feature    2117..2464
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM50002"
FT                   /note="HMMPfam hit to PF02767, DNA polymerase III beta
FT                   subunit, cent, score 1.9e-34"
FT                   /inference="protein motif:HMMPfam:PF02767"
FT   misc_feature    2468..2839
FT                   /gene="dnaN"
FT                   /locus_tag="SpyM50002"
FT                   /note="HMMPfam hit to PF02768, DNA polymerase III beta
FT                   subunit, C-te, score 3.2e-29"
FT                   /inference="protein motif:HMMPfam:PF02768"
FT   CDS             2923..3120
FT                   /transl_table=11
FT                   /locus_tag="SpyM50003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBX5"
FT                   /protein_id="CAM29347.1"
FT                   /translation="MYQIGSFVEMKKPHACVIKETGKKANQWKVLRVGADIKIQCTNCQ
FT                   HVIMMSRYDFERKLKKVLQP"
FT   misc_feature    2923..3114
FT                   /locus_tag="SpyM50003"
FT                   /note="HMMPfam hit to PF06107, Bacterial protein of unknown
FT                   function (DUF95, score 1.4e-47"
FT                   /inference="protein motif:HMMPfam:PF06107"
FT   CDS             3450..4565
FT                   /transl_table=11
FT                   /locus_tag="SpyM50004"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="GOA:A2RBX6"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBX6"
FT                   /protein_id="CAM29348.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASRGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPIADIDTINLELILADLESINKRYARVEKMARTQKDKES
FT                   VAEFNVLQKIKPVLEDGKSARTIEFTEEEAKVVKGLFLLTTKPVLYVANVDEDKVANPD
FT                   GIDYVKQIRDFAATENAEVVVISARAEEEISELDDEDKEEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMIYGS
FT                   EKAVKEAGRLREEGKEYVVQDGDIMEFRFNV"
FT   misc_feature    3456..3905
FT                   /locus_tag="SpyM50004"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown
FT                   function,score 1.4e-34"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    3474..3497
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    4308..4559
FT                   /locus_tag="SpyM50004"
FT                   /note="HMMPfam hit to PF06071, Protein of unknown function
FT                   (DUF933), score 5.3e-60"
FT                   /inference="protein motif:HMMPfam:PF06071"
FT   CDS             4635..5204
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SpyM50005"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="GOA:A2RBX7"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /protein_id="CAM29349.1"
FT                   /translation="MVKMIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFK
FT                   AQIGSTFINHEKVYFVKPTTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRL
FT                   RSKGSAGGHNGIKSIIAHIGTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLT
FT                   LDRVVNAVKFYLQENDFEKTMQKFNG"
FT   misc_feature    4644..5198
FT                   /gene="pth"
FT                   /locus_tag="SpyM50005"
FT                   /note="HMMPfam hit to PF01195, Peptidyl-tRNA
FT                   hydrolase,score 4.6e-76"
FT                   /inference="protein motif:HMMPfam:PF01195"
FT   misc_feature    4959..4991
FT                   /note="PS01196 Peptidyl-tRNA hydrolase signature 2"
FT                   /inference="protein motif:Prosite:PS01196"
FT   CDS             5207..8710
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /product="putative transcription-repair coupling factor"
FT                   /db_xref="GOA:A2RBX8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBX8"
FT                   /protein_id="CAM29350.1"
FT                   /translation="MDILELFSQNKKVQSWHSGLTTLGRQLVMGLSGSSKALAIASAYL
FT                   DDQKKIVVVTSTQNEVEKLASDLSSLLDEELVFQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSSLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFYPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQVQGIHR
FT                   DYVTIQYQNSDRISLPIDQIGSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYLVEVDVL
FT                   SRFRSKKEQAETLEHVQKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQIFYVYNKVDTIEKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KILTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYIADERQKIDIYKRIREIQSREDYLN
FT                   LQDELIDRFGEYPDQVAYLLEIALLKHYMDNAFAELVERKNNQVIVRFEVTSLSYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRHQKDYRILEELMLFGERLSEIKIRKNNSVF
FT                   K"
FT   misc_feature    6665..6958
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /note="HMMPfam hit to PF02559, CarD-like/TRCF domain,score
FT                   5.8e-51"
FT                   /inference="protein motif:HMMPfam:PF02559"
FT   misc_feature    7034..7522
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 1.5e-06"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    7040..7537
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   1e-37"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    7121..7144
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    7727..7960
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 5e-18"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    8240..8566
FT                   /gene="trcF"
FT                   /locus_tag="SpyM50006"
FT                   /note="HMMPfam hit to PF03461, TRCF domain, score 2.8e-47"
FT                   /inference="protein motif:HMMPfam:PF03461"
FT   CDS             8872..9144
FT                   /transl_table=11
FT                   /locus_tag="SpyM50007"
FT                   /product="S4 domain containing protein"
FT                   /db_xref="GOA:A2RBX9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBX9"
FT                   /protein_id="CAM29351.1"
FT                   /translation="MRLDKYLKVSRLIKRRSVAKEVADKGRIKVNGILAKSSTNVKLND
FT                   HIEISFGNKLLTVRVIEIKDSTKKEDALKMYEIISETRITLNEEA"
FT   misc_feature    8872..9012
FT                   /locus_tag="SpyM50007"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 1.3e-10"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   CDS             9131..9502
FT                   /transl_table=11
FT                   /locus_tag="SpyM50008"
FT                   /product="putative septum formation initiator protein"
FT                   /note="Weakly similar to Bacillus subtilis cell division
FT                   protein DivIC SWALL:DIVC_BACSU (SWALL:P37471) (125 aa)
FT                   fasta scores: E(): 0.84, 21.84% id in 119 aa"
FT                   /db_xref="GOA:A2RBY0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY0"
FT                   /protein_id="CAM29352.1"
FT                   /translation="MKKPSIVQLNNHYIKKENLKKKFEEEESQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVVKLKKEYNELSKSTKKEKQLAERLKDDNFVKKYARAK
FT                   YYLSREGEMIYPIPGLLPK"
FT   misc_feature    9239..9292
FT                   /locus_tag="SpyM50008"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50008 by TMHMM2.0 at aa 37-54"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             9499..9624
FT                   /transl_table=11
FT                   /locus_tag="SpyM50009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY1"
FT                   /protein_id="CAM29353.1"
FT                   /translation="MMMDNIIKKIEAFLAFSDKKLAELQQENQKVKEESQYIQKN"
FT   CDS             9637..10923
FT                   /transl_table=11
FT                   /locus_tag="SpyM50010"
FT                   /product="putative exported protein"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="GOA:A2RBY2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY2"
FT                   /protein_id="CAM29354.1"
FT                   /translation="MRKLLAAMLMTFFLTPLPVISTEKKLIFSKNAVYQLKQDVVQSTQ
FT                   FYNQLPSNPNLYQETCAYKDSDLTLPAGRLGVNQPLLIKSLVLNKESLPVFELADGTYV
FT                   EANRQLIYDDIVLNQVDIDSYFWTQKKLRLYSAPYVLGTQTIPSSFSFAQKVHATQMAQ
FT                   TNHGTYYLIDDKGWASQEDLVQFDNRMLKVQEMLLQKYNNPNYSIFVKQLNTQTSAGIN
FT                   ADKKMYAASISKLAPLYIVQKQLQKKKLAENKTLTYTKDVNHFYGDYDPLGSGKISKIA
FT                   DNKDYRVEDLLKAVAQQSDNVATNILGYYLCHQYDKAFRSEIKALSGIDWDMEQRLLTS
FT                   RSAANMMEAIYHQKGQIISYLSNTEFDQQRITKNITVPVAHKIGDAYDYKHDVAIVYGN
FT                   TPFILSIFTNKSTYEDITAIADDVYGILK"
FT   sig_peptide     9637..9699
FT                   /locus_tag="SpyM50010"
FT                   /note="Signal peptide predicted for SpyM50010 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.990) with cleavage
FT                   site probability 0.743 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             10920..12206
FT                   /transl_table=11
FT                   /locus_tag="SpyM50011"
FT                   /product="PP-loop family protein"
FT                   /note="N-terminus is weakly similar to the N-terminal
FT                   region Escherichia coli putative cell cycle protein MesJ
FT                   SWALL:MESJ_ECOLI (SWALL:P52097) (432 aa) fasta scores: E():
FT                   7.3e-12, 31.64% id in 237 aa"
FT                   /db_xref="GOA:A2RBY3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY3"
FT                   /protein_id="CAM29355.1"
FT                   /translation="MKTYQEIFNEIKNKAYFKNHRHVLIAVSGGVDSMNLLHFLYLFQD
FT                   KLKIRIGIAHVNHKQRSESDSEEAYLKCWAKKHDIPIYVSNFEGIFSEKAARDWRYAFF
FT                   KSIMLKNNYSALVTAHHSDDQAETILMRLIRGSRLRYLSGIKSVQPFANGQLIRPFLTF
FT                   SKKDLPEIFHFEDSSNRELSFLRNRVRNNYLPLLKQENPRFIQGLNQLALENSLLFQAF
FT                   KELTNHITTTDLTEFNEQSKSIQYFLLQDYLEGFPDLDLKKSQFTQLLQIIQTAKQGYY
FT                   YLKKDYYIFIDKFSFKITKIVPKTELVKEEKMLEYDSNLCYRDYYFSFMPKSNGDQGQV
FT                   SIPLFSLSSIKLRSRQSGDYISFGHFSKKIRRLFIDEKFTIAERQNAIIGEQDEQIIFV
FT                   LIGNKTYLRKACKHDIMLAKLYIDKLEKG"
FT   misc_feature    10980..11048
FT                   /locus_tag="SpyM50011"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50011 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    10983..11561
FT                   /locus_tag="SpyM50011"
FT                   /note="HMMPfam hit to PF01171, PP-loop family, score
FT                   1.1e-95"
FT                   /inference="protein motif:HMMPfam:PF01171"
FT   CDS             12211..12753
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SpyM50012"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /db_xref="GOA:A2RBY4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY4"
FT                   /protein_id="CAM29356.1"
FT                   /translation="MLEQDIQKILYSENDIIRKTKKLGEQLTKDYQEKNPLMIGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIIVEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVKIEADYVCYNIPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   misc_feature    12223..12657
FT                   /gene="hpt"
FT                   /locus_tag="SpyM50012"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 4.8e-34"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    12493..12531
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             12775..14754
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="SpyM50013"
FT                   /product="putative cell division protease FtsH"
FT                   /db_xref="GOA:A2RBY5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY5"
FT                   /protein_id="CAM29357.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKPQKVTVNSGLSFLGGRASTQVTEFSSLVL
FT                   PSDTILKEMTAAADKNGTELTVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKSLGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLANDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKIKIDASDIDEAEDRVIAGPSKKDRTISQKEREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKEDLKEQLAGLMGGRVAEEIVFNA
FT                   QTSGASNDFEQATQIARAMVTEYGMSEKLGPVQYEGNHAMMPGQISPEKAYSAQTAQMI
FT                   DDEVRELLNQARNQAADIINENRDTHKLIAEALLKYETLDAAQIKSIYETGKMPVDLET
FT                   DDNEAHALSYDEIKNKMTESESAE"
FT   misc_feature    join(12811..12867,13177..13245)
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="SpyM50013"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50013 by TMHMM2.0 at aa 13-31 and 135-157"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    12889..13362
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="SpyM50013"
FT                   /note="HMMPfam hit to PF06480, FtsH Extracellular, score
FT                   2e-37"
FT                   /inference="protein motif:HMMPfam:PF06480"
FT   misc_feature    13438..14001
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="SpyM50013"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various c, score 7e-92"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    13453..13476
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    13750..13806
FT                   /note="PS00674 AAA-protein family signature"
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    14017..14643
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /locus_tag="SpyM50013"
FT                   /note="HMMPfam hit to PF01434, Peptidase family M41, score
FT                   7e-111"
FT                   /inference="protein motif:HMMPfam:PF01434"
FT   CDS             15079..16470
FT                   /transl_table=11
FT                   /locus_tag="SpyM50014"
FT                   /product="putative amino acid permease"
FT                   /db_xref="GOA:A2RBY6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY6"
FT                   /protein_id="CAM29358.1"
FT                   /translation="MTIFRKKKKYSNKTEMQRHFKVIDLVFLGLGSMVGTGIFTVTGIG
FT                   AAKYAGPALTISIIISAITIGILALFYAEFASRMPSNGGAYSYVYATLGEFPAWLVGWY
FT                   IIMEFLTAISSVAVGWGSYLKGLLANYNIVLPNALNGTFNLKNGTYIDILPVLVMFFVT
FT                   GIVLMNSKLALRFNSFLVILKFSALALFIFVGIFFIDHNNWSHFAPYGVGQITGGKTGI
FT                   FAGASVMFFAFLGFESISMAVDEVKEPQKTIPKGIILSLIIVTALYIVVTTILTGIVHY
FT                   TKLNVPDAVAFALRNIRLYWAADYVSIVAILTLITVCISMTYALARTIYSISRDGLLPK
FT                   SLYTLTKKNKVPQNATLVTGLLAMICAGIFPLSSLAEFVNICTLAYLIILSGAIIKLRR
FT                   IEGEPKANEFKTPLVPFLPMLAIIICLSFMSQYKAFTWIAFAIATIIGILIYLAYGYTH
FT                   SIENK"
FT   sig_peptide     15079..15225
FT                   /locus_tag="SpyM50014"
FT                   /note="Signal peptide predicted for SpyM50014 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.433 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    15148..16467
FT                   /locus_tag="SpyM50014"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   2.4e-20"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   misc_feature    join(15151..15219,15229..15297,15331..15399,15520..15588,
FT                   15607..15675,15718..15786,15847..15915,16000..16068,
FT                   16129..16197,16210..16278,16315..16368,16378..16446)
FT                   /locus_tag="SpyM50014"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SpyM50014 by TMHMM2.0 at aa 25-47,
FT                   51-73,85-107,148-170,177-199, 214-236, 257-279,
FT                   308-330,351-373,378-400,413-430 and 434-456"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    15715..15738
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   rRNA            17043..18549
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            18636..18708
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:18669..18671,aa:Ala)"
FT   rRNA            19034..21907
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            21995..22110
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            22128..22200
FT                   /gene="tRNA-Val (TAC)"
FT                   /product="transfer RNA-Val (TAC)"
FT                   /anticodon="(pos:22161..22163,aa:Val)"
FT   tRNA            22218..22290
FT                   /gene="tRNA-Asp (GTC)"
FT                   /product="transfer RNA-Asp (GTC)"
FT                   /anticodon="(pos:22251..22253,aa:Asp)"
FT   tRNA            22322..22394
FT                   /gene="tRNA-Lys (TTT)"
FT                   /product="transfer RNA-Lys (TTT)"
FT                   /anticodon="(pos:22355..22357,aa:Lys)"
FT   tRNA            22400..22481
FT                   /gene="tRNA-Leu (TAG)"
FT                   /product="transfer RNA-Leu (TAG)"
FT                   /anticodon="(pos:22434..22436,aa:Leu)"
FT   tRNA            22492..22564
FT                   /gene="tRNA-Thr (TGT)"
FT                   /product="transfer RNA-Thr (TGT)"
FT                   /anticodon="(pos:22525..22527,aa:Thr)"
FT   tRNA            22577..22648
FT                   /gene="tRNA-Gly (GCC)"
FT                   /product="transfer RNA-Gly (GCC)"
FT                   /anticodon="(pos:22609..22611,aa:Gly)"
FT   tRNA            22657..22741
FT                   /gene="tRNA-Leu (TAA)"
FT                   /product="transfer RNA-Leu (TAA)"
FT                   /anticodon="(pos:22691..22693,aa:Leu)"
FT   tRNA            22758..22831
FT                   /gene="tRNA-Arg (ACG)"
FT                   /product="transfer RNA-Arg (ACG)"
FT                   /anticodon="(pos:22792..22794,aa:Arg)"
FT   tRNA            22838..22911
FT                   /gene="tRNA-Pro (TGG)"
FT                   /product="transfer RNA-Pro (TGG)"
FT                   /anticodon="(pos:22872..22874,aa:Pro)"
FT   rRNA            23044..24550
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            24637..24709
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:24670..24672,aa:Ala)"
FT   rRNA            25008..27908
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            27996..28111
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            28129..28201
FT                   /gene="tRNA-Val (TAC)"
FT                   /product="transfer RNA-Val (TAC)"
FT                   /anticodon="(pos:28162..28164,aa:Val)"
FT   tRNA            28219..28291
FT                   /gene="tRNA-Asp (GTC)"
FT                   /product="transfer RNA-Asp (GTC)"
FT                   /anticodon="(pos:28252..28254,aa:Asp)"
FT   tRNA            28323..28395
FT                   /gene="tRNA-Lys (TTT)"
FT                   /product="transfer RNA-Lys (TTT)"
FT                   /anticodon="(pos:28356..28358,aa:Lys)"
FT   tRNA            28401..28482
FT                   /gene="tRNA-Leu (TAG)"
FT                   /product="transfer RNA-Leu (TAG)"
FT                   /anticodon="(pos:28435..28437,aa:Leu)"
FT   tRNA            28493..28565
FT                   /gene="tRNA-Thr (TGT)"
FT                   /product="transfer RNA-Thr (TGT)"
FT                   /anticodon="(pos:28526..28528,aa:Thr)"
FT   tRNA            28578..28649
FT                   /gene="tRNA-Gly (GCC)"
FT                   /product="transfer RNA-Gly (GCC)"
FT                   /anticodon="(pos:28610..28612,aa:Gly)"
FT   tRNA            28658..28742
FT                   /gene="tRNA-Leu (TAA)"
FT                   /product="transfer RNA-Leu (TAA)"
FT                   /anticodon="(pos:28692..28694,aa:Leu)"
FT   tRNA            28759..28832
FT                   /gene="tRNA-Arg (ACG)"
FT                   /product="transfer RNA-Arg (ACG)"
FT                   /anticodon="(pos:28793..28795,aa:Arg)"
FT   tRNA            28839..28912
FT                   /gene="tRNA-Pro (TGG)"
FT                   /product="transfer RNA-Pro (TGG)"
FT                   /anticodon="(pos:28873..28875,aa:Pro)"
FT   tRNA            28918..28991
FT                   /gene="tRNA-Met (CAT)"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /anticodon="(pos:28952..28954,aa:Met)"
FT   tRNA            29012..29085
FT                   /gene="tRNA-Met (CAT)"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /anticodon="(pos:29046..29048,aa:Met)"
FT   tRNA            29108..29197
FT                   /gene="tRNA-Ser (TGA)"
FT                   /product="transfer RNA-Ser (TGA)"
FT                   /anticodon="(pos:29144..29146,aa:Ser)"
FT   tRNA            29220..29292
FT                   /gene="tRNA-Phe (GAA)"
FT                   /product="transfer RNA-Phe (GAA)"
FT                   /anticodon="(pos:29253..29255,aa:Phe)"
FT   tRNA            29305..29375
FT                   /gene="tRNA-Gly (TCC)"
FT                   /product="transfer RNA-Gly (TCC)"
FT                   /anticodon="(pos:29337..29339,aa:Gly)"
FT   tRNA            29410..29483
FT                   /gene="tRNA-Ile (GAT)"
FT                   /product="transfer RNA-Ile (GAT)"
FT                   /anticodon="(pos:29444..29446,aa:Ile)"
FT   tRNA            29493..29580
FT                   /gene="tRNA-Ser (GCT)"
FT                   /product="transfer RNA-Ser (GCT)"
FT                   /anticodon="(pos:29527..29529,aa:Ser)"
FT   CDS             30944..32140
FT                   /transl_table=11
FT                   /locus_tag="SpyM50015"
FT                   /product="putative amidase"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY7"
FT                   /protein_id="CAM29359.1"
FT                   /translation="MKKRILSAVLVSGVTLGAATTVGAEDLSTKIAKQDSIISNLTTEQ
FT                   KAAQNQVSALQAQVSSLQSEQDKLTARNTELEALSKRFEQEIKALTSQIVARNEKLKNQ
FT                   ARSAYKNNETSGYINALLNSKSISDVVNRLVAINRAVSANAKLLEQQKADKVSLEEKQA
FT                   ANQTAINTIAANMAMAEENQNTLRTQQANLEAATANLALQLASATEDKANLVAQKEAAE
FT                   KAAAEALAQEQAAKVKAQEQAAQQAASVEAAKSAITPAPQATPAAQSSNAIEPAALTAP
FT                   AAPSARPQTSYDSSNTYPVGQCTWGAKSLAPWAGNNWGNGGQWAYSAQAAGYRTGSTPM
FT                   VGAIAVWNDGGYGHVAVVVEVQSASSIRVMESNYSGRQYIADHRGWFNPTGVTFIYPH"
FT   sig_peptide     30944..31015
FT                   /locus_tag="SpyM50015"
FT                   /note="Signal peptide predicted for SpyM50015 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.996 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    31790..32131
FT                   /locus_tag="SpyM50015"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 7.3e-46"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS             32393..33355
FT                   /transl_table=11
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SpyM50016"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /note="Similar to SpyM50943, 55.380% identity (56.452%
FT                   ungapped) in 316 aa overlap"
FT                   /db_xref="GOA:A2RBY8"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBY8"
FT                   /protein_id="CAM29360.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLV
FT                   GEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVSGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLDTIYL
FT                   PKERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGN"
FT   misc_feature    32750..32779
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00339"
FT   misc_feature    32780..32827
FT                   /note="PS00114 Phosphoribosyl pyrophosphate synthetase
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00114"
FT   misc_feature    32813..33214
FT                   /gene="prsA1"
FT                   /gene_synonym="prs1"
FT                   /locus_tag="SpyM50016"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 3.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    33050..33088
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             33541..34296
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SpyM50017"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="GOA:A2RBY9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /protein_id="CAM29361.1"
FT                   /translation="MQLTESLGIVLFNRNYREDDKLVKIFTEVAGKQMFFVKHISRSKM
FT                   SSIIQPLTIADFIFKLNDTGLSYVVDYSNVNTYRYINNDIFRLAYASYVLALADAAIAD
FT                   NESDSHLFTFLKKTLDLMEEGLDYEILTNIFEIQILDRFGISLNFHECAICHRTDLPLD
FT                   FSHRFSAVLCSEHYYKDNRRNHLDPNVIYLLSRFQKITFDDLRTISLNKDIKKKLRQFI
FT                   DELYHDYVGIKLKSKTFIDNLVKWGDIMK"
FT   misc_feature    33541..34275
FT                   /gene="recO"
FT                   /locus_tag="SpyM50017"
FT                   /note="HMMPfam hit to PF02565, Recombination protein
FT                   O,score 2.6e-20"
FT                   /inference="protein motif:HMMPfam:PF02565"
FT   misc_feature    33994..34011
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS             34399..35406
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SpyM50018"
FT                   /product="fatty acid/phospholipid synthesis protein"
FT                   /db_xref="GOA:A2RBZ0"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="InterPro:IPR024084"
FT                   /protein_id="CAM29362.1"
FT                   /translation="MKRIAIDAMGGDNAPKAIVEGVNQAIEAFSDIEIQLYGDQTKINS
FT                   YLIQSDRVAIIHTDEKIMSDDEPAKAVRRKKKASMVLAAKAVKEGKADAIISAGNTGAL
FT                   LAVGLFVVGRIKGVDRPGLLSTIPTVTGLGFDMLDLGANAENTAKHLHQYAILGSFYAK
FT                   NVRGIANPRVGLLNNGTEETKGDPLRKATYELLTADNTISFVGNVEARELMSGVADVIV
FT                   SDGFTGNAVLKSIEGTAISIMGQLKQIINSGGIKTKIGASLLKSSLYEMKKTLDYSSAG
FT                   GAVLFGLKAPVVKSHGSSDVKAIFSTIKQVRTMLDTNVVGQLVEEFAKETQVND"
FT   misc_feature    34402..35364
FT                   /gene="plsX"
FT                   /locus_tag="SpyM50018"
FT                   /note="HMMPfam hit to PF02504, Fatty acid synthesis
FT                   protein, score 1.6e-127"
FT                   /inference="protein motif:HMMPfam:PF02504"
FT   CDS             35399..35641
FT                   /transl_table=11
FT                   /locus_tag="SpyM50019"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="GOA:A2RBZ1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ1"
FT                   /protein_id="CAM29363.1"
FT                   /translation="MTRQEIFERLINLIQKQRSYLSVAITEQTHLKNDLAVDSIELVEF
FT                   IINVEDEFHIAIPDEDIEDMVFMEDVLDYLVQRLT"
FT   CDS             join(35792..36016,36015..36497)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SpyM50020"
FT                   /EC_number="6.3.2.6"
FT                   /note="CDS contains a frameshift mutation after codon 74.
FT                   Frameshift occurs at a poly A heptamer"
FT                   /db_xref="PSEUDO:CAM29364.1"
FT   misc_feature    35795..36484
FT                   /gene="purC"
FT                   /locus_tag="SpyM50020"
FT                   /note="HMMPfam hit to PF01259, SAICAR synthetase, score
FT                   3.6e-103"
FT                   /inference="protein motif:HMMPfam:PF01259"
FT   misc_feature    36045..36089
FT                   /note="PS01057 SAICAR synthetase signature 1"
FT                   /inference="protein motif:Prosite:PS01057"
FT   misc_feature    36306..36332
FT                   /note="PS01058 SAICAR synthetase signature 2"
FT                   /inference="protein motif:Prosite:PS01058"
FT   CDS             36573..40346
FT                   /transl_table=11
FT                   /locus_tag="SpyM50022"
FT                   /product="putative phosphoribosylformylglycinamidine
FT                   synthase protein"
FT                   /EC_number="6.3.5.3"
FT                   /note="Internal region is similar to the N-terminal region
FT                   of Mycobacterium tuberculosis, and Mycobacterium bovis
FT                   phosphoribosylformylglycinamidine synthase II PurL
FT                   SWALL:PURL_MYCTU (SWALL:P54876) (754 aa) fasta scores: E():
FT                   1.6e-26, 27.28% id in 667 aa"
FT                   /db_xref="GOA:A2RBZ3"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ3"
FT                   /protein_id="CAM29365.1"
FT                   /translation="MSSYFPVAPLSDLVSYMNKRIFVEKKADFGIKSASLVKELTHNLQ
FT                   LTSLKDLRIVQVYDVFNLAEDLLARAEKHIFSEQVTDRLLTEAEITAELDKVAFFAIEA
FT                   FPGQFDQRAASSQEALLLFGSDSQVKVNTAELYLINKDIAEAELEAVKNYLLNPVDSLF
FT                   KDITLPLEEQAFSVSDKTIPNLDFFENYKADDFAAYKAEQGLAMEVDDLLFIQDYFKSI
FT                   GRVPTETELKVLDTYWSDHCRHTTFETELKNIDFSASKFQKQLQTTYDKYIAMRDELGR
FT                   SEKPQTLMDMATIFGRYERANGRLDDMEVSDEINACSVEIEVDVDGVKEPWLLMFKNET
FT                   HNHPTEIEPFGGAATCIGGAIRDPLSGRSYVYQAMRISGAGDITTPIAETRTGKLPQQV
FT                   ISKTAAHGYSSYGNQIGLATTYVREYFHPGFVAKRMELGAVVGAAPKENVVREKPEAGD
FT                   VVILLGGKTGRDGVGGATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRDGEVTRL
FT                   IKKSNDFGAGGVCVAIGELADGLEIDLDKVPLKYQGLNGTEIAISESQERMSVVVRPSD
FT                   VDAFIAACNKENIDAVVVATVTEKPNLVMTWNGETIVDLERRFLDTNGVRVVVDVKFVD
FT                   KDLTVPEARTTSAETLEADTLKVLSDLNHASQKGLQTIFDSSVGRSTVNHPIGGRYQIT
FT                   PTESSVQKLPVQHGVTRTASVMAQGYNPYIAEWSPYHGAAYAVIEATARLVATGADWSR
FT                   ARFSYQEYFERMDKQAERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEDLTVPPT
FT                   LVAFGVTTADSRKVLSPEFKAAGENIYYIPGQAISEDIDFDLIKANFSQFEAIQAQHKI
FT                   TAASAAKYGGVLESLALMTFGNRIGASVEIAELDSSLTAQLGGFVFTSAEEIADAVKIG
FT                   QTQADFTVTVNGNDLAGASLLAAFEGKLEEVYPTEFEQADALEEVPAVVSDTVIKAKET
FT                   IEKPVVYIPVFPGTNSEYDSAKAFEQVGASVNLVPFVTLNEVAIAESVDTMVANIAKAN
FT                   IIFFAGGFSAADEPDGSAKFIVNILLNEKVRAAIDSFIEKGDLIIGICNGFQALVKSGL
FT                   LPYGNFEEAGETSPTLFYNDANQHVAKMVETRIANTNSPWLAGVEVGDIHAIPVSHGEG
FT                   KFVVSASEFAELRDNGQIWSQYVDFDGQPSMDSKYNPNGSVNAIEGITSKNGQIIGKMG
FT                   HSERWEDGLFQNIPGNKDQTLFASAVKYFTGK"
FT   misc_feature    37935..38396
FT                   /locus_tag="SpyM50022"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal do, score 5.7e-34"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   misc_feature    38823..38897
FT                   /note="PS01159 WW/rsp5/WWP domain signature"
FT                   /inference="protein motif:Prosite:PS01159"
FT   misc_feature    39576..40055
FT                   /locus_tag="SpyM50022"
FT                   /note="HMMPfam hit to PF01965, DJ-1/PfpI family, score
FT                   0.0059"
FT                   /inference="protein motif:HMMPfam:PF01965"
FT   CDS             40580..42034
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SpyM50023"
FT                   /product="putative amidophosphoribosyltransferase
FT                   precursor"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="GOA:A2RBZ4"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ4"
FT                   /protein_id="CAM29366.1"
FT                   /translation="MTYEVKSLNEECGVFGIWGHPQAAQVTYFGLHSLQHRGQEGAGIV
FT                   SNDNGKLYGYRNVGLLSEVFKNQSELDNLTGNAAIGHVRYATAGSADIRNIQPFLYKFH
FT                   DGQFALCHNGNLTNAISLRKELEKQGAIFNASSDTEILMHLIRRSHNSSFMGKVKEALN
FT                   TVKGGFAYLLMTENKLIAALDPNAFRPLSIGQMQNGAWVISSETCAFEVVGAKWVRDVE
FT                   PGEVILIDDRGIQCDRYTDETQLAICSMEYVYFARPDSTIHGINVHTARKNMGKRLAQE
FT                   FKQDADIVIGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQELREQGVRMK
FT                   LSAVSGVVKGKRVVMIDDSIVRGTTSRRIVGLLREAGASEVHVAIASPELKYPCFYGID
FT                   IQTRRELISANHAVDEVCDIIGADSLTYLSLDGLIESIGLETKAPNGGLCVAYFDGHYP
FT                   TPLYDYEEEYLRSLEEKTSFYIQKVK"
FT   misc_feature    40580..40627
FT                   /note="PS00443 Glutamine amidotransferases class-II active
FT                   site"
FT                   /inference="protein motif:Prosite:PS00443"
FT   misc_feature    40613..41023
FT                   /gene="purF"
FT                   /locus_tag="SpyM50023"
FT                   /note="HMMPfam hit to PF00310, Glutamine amidotransferases
FT                   class-II, score 4.4e-50"
FT                   /inference="protein motif:HMMPfam:PF00310"
FT   misc_feature    41354..41773
FT                   /gene="purF"
FT                   /locus_tag="SpyM50023"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 2.9e-09"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   misc_feature    41636..41674
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature"
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             42062..43084
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="SpyM50024"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="GOA:A2RBZ5"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /protein_id="CAM29367.1"
FT                   /translation="MSEKNAYAKSGVDVEAGYEVVERIKKHVARTERAGVMGVLGGFGG
FT                   MFDLSKTGVKEPVLVSGTDGVGTKLMLAIKYDKHDTIGQDCVAMCVNDIIAAGAEPLYF
FT                   LDYIATGKNNPVKLEEVVSGVAEGCVQAGVALIGDETAEMPGMYGEDDYDLAGFAVGVA
FT                   EKSQIIDGSKVKEGDILLGLASSGIHSNGYSLVRRVFADYTGKELLPELEGKQLKDVLL
FT                   EPTRIYVKAALPLIKEELVNGIGHITGGGFIENVPRMFADDLAAEIDEDKVPVLPIFKA
FT                   LEKYGDIKHEEMFEIFNMGVGLMLAVSPENVNRVKDLLDEPVYEIGRIIKKADDSVVIK
FT                   "
FT   misc_feature    42068..42553
FT                   /gene="purM"
FT                   /locus_tag="SpyM50024"
FT                   /note="HMMPfam hit to PF00586, AIR synthase related
FT                   protein, N-terminal dom, score 1.6e-66"
FT                   /inference="protein motif:HMMPfam:PF00586"
FT   misc_feature    42584..43081
FT                   /gene="purM"
FT                   /locus_tag="SpyM50024"
FT                   /note="HMMPfam hit to PF02769, AIR synthase related
FT                   protein, C-terminal dom, score 1.2e-47"
FT                   /inference="protein motif:HMMPfam:PF02769"
FT   CDS             43252..43806
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SpyM50025"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /db_xref="GOA:A2RBZ6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ6"
FT                   /protein_id="CAM29368.1"
FT                   /translation="MKIAVFASGNGSNFQVIAEQFPVSFVFSDHRDAYVLERAQNLAIP
FT                   SFAFELKEFENKAAYEQAIVDLLDKHEIDLVCLAGYMKIVGETLLLAYEGRIINIHPAY
FT                   LPEFPGAHGIEDAWEAGVDQSGVTIHWVDSGVDTGQVIQQVRVPRLADDSLESFETRIH
FT                   ETEYQLYPAVLDSLGVERKVI"
FT   misc_feature    43252..43773
FT                   /gene="purN"
FT                   /locus_tag="SpyM50025"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   3.3e-60"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   CDS             join(43990..45063,45067..45537)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="SpyM50027"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="CDS similar to Bacillus subtilis bifunctional purine
FT                   biosynthesis protein purh [includes:
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase
FT                   PurH or PurHJ or bsu06520 SWALL:PUR9_BACSU (SWALL:P12048)
FT                   (512 aa) fasta scores: E(): 9.3e-116, 59.57% id in 512 aa.
FT                   CDS has a nonsense mutation (ochre) after codon 358"
FT                   /db_xref="PSEUDO:CAM29369.1"
FT   misc_feature    44029..44376
FT                   /gene="purH"
FT                   /locus_tag="SpyM50027"
FT                   /note="HMMPfam hit to PF02142, MGS-like domain, score
FT                   3.2e-55"
FT                   /inference="protein motif:HMMPfam:PF02142"
FT   misc_feature    44389..45336
FT                   /gene="purH"
FT                   /locus_tag="SpyM50027"
FT                   /note="HMMPfam hit to PF01808, AICARFT/IMPCHase
FT                   bienzyme,score 1.5e-147"
FT                   /inference="protein motif:HMMPfam:PF01808"
FT   CDS             complement(45596..46720)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50028"
FT                   /product="putative amidase"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ8"
FT                   /protein_id="CAM29370.1"
FT                   /translation="MKKFHRFLVSGVILLGFNGLVPTMPSTLISQQENLVHAAVLGDNY
FT                   PSKWKKGNGIDSWNMYIRQCTSFAAFRLSSANGFQLPKGYGNACTWGHIAKNQGYPVNK
FT                   TPSIGAIAWFDKNAYQSNAAYGHVAWVADIRGDTVTIEEYNYNAGQGPERYHKRQIPKS
FT                   QVSGYIHFKDLSSQTSHSYPRQLKHISQASFDPSGTYHFTTRLPVKGQTSIDSPDLAYY
FT                   EAGQSVYYDKVVTAGGYTWLSYLSFSGNRRYIPIKEPAQSVVQNDNTKPSIKVGDTVTF
FT                   PGVFRVDQLVNNLIVNKELAGGDPTPLNWIDPTPLDETDNQGKVLGDQILRVGEYFTVT
FT                   GSYKVLKIDQPSNGIYVQIGSRGTWVNADKANKL"
FT   misc_feature    complement(46211..46585)
FT                   /locus_tag="SpyM50028"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 3.4e-37"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   sig_peptide     complement(46607..46720)
FT                   /locus_tag="SpyM50028"
FT                   /note="Signal peptide predicted for SpyM50028 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.841 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(46634..46702)
FT                   /locus_tag="SpyM50028"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50028 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             46973..48238
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SpyM50029"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="GOA:A2RBZ9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:A2RBZ9"
FT                   /protein_id="CAM29371.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLSSKGVDQVFVAPGNDGMTLDGLDLV
FT                   NIVVSEHSRLIAFAKENEISWAFIGPDDALAAGIVDDFNSAGLRAFGPTKAAAELEWSK
FT                   DFAKEIMVKYNVPTAAYGTFLDFEKAKAYIEEQGAPIVVKADGLALGKGVVVAETVEQA
FT                   VEAAQEMLLDNKFGDSGARVVIEEFLDGEEFSLFAFVNGDKFYIMPTAQDHKRAFDGDK
FT                   GPNTGGMGAYAPVPHLPQSVVDTAVETIVRPVLEGMVAEGRPYLGVLYVGLILTADGPK
FT                   VIEFNSRFGDPETQIILPRLTSDFAQNIDDIMMGIEPYITWQNDGVTLGVVVASEGYPL
FT                   DYEKGVPLPEKTDGDIITYYAGAKFAENSELLLSNGGRVYMLVTTEDSVKAGQDKIYTQ
FT                   LAQQDTTGLFYRNDIGSKAIRE"
FT   misc_feature    46973..47275
FT                   /gene="purD"
FT                   /locus_tag="SpyM50029"
FT                   /note="HMMPfam hit to PF02844, Phosphoribosylglycinamide
FT                   synthetase, N doma, score 8.9e-40"
FT                   /inference="protein motif:HMMPfam:PF02844"
FT   misc_feature    47279..47527
FT                   /gene="purD"
FT                   /locus_tag="SpyM50029"
FT                   /note="HMMPfam hit to PF02842, Phosphoribosylglycinamide
FT                   synthetase, B doma, score 9.2e-42"
FT                   /inference="protein motif:HMMPfam:PF02842"
FT   misc_feature    47528..47938
FT                   /gene="purD"
FT                   /locus_tag="SpyM50029"
FT                   /note="HMMPfam hit to PF01071, Phosphoribosylglycinamide
FT                   synthetase, ATP-gr, score 7.5e-78"
FT                   /inference="protein motif:HMMPfam:PF01071"
FT   misc_feature    47834..47857
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    47951..48229
FT                   /gene="purD"
FT                   /locus_tag="SpyM50029"
FT                   /note="HMMPfam hit to PF02843, Phosphoribosylglycinamide
FT                   synthetase, C doma, score 1.1e-13"
FT                   /inference="protein motif:HMMPfam:PF02843"
FT   CDS             48519..49007
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="SpyM50030"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="GOA:A2RC00"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC00"
FT                   /protein_id="CAM29372.1"
FT                   /translation="MQPIISIIMGSKSDWATMQKTAEVLDNFGIAYEKKVVSAHRTPDL
FT                   MFKYAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRVLSGLDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQNLADALAHFHEEQGKIAEESSNELI"
FT   misc_feature    48525..49001
FT                   /gene="purE"
FT                   /locus_tag="SpyM50030"
FT                   /note="HMMPfam hit to PF00731, AIR carboxylase, score
FT                   4.9e-89"
FT                   /inference="protein motif:HMMPfam:PF00731"
FT   CDS             48994..50067
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="SpyM50031"
FT                   /product="putative phosphoribosylaminoimidazole carboxylase
FT                   ATPase subunit"
FT                   /EC_number="4.1.1.21"
FT                   /db_xref="GOA:A2RC01"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC01"
FT                   /protein_id="CAM29373.1"
FT                   /translation="MNSFKTIGIIGGGQLGQMMAIAAIYMGHKVITLDPTNDCPASRVS
FT                   EVIVAPYDDVEALGQLAACCDVLTYEFENVNADGLDAVVSACQLPQGTDLLRISQNRIF
FT                   EKDFLANKAGVTVAPYKVVTSSLDLEGLDFTKTYVLKTATGGYDGHGQKVIRSAEDLPE
FT                   AQQLANSAQCVLEEFVNFDLEISVIVSGNGEDVTVFPVQENIHCNNILSKTIVPARISD
FT                   QLADKAKKMAVQIAKKLQLSGTLCVEMFATADDIIINEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGQPLPPIKLHAPAVMLNVLGQHVQQAIDYVAQNPSAHLHMYGKLEAKHNRK
FT                   MGHVTLFAEDADEVEEF"
FT   misc_feature    49090..49563
FT                   /gene="purK"
FT                   /locus_tag="SpyM50031"
FT                   /note="HMMPfam hit to PF02222, ATP-grasp domain, score
FT                   1.4e-13"
FT                   /inference="protein motif:HMMPfam:PF02222"
FT   CDS             50069..51487
FT                   /transl_table=11
FT                   /locus_tag="SpyM50032"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC02"
FT                   /protein_id="CAM29374.1"
FT                   /translation="MYLKYIFKIKDRNLVSDYESLVRNLTINLQKLVIKDRTALIGDKQ
FT                   LPITIYYRGENEKFPTGIVKVESDSVEGLELFDKTIKEIVGNESRFGKFTCIYDGISTY
FT                   YSTEIYSELHEIERRTQEFLREAFFLSDKSGELKEYQATIKKMDSSDFSFSKLINEIFK
FT                   ASDITDTFIDHVRACVEFGTVPNGDLLPKSFWDSLDDSLLDDKEQGLEINNLLNEIRST
FT                   RNTIAHCKEFKKKDYINCIEQVKKLKQALDKIIASIESTDISKMSREVSRINNSLQADN
FT                   DYIKQKYFIEYDIFEKDILARTGLLEIDWENVSDDIEPLKIHRNFYESISEKTDSEVIE
FT                   EIKNLEDINFTDEKGNDLDDLTIIVPAQDEGFKRVFLGQREWYDIRIGKSKRNRIKYIA
FT                   GYEVAPESGVKYWAEVDKIVPSDNYVGYWKVIFKGEVKEYSEYKRLGNTWPPQNSRYVS
FT                   KKALDEAKYLSDVF"
FT   CDS             51507..52799
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SpyM50033"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="GOA:A2RC03"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC03"
FT                   /protein_id="CAM29375.1"
FT                   /translation="MIERYSRPEMAAIWTEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIREKADFDIDRILEIEQETRHDVVAFTRAVSETLGEERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTNIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NQERFEHAAAGVEAGKISGAVGNFANIPPFVEQYVCDKLGIRSQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMVTAYENVSLWHERDISHSSAERIITPDTTILIDYMLNRFGNIVKNLTVFPEN
FT                   MMRNMESTFGLIYSQRVMLKLIEKGMTREEAYDLVQPKTAYSWDNQVDFKPLLEEDTKV
FT                   TSCLTQEEIDELFNPIYYTKRVDDIFKRLGI"
FT   misc_feature    51513..52364
FT                   /gene="purB"
FT                   /locus_tag="SpyM50033"
FT                   /note="HMMPfam hit to PF00206, Lyase, score 1.8e-91"
FT                   /inference="protein motif:HMMPfam:PF00206"
FT   misc_feature    52287..52316
FT                   /note="PS00163 Fumarate lyases signature"
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS             52930..53841
FT                   /transl_table=11
FT                   /locus_tag="SpyM50034"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RC04"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC04"
FT                   /protein_id="CAM29376.1"
FT                   /translation="MLEHFGGKVKVLRLEKRISREDLCGDESELSVRQLARIELGQSIP
FT                   SLSKVIFIAKALNVSVGYLTDGADLELPKRYKELKYLILRTPTYMDDGKLQVREEQFDE
FT                   IFEDYYDKLPEEEKVAVDIIQAKFEVYQTGDINFGYSILKEFLPQLKRKSIYNLNELLL
FT                   IDLYLIILVVSHFSDDIFDVQFYEEITESMLKQHNNLSLEDLFLLNNILLSCADTYIRL
FT                   KMFGRLKETLQLSHFIMSTIQDFQKMPMYCMYEWKLSIFYLKDINRARNYFEQSILFTQ
FT                   MTGDTYLVQKLRGEWNKDIHYI"
FT   misc_feature    52954..53121
FT                   /locus_tag="SpyM50034"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.2e-07"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS             54061..55059
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM50035"
FT                   /product="Holliday junction DNA helicase, subunit B"
FT                   /db_xref="GOA:A2RC05"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29377.1"
FT                   /translation="MARILDNNVMGNEEFSDRTLRPQYLHEYIGQDKVKEQFAIFIEAA
FT                   KRRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAVEKAGDLVAILNELEPG
FT                   DILFIDEIHRMPMSVEEVLYSAMEDFYIDIMIGAGDTSRSIHLDLPPFTLIGATTRAGM
FT                   LSNPLRARFGITGHMEYYQEKDLTEIVERTATIFEIKIDHEAARKLACRSRGTPRIANR
FT                   LLKRVRDYAQIIGDGIITAQITDRALTMLDVDREGLDYIDQKILRTMIEMYQGGPVGLG
FT                   TLSVNIAEERNTVEEMYEPYLIQKGFLMRTRTGRVATQKAYRHLGYPYQNT"
FT   misc_feature    54064..54219
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM50035"
FT                   /note="HMMPfam hit to PF05496, Holliday junction DNA
FT                   helicase ruvB N-termin, score 6.4e-28"
FT                   /inference="protein motif:HMMPfam:PF05496"
FT   misc_feature    54220..54759
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM50035"
FT                   /note="HMMPfam hit to PF00004, ATPase family associated
FT                   with various cellul, score 1.4e-27"
FT                   /inference="protein motif:HMMPfam:PF00004"
FT   misc_feature    54235..54258
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    54808..55044
FT                   /gene="ruvB"
FT                   /locus_tag="SpyM50035"
FT                   /note="HMMPfam hit to PF05491, Holliday junction DNA
FT                   helicase ruvB C-termin, score 1.4e-53"
FT                   /inference="protein motif:HMMPfam:PF05491"
FT   CDS             55197..55634
FT                   /transl_table=11
FT                   /locus_tag="SpyM50036"
FT                   /product="putative phosphotyrosine protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="GOA:A2RC06"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC06"
FT                   /protein_id="CAM29378.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSIVSSDVMMIESRATSDWEHGN
FT                   PIHSGTQSILKTYQINYDITKCSKQITITDFNTFDYIIGMDSDNVKNLKEMSQHQWDSK
FT                   IYLFREGGVPDPWYTNDFEETYQLVRKGCQDWLSRLMSKEY"
FT   misc_feature    55200..55613
FT                   /locus_tag="SpyM50036"
FT                   /note="HMMPfam hit to PF01451, Low molecular weight
FT                   phosphotyrosine protein, score 8.5e-31"
FT                   /inference="protein motif:HMMPfam:PF01451"
FT   CDS             55657..56058
FT                   /transl_table=11
FT                   /locus_tag="SpyM50037"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC07"
FT                   /protein_id="CAM29379.1"
FT                   /translation="MIDMQDIVKKWSITRAKLEIVSVIVILVCAISVFSVRISNKTSLT
FT                   YDKGRIHYTGYVINHKMNGEGKLVYPNGDIYEGTFKNGLFEGKGTFTAKTGWLYNGEFH
FT                   KGQANGKGVLKAKNNKVYKGIFKQGIFQK"
FT   misc_feature    55714..55773
FT                   /locus_tag="SpyM50037"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50037 by TMHMM2.0 at aa 20-39"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    55813..55881
FT                   /locus_tag="SpyM50037"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   misc_feature    55882..55950
FT                   /locus_tag="SpyM50037"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 1.1e-05"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   misc_feature    55951..56019
FT                   /locus_tag="SpyM50037"
FT                   /note="HMMPfam hit to PF02493, MORN repeat, score 0.0021"
FT                   /inference="protein motif:HMMPfam:PF02493"
FT   CDS             56055..57830
FT                   /transl_table=11
FT                   /locus_tag="SpyM50038"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="GOA:A2RC08"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC08"
FT                   /protein_id="CAM29380.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNVFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLKRRFYRIVPPLVLMILLTIPFTFLIKKDFIANIGSQITA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLLWGVFVWLLARRKETQKQL
FT                   RGLLFLISLGIFAISFLSMFIRSFMTSNFSLIYFSSLSHSFPFFLGAMFATITGINETT
FT                   VRFQKNVRLWPRQYVLAAMVGAFTLLLVLTVTLDFNHITTYLFGFALASLFASIMIYAA
FT                   RVLHEQTPDVQEPKAITYIADISYGIYLFHWPFYIIFSQLMSHILAVILTVFFSILFAT
FT                   VSYYIVEPLVQGRKPNLLGLEIDCSSYYKWIVGGALALALLTLGTCMIAPKVGKFEKQL
FT                   LVSSLQQAQSNMERTHTLAAGDANALSDVGIIGDSVALRSSAAFSKIMPQAQLDAAVSR
FT                   NFKEAFDLFNNQIKSKSLSKTVVLAVGVNSLDNYSQAVQSFIEALPNGHRLVLVSPYNA
FT                   KNASQVAEARDYGLKLSKKYKYVTIADWYKVAVEHPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQTAVEKSAKKPAK"
FT   misc_feature    56061..57113
FT                   /locus_tag="SpyM50038"
FT                   /note="HMMPfam hit to PF01757, Acyltransferase family,score
FT                   9e-31"
FT                   /inference="protein motif:HMMPfam:PF01757"
FT   misc_feature    order(56067..56123,56133..56201,56259..56324,56442..56510,
FT                   56547..56606,56634..56702,56760..56828,56838..56906,
FT                   56943..57011,57024..57092,57153..57221)
FT                   /locus_tag="SpyM50038"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50038 by TMHMM2.0 at aa 5-23,
FT                   27-49,69-90,130-152,165-184, 194-216, 236-258,
FT                   262-284,297-319,324-346 and 367-389"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             58139..60781
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="SpyM50039"
FT                   /product="aldehyde-alcohol dehydrogenase 2 [includes:
FT                   alcohol dehydrogenase; acetaldehyde dehydrogenase]"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /db_xref="GOA:A2RC09"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC09"
FT                   /protein_id="CAM29381.1"
FT                   /translation="MTEGHNTVETTSVSVTIDALVQKGLAALEEMRKLDQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKPATWIAAQAGFTVPEGTNILAAEC
FT                   TEVSEKEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNAVGDNVSAINLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFAEVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FDNLEKSVKTADFEAREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYCADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIQMNFKAQGIDENEWKEHSRELAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   misc_feature    59546..60721
FT                   /gene="adhE"
FT                   /locus_tag="SpyM50039"
FT                   /note="HMMPfam hit to PF00465, Iron-containing alcohol
FT                   dehydrogenase, score 4.2e-139"
FT                   /inference="protein motif:HMMPfam:PF00465"
FT   misc_feature    60068..60154
FT                   /note="PS00913 Iron-containing alcohol dehydrogenases
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00913"
FT   misc_feature    60326..60388
FT                   /note="PS00060 Iron-containing alcohol dehydrogenases
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00060"
FT   CDS             61033..62049
FT                   /transl_table=11
FT                   /gene="adhP"
FT                   /locus_tag="SpyM50040"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="GOA:A2RC10"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC10"
FT                   /protein_id="CAM29382.1"
FT                   /translation="MKAVVVNQASTGVEVVEHDLPNIGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADILVNGKEIEDVPG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS"
FT   misc_feature    61054..62040
FT                   /gene="adhP"
FT                   /locus_tag="SpyM50040"
FT                   /note="HMMPfam hit to PF00107, Zinc-binding
FT                   dehydrogenase,score 1.2e-108"
FT                   /inference="protein motif:HMMPfam:PF00107"
FT   misc_feature    61135..61152
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    61204..61248
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS             62437..63726
FT                   /transl_table=11
FT                   /locus_tag="SpyM50041"
FT                   /product="multi antimicrobial extrusion (MATE) family
FT                   transporter"
FT                   /db_xref="GOA:A2RC11"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC11"
FT                   /protein_id="CAM29383.1"
FT                   /translation="MIYNRRKIFSLALPSMIENILQMLMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIISIYQSLFIALGAAVSSLIARSIGENNQNKQLNYMAGVLQVTLLLSVGLGLLSV
FT                   VGHHQVLEWLGAEVSVTLVGGQYLSIVGGMIVSLGLLTSLGAIVRAQGYPKIPMQVSLL
FT                   INVLNAIFSALSIYVWGFGLLGVAWATVLSRLVGVFLLCQFIPIKQVAKRLMRPLDKII
FT                   FDLSLPAAGERLMMRAGDVLIIGIVVRFGTTALAGNAIGETLTQFNYMPGLAMATATII
FT                   LVARQLGGGKVTEIRYIIREAFILSTLMMLVMGALTYLLGPSLLPLFTQNTDAQRSAMV
FT                   VLLFSLLGAPATAGTLVYTALWQGLGKAKLPFYATTIGMWVIRIGLGYVIGVVWQYGLI
FT                   GVWMATVLDNTSRWFILSKQFKKYQEITFH"
FT   misc_feature    62476..62958
FT                   /locus_tag="SpyM50041"
FT                   /note="HMMPfam hit to PF01554, MatE, score 4.1e-28"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   misc_feature    order(62527..62595,62605..62658,62695..62754,62812..62880,
FT                   62917..62976,62989..63057,63157..63216,63244..63303,
FT                   63340..63408,63451..63519,63580..63648)
FT                   /locus_tag="SpyM50041"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50041 by TMHMM2.0 at aa 31-53,
FT                   57-74,87-106,126-148,161-180, 185-207, 241-260,
FT                   270-289,302-324,339-361 and 382-404"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    63118..63603
FT                   /locus_tag="SpyM50041"
FT                   /note="HMMPfam hit to PF01554, MatE, score 2.3e-30"
FT                   /inference="protein motif:HMMPfam:PF01554"
FT   repeat_region   63716..63730
FT                   /note="direct repeat"
FT   repeat_region   63730..64794
FT                   /note="IS1239"
FT   CDS             join(63830..64591,64590..64823)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50042"
FT                   /note="Similar to Streptococcus pyogenes insertion sequence
FT                   IS1239 putative transposase SWALL:Q54534 (EMBL:U11799) (326
FT                   aa) fasta scores: E(): 4.3e-114, 93.49% id in 323 aa. CDS
FT                   has a frameshift mutation after codon 254"
FT                   /db_xref="PSEUDO:CAM29384.1"
FT   misc_feature    64337..64771
FT                   /locus_tag="SpyM50042"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   2.3e-10"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   repeat_region   64796..64810
FT                   /note="direct repeat"
FT   CDS             65004..65312
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SpyM50043"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="GOA:A2RC13"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /protein_id="CAM29385.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLVDIINPTQKTVDALMKLDLPSGVNVEIKL"
FT   misc_feature    65016..65303
FT                   /gene="rpsJ"
FT                   /locus_tag="SpyM50043"
FT                   /note="HMMPfam hit to PF00338, Ribosomal protein S10p/S20e,
FT                   score 4.7e-57"
FT                   /inference="protein motif:HMMPfam:PF00338"
FT   misc_feature    65088..65135
FT                   /note="PS00361 Ribosomal protein S10 signature"
FT                   /inference="protein motif:Prosite:PS00361"
FT   CDS             65560..66186
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SpyM50044"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="GOA:A2RC14"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /protein_id="CAM29386.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   misc_feature    65584..66162
FT                   /gene="rplC"
FT                   /locus_tag="SpyM50044"
FT                   /note="HMMPfam hit to PF00297, Ribosomal protein L3, score
FT                   5.9e-90"
FT                   /inference="protein motif:HMMPfam:PF00297"
FT   misc_feature    65857..65928
FT                   /note="PS00474 Ribosomal protein L3 signature"
FT                   /inference="protein motif:Prosite:PS00474"
FT   CDS             66210..66833
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SpyM50045"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="GOA:A2RC15"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /protein_id="CAM29387.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   misc_feature    66255..66824
FT                   /gene="rplD"
FT                   /locus_tag="SpyM50045"
FT                   /note="HMMPfam hit to PF00573, Ribosomal protein L4/L1
FT                   family, score 2.7e-72"
FT                   /inference="protein motif:HMMPfam:PF00573"
FT   CDS             66833..67129
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SpyM50046"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="GOA:A2RC16"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /protein_id="CAM29388.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   misc_feature    66842..67117
FT                   /gene="rplW"
FT                   /locus_tag="SpyM50046"
FT                   /note="HMMPfam hit to PF00276, Ribosomal protein L23,score
FT                   1.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00276"
FT   misc_feature    67061..67108
FT                   /note="PS00050 Ribosomal protein L23 signature"
FT                   /inference="protein motif:Prosite:PS00050"
FT   CDS             67147..67980
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SpyM50047"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="GOA:A2RC17"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /protein_id="CAM29389.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   misc_feature    67270..67500
FT                   /gene="rplB"
FT                   /locus_tag="SpyM50047"
FT                   /note="HMMPfam hit to PF00181, Ribosomal Proteins L2, RNA
FT                   binding dom, score 3.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00181"
FT   misc_feature    67516..67905
FT                   /gene="rplB"
FT                   /locus_tag="SpyM50047"
FT                   /note="HMMPfam hit to PF03947, Ribosomal Proteins
FT                   L2,C-terminal doma, score 8.6e-88"
FT                   /inference="protein motif:HMMPfam:PF03947"
FT   misc_feature    67798..67833
FT                   /note="PS00467 Ribosomal protein L2 signature"
FT                   /inference="protein motif:Prosite:PS00467"
FT   CDS             68119..68397
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SpyM50048"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="GOA:A2RC18"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /protein_id="CAM29390.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFI
FT                   GYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR"
FT   misc_feature    68125..68367
FT                   /gene="rpsS"
FT                   /locus_tag="SpyM50048"
FT                   /note="HMMPfam hit to PF00203, Ribosomal protein S19,score
FT                   2.9e-51"
FT                   /inference="protein motif:HMMPfam:PF00203"
FT   misc_feature    68275..68349
FT                   /note="PS00323 Ribosomal protein S19 signature"
FT                   /inference="protein motif:Prosite:PS00323"
FT   CDS             68413..68757
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SpyM50049"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="GOA:A2RC19"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /protein_id="CAM29391.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   misc_feature    68437..68751
FT                   /gene="rplV"
FT                   /locus_tag="SpyM50049"
FT                   /note="HMMPfam hit to PF00237, Ribosomal protein L22p/L17e,
FT                   score 2.1e-60"
FT                   /inference="protein motif:HMMPfam:PF00237"
FT   misc_feature    68671..68745
FT                   /note="PS00464 Ribosomal protein L22 signature"
FT                   /inference="protein motif:Prosite:PS00464"
FT   CDS             68770..69423
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM50050"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="GOA:A2RC20"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /protein_id="CAM29392.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LADASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRGQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   misc_feature    68770..68952
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM50050"
FT                   /note="HMMPfam hit to PF00417, Ribosomal protein
FT                   S3,N-terminal domai, score 4.3e-32"
FT                   /inference="protein motif:HMMPfam:PF00417"
FT   misc_feature    68953..69117
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM50050"
FT                   /note="HMMPfam hit to PF07650, KH domain, score 1.7e-22"
FT                   /inference="protein motif:HMMPfam:PF07650"
FT   misc_feature    69121..69372
FT                   /gene="rpsC"
FT                   /locus_tag="SpyM50050"
FT                   /note="HMMPfam hit to PF00189, Ribosomal protein
FT                   S3,C-terminal domai, score 2.3e-50"
FT                   /inference="protein motif:HMMPfam:PF00189"
FT   misc_feature    69253..69357
FT                   /note="PS00548 Ribosomal protein S3 signature"
FT                   /inference="protein motif:Prosite:PS00548"
FT   CDS             69427..69840
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="SpyM50051"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="GOA:A2RC21"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /protein_id="CAM29393.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKEVSFGEYGLQATTSHWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   misc_feature    69427..69822
FT                   /gene="rplP"
FT                   /locus_tag="SpyM50051"
FT                   /note="HMMPfam hit to PF00252, Ribosomal protein L16,score
FT                   2.5e-82"
FT                   /inference="protein motif:HMMPfam:PF00252"
FT   misc_feature    69601..69636
FT                   /note="PS00586 Ribosomal protein L16 signature 1"
FT                   /inference="protein motif:Prosite:PS00586"
FT   misc_feature    69670..69705
FT                   /note="PS00701 Ribosomal protein L16 signature 2"
FT                   /inference="protein motif:Prosite:PS00701"
FT   CDS             69850..70056
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="SpyM50052"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="GOA:A2RC22"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /protein_id="CAM29394.1"
FT                   /translation="MKLQEIKDFVKELRGLSQEELAKKENELKKELFDLRFQAAAGQLE
FT                   KTARLDEVKKQIARVKTVQSEMK"
FT   misc_feature    69877..70050
FT                   /gene="rpmC"
FT                   /locus_tag="SpyM50052"
FT                   /note="HMMPfam hit to PF00831, Ribosomal L29 protein,score
FT                   4.5e-29"
FT                   /inference="protein motif:HMMPfam:PF00831"
FT   CDS             70082..70342
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="SpyM50053"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="GOA:A2RC23"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /protein_id="CAM29395.1"
FT                   /translation="MERNQRKTLYGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDENNVAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   misc_feature    70112..70318
FT                   /gene="rpsQ"
FT                   /locus_tag="SpyM50053"
FT                   /note="HMMPfam hit to PF00366, Ribosomal protein S17,score
FT                   5.7e-37"
FT                   /inference="protein motif:HMMPfam:PF00366"
FT   misc_feature    70250..70288
FT                   /note="PS00056 Ribosomal protein S17 signature"
FT                   /inference="protein motif:Prosite:PS00056"
FT   CDS             70367..70735
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SpyM50054"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="GOA:A2RC24"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR023571"
FT                   /protein_id="CAM29396.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   misc_feature    70367..70732
FT                   /gene="rplN"
FT                   /locus_tag="SpyM50054"
FT                   /note="HMMPfam hit to PF00238, Ribosomal protein L14p/L23e,
FT                   score 7.2e-78"
FT                   /inference="protein motif:HMMPfam:PF00238"
FT   misc_feature    70544..70624
FT                   /note="PS00049 Ribosomal protein L14 signature"
FT                   /inference="protein motif:Prosite:PS00049"
FT   CDS             70814..71119
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SpyM50055"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="GOA:A2RC25"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /protein_id="CAM29397.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVIVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYSKKSGEVLD"
FT   misc_feature    70820..70921
FT                   /gene="rplX"
FT                   /locus_tag="SpyM50055"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   misc_feature    70829..70882
FT                   /note="PS01108 Ribosomal protein L24 signature"
FT                   /inference="protein motif:Prosite:PS01108"
FT   CDS             71143..71685
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SpyM50056"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="GOA:A2RC26"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /protein_id="CAM29398.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEISFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   misc_feature    71215..71385
FT                   /gene="rplE"
FT                   /locus_tag="SpyM50056"
FT                   /note="HMMPfam hit to PF00281, Ribosomal protein L5, score
FT                   6.6e-30"
FT                   /inference="protein motif:HMMPfam:PF00281"
FT   misc_feature    71314..71364
FT                   /note="PS00358 Ribosomal protein L5 signature"
FT                   /inference="protein motif:Prosite:PS00358"
FT   misc_feature    71395..71679
FT                   /gene="rplE"
FT                   /locus_tag="SpyM50056"
FT                   /note="HMMPfam hit to PF00673, ribosomal L5P family
FT                   C-terminus, score 1.7e-52"
FT                   /inference="protein motif:HMMPfam:PF00673"
FT   CDS             71701..71886
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SpyM50057"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="GOA:A2RC27"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /protein_id="CAM29399.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   misc_feature    71713..71880
FT                   /gene="rpsN"
FT                   /locus_tag="SpyM50057"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 3e-19"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   misc_feature    71767..71835
FT                   /note="PS00527 Ribosomal protein S14 signature"
FT                   /inference="protein motif:Prosite:PS00527"
FT   CDS             72037..72435
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SpyM50058"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="GOA:A2RC28"
FT                   /db_xref="InterPro:IPR000630"
FT                   /protein_id="CAM29400.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGKNGERVITNLKRISKPGLRVYAKRDDMPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   misc_feature    72049..72432
FT                   /gene="rpsH"
FT                   /locus_tag="SpyM50058"
FT                   /note="HMMPfam hit to PF00410, Ribosomal protein S8, score
FT                   1.6e-75"
FT                   /inference="protein motif:HMMPfam:PF00410"
FT   misc_feature    72340..72393
FT                   /note="PS00053 Ribosomal protein S8 signature"
FT                   /inference="protein motif:Prosite:PS00053"
FT   CDS             72638..73174
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SpyM50059"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="GOA:A2RC29"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /protein_id="CAM29401.1"
FT                   /translation="MSRIGNKVITMPAGVELTNNNNVITVKGPKGELTREFNKNIEIKV
FT                   EGTEITVVRPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   misc_feature    72668..72883
FT                   /gene="rplF"
FT                   /locus_tag="SpyM50059"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   2.4e-24"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    72905..73132
FT                   /gene="rplF"
FT                   /locus_tag="SpyM50059"
FT                   /note="HMMPfam hit to PF00347, Ribosomal protein L6, score
FT                   1.1e-29"
FT                   /inference="protein motif:HMMPfam:PF00347"
FT   misc_feature    73097..73123
FT                   /note="PS00525 Ribosomal protein L6 signature 1"
FT                   /inference="protein motif:Prosite:PS00525"
FT   CDS             73279..73635
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SpyM50060"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="GOA:A2RC30"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /protein_id="CAM29402.1"
FT                   /translation="MISKPDKNKIRQKRHRRVRGKLSGTADRPRLNVFRSNTGIYAQVI
FT                   DDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYHGRV
FT                   KALADAARENGLKF"
FT   misc_feature    73294..73632
FT                   /gene="rplR"
FT                   /locus_tag="SpyM50060"
FT                   /note="HMMPfam hit to PF00861, Ribosomal L18p/L5e
FT                   family,score 9.9e-57"
FT                   /inference="protein motif:HMMPfam:PF00861"
FT   CDS             73654..74148
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SpyM50061"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="GOA:A2RC31"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /protein_id="CAM29403.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGVADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   misc_feature    73678..73878
FT                   /gene="rpsE"
FT                   /locus_tag="SpyM50061"
FT                   /note="HMMPfam hit to PF00333, Ribosomal protein
FT                   S5,N-terminal domai, score 5e-42"
FT                   /inference="protein motif:HMMPfam:PF00333"
FT   misc_feature    73732..73830
FT                   /note="PS00585 Ribosomal protein S5 signature"
FT                   /inference="protein motif:Prosite:PS00585"
FT   misc_feature    73903..74124
FT                   /gene="rpsE"
FT                   /locus_tag="SpyM50061"
FT                   /note="HMMPfam hit to PF03719, Ribosomal protein
FT                   S5,C-terminal domai, score 8.2e-35"
FT                   /inference="protein motif:HMMPfam:PF03719"
FT   CDS             74163..74345
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SpyM50062"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="GOA:A2RC32"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /protein_id="CAM29404.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   misc_feature    74166..74324
FT                   /gene="rpmD"
FT                   /locus_tag="SpyM50062"
FT                   /note="HMMPfam hit to PF00327, Ribosomal protein
FT                   L30p/L7e,score 5.2e-15"
FT                   /inference="protein motif:HMMPfam:PF00327"
FT   misc_feature    74226..74324
FT                   /note="PS00634 Ribosomal protein L30 signature"
FT                   /inference="protein motif:Prosite:PS00634"
FT   CDS             74560..75000
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SpyM50063"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="GOA:A2RC33"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /protein_id="CAM29405.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINTKEYALVNLDQLNVFDDGTEVTPAILKDAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAIIAKGGSIEVI"
FT   misc_feature    74560..74865
FT                   /gene="rplO"
FT                   /locus_tag="SpyM50063"
FT                   /note="HMMPfam hit to PF01305, Ribosomal protein L15 amino
FT                   terminal re, score 4.8e-58"
FT                   /inference="protein motif:HMMPfam:PF01305"
FT   misc_feature    74887..74982
FT                   /gene="rplO"
FT                   /locus_tag="SpyM50063"
FT                   /note="HMMPfam hit to PF00256, Ribosomal protein L15,score
FT                   4.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00256"
FT   misc_feature    74887..74979
FT                   /note="PS00475 Ribosomal protein L15 signature"
FT                   /inference="protein motif:Prosite:PS00475"
FT   CDS             75017..76321
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SpyM50064"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="GOA:A2RC34"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC34"
FT                   /protein_id="CAM29406.1"
FT                   /translation="MFLKILKDALKIKTVRNKIFFTIFIILVFRIGTHITVPGVNAKSL
FT                   EQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMDILPKFVEWGKQGE
FT                   VGRRKLNQATRYISLVLAFAQSIGITAGFNTLSNVALVKTPDIKTYLLIGALLTTGSVI
FT                   VTWLGEQITDKGFGNGVSMIIFAGIISSIPSAIATIREDYFVNVKASDLHSSYLIVGIL
FT                   IIAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVNPAGVIPVIFASSITTI
FT                   PSTIIPFVQNGRDLPWLNRLQEIFNYQTPVGMIVYALLIILFSFFYTFVQVNPEKTAEN
FT                   LQKNSSYIPSVRPGRETEQFMSALLKKLATVGAIFLAFISLAPIAAQQALNLSSSIALG
FT                   GTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   sig_peptide     75017..75142
FT                   /gene="secY"
FT                   /locus_tag="SpyM50064"
FT                   /note="Signal peptide predicted for SpyM50064 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.935) with cleavage
FT                   site probability 0.857 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(75074..75142,75212..75280,75365..75433,75461..75520,
FT                   75539..75607,75650..75718,75815..75883,75926..75994,
FT                   76118..76186,76199..76258)
FT                   /gene="secY"
FT                   /locus_tag="SpyM50064"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SpyM50064 by TMHMM2.0 at aa 20-42,
FT                   66-88,117-139,149-168,175-197, 212-234, 267-289,
FT                   304-326,368-390 and 395-414"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    75221..76264
FT                   /gene="secY"
FT                   /locus_tag="SpyM50064"
FT                   /note="HMMPfam hit to PF00344, eubacterial secY
FT                   protein,score 3e-161"
FT                   /inference="protein motif:HMMPfam:PF00344"
FT   misc_feature    75221..75280
FT                   /note="PS00755 Protein secY signature 1"
FT                   /inference="protein motif:Prosite:PS00755"
FT   misc_feature    75512..75568
FT                   /note="PS00756 Protein secY signature 2"
FT                   /inference="protein motif:Prosite:PS00756"
FT   misc_feature    75536..75592
FT                   /note="PS00095 C-5 cytosine-specific DNA methylases
FT                   C-terminal signature"
FT                   /inference="protein motif:Prosite:PS00095"
FT   CDS             76471..77109
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SpyM50065"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="GOA:A2RC35"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29407.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEEFGVAHISTGDMFRAAMANQTEM
FT                   GRLAKSYIDKGELVPDEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEEL
FT                   GLRLDGVINIKVDPSCLVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPET
FT                   VKRRLDVNMAQGEPILEHYRKLDLVTDIEGNQEITDVFADVEKALLELK"
FT   misc_feature    76483..77031
FT                   /gene="adk"
FT                   /locus_tag="SpyM50065"
FT                   /note="HMMPfam hit to PF00406, Adenylate kinase, score
FT                   1.3e-85"
FT                   /inference="protein motif:HMMPfam:PF00406"
FT   misc_feature    76714..76749
FT                   /note="PS00113 Adenylate kinase signature"
FT                   /inference="protein motif:Prosite:PS00113"
FT   CDS             77227..77445
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SpyM50066"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="GOA:A2RC36"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /protein_id="CAM29408.1"
FT                   /translation="MAKEDVIEIEGKVVETMPNAMFTVELENGHQILATVSGKIRKNYI
FT                   RILVGDRVTVEMSPYDLTRGRITYRFK"
FT   misc_feature    77230..77442
FT                   /gene="infA"
FT                   /locus_tag="SpyM50066"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain,score
FT                   2.9e-13"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS             77471..77587
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SpyM50066A"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="GOA:A2RC37"
FT                   /db_xref="InterPro:IPR000473"
FT                   /protein_id="CAM29409.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   misc_feature    77471..77584
FT                   /gene="rpmJ"
FT                   /locus_tag="SpyM50066A"
FT                   /note="HMMPfam hit to PF00444, Ribosomal protein L36,score
FT                   2.2e-17"
FT                   /inference="protein motif:HMMPfam:PF00444"
FT   CDS             77605..77970
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SpyM50067"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="GOA:A2RC38"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /protein_id="CAM29410.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNMNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   misc_feature    77611..77928
FT                   /gene="rpsM"
FT                   /locus_tag="SpyM50067"
FT                   /note="HMMPfam hit to PF00416, Ribosomal protein
FT                   S13/S18,score 5.4e-55"
FT                   /inference="protein motif:HMMPfam:PF00416"
FT   misc_feature    77863..77904
FT                   /note="PS00646 Ribosomal protein S13 signature"
FT                   /inference="protein motif:Prosite:PS00646"
FT   CDS             77988..78371
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SpyM50068"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="GOA:A2RC39"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /protein_id="CAM29411.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   misc_feature    78036..78365
FT                   /gene="rpsK"
FT                   /locus_tag="SpyM50068"
FT                   /note="HMMPfam hit to PF00411, Ribosomal protein S11,score
FT                   2e-72"
FT                   /inference="protein motif:HMMPfam:PF00411"
FT   misc_feature    78270..78338
FT                   /note="PS00054 Ribosomal protein S11 signature"
FT                   /inference="protein motif:Prosite:PS00054"
FT   CDS             78417..79355
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM50069"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GOA:A2RC40"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /protein_id="CAM29412.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTEVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   misc_feature    78456..79088
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM50069"
FT                   /note="HMMPfam hit to PF01193, RNA polymerase Rpb3/Rpb11
FT                   dimerisation, score 9.6e-22"
FT                   /inference="protein motif:HMMPfam:PF01193"
FT   misc_feature    78576..78923
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM50069"
FT                   /note="HMMPfam hit to PF01000, RNA polymerase Rpb3/RpoA
FT                   insert domain, score 6.3e-56"
FT                   /inference="protein motif:HMMPfam:PF01000"
FT   misc_feature    79122..79325
FT                   /gene="rpoA"
FT                   /locus_tag="SpyM50069"
FT                   /note="HMMPfam hit to PF03118, Bacterial RNA
FT                   polymerase,alpha chain C, score 1.2e-31"
FT                   /inference="protein motif:HMMPfam:PF03118"
FT   CDS             79370..79756
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SpyM50070"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="GOA:A2RC41"
FT                   /db_xref="InterPro:IPR000456"
FT                   /protein_id="CAM29413.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEVTDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   misc_feature    79415..79753
FT                   /gene="rplQ"
FT                   /locus_tag="SpyM50070"
FT                   /note="HMMPfam hit to PF01196, Ribosomal protein L17,score
FT                   8.5e-62"
FT                   /inference="protein motif:HMMPfam:PF01196"
FT   misc_feature    79457..79525
FT                   /note="PS01167 Ribosomal protein L17 signature"
FT                   /inference="protein motif:Prosite:PS01167"
FT   repeat_region   80266..80280
FT                   /note="direct repeat"
FT   repeat_region   80280..81349
FT                   /note="IS1239"
FT   CDS             80380..81369
FT                   /transl_table=11
FT                   /locus_tag="SpyM50071"
FT                   /product="insertion sequence IS1239 putative transposase"
FT                   /note="Similar to Streptococcus pyogenes insertion sequence
FT                   IS1239 putative transposase SWALL:Q54534 (EMBL:U11799) (326
FT                   aa) fasta scores: E(): 1.3e-123, 98.14% id in 323 aa"
FT                   /db_xref="GOA:A2RC42"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC42"
FT                   /protein_id="CAM29414.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVCQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSPGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNEALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   NKTTTPKEVAAIEHWINHYPKRLFNYKSSVEMLKLANFNLKFGFPTKL"
FT   misc_feature    80461..80526
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1555.000, SD 4.48 at aa 28-49, sequence
FT                   RSNREIARLLGKAPQTIHNEIK"
FT   misc_feature    80887..81324
FT                   /locus_tag="SpyM50071"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   3.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   repeat_region   81352..81366
FT                   /note="direct repeat"
FT   rRNA            81668..83174
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            83261..83333
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:83294..83296,aa:Ala)"
FT   rRNA            83632..86532
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            86620..86735
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            86753..86825
FT                   /gene="tRNA-Val (TAC)"
FT                   /product="transfer RNA-Val (TAC)"
FT                   /anticodon="(pos:86786..86788,aa:Val)"
FT   tRNA            86831..86901
FT                   /gene="tRNA-Gly (TCC)"
FT                   /product="transfer RNA-Gly (TCC)"
FT                   /anticodon="(pos:86863..86865,aa:Gly)"
FT   tRNA            86936..87009
FT                   /gene="tRNA-Ile (GAT)"
FT                   /product="transfer RNA-Ile (GAT)"
FT                   /anticodon="(pos:86970..86972,aa:Ile)"
FT   tRNA            87032..87103
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu (TTC)"
FT                   /anticodon="(pos:87065..87067,aa:Glu)"
FT   tRNA            87114..87203
FT                   /gene="tRNA-Ser (TGA)"
FT                   /product="transfer RNA-Ser (TGA)"
FT                   /anticodon="(pos:87150..87152,aa:Ser)"
FT   tRNA            87213..87286
FT                   /gene="tRNA-Met (CAT)"
FT                   /product="transfer RNA-Met (CAT)"
FT                   /anticodon="(pos:87247..87249,aa:Met)"
FT   tRNA            87307..87379
FT                   /gene="tRNA-Phe (GAA)"
FT                   /product="transfer RNA-Phe (GAA)"
FT                   /anticodon="(pos:87340..87342,aa:Phe)"
FT   tRNA            87399..87479
FT                   /gene="tRNA-Tyr (GTA)"
FT                   /product="transfer RNA-Tyr (GTA)"
FT                   /anticodon="(pos:87433..87435,aa:Tyr)"
FT   tRNA            87486..87556
FT                   /gene="tRNA-Trp (CCA)"
FT                   /product="transfer RNA-Trp (CCA)"
FT                   /anticodon="(pos:87518..87520,aa:Trp)"
FT   tRNA            87568..87640
FT                   /gene="tRNA-His (GTG)"
FT                   /product="transfer RNA-His (GTG)"
FT                   /anticodon="(pos:87601..87603,aa:His)"
FT   tRNA            87649..87720
FT                   /gene="tRNA-Gln (TTG)"
FT                   /product="transfer RNA-Gln (TTG)"
FT                   /anticodon="(pos:87681..87683,aa:Gln)"
FT   tRNA            87740..87823
FT                   /gene="tRNA-Leu (CAA)"
FT                   /product="transfer RNA-Leu (CAA)"
FT                   /anticodon="(pos:87774..87776,aa:Leu)"
FT   CDS             join(88083..88217,88225..88275)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50071A"
FT                   /note="Identical to Streptococcus pyogenes MGAS10394
FT                   hypothetical protein SWALL:Q5XEA6 (EMBL:CP000003) (61 aa)
FT                   fasta scores: E(): 1.5e-27, 100% id in 61 aa.CDS contains a
FT                   possible frameshift after codon 45"
FT                   /db_xref="PSEUDO:CAM29415.1"
FT   CDS             join(88691..88753,88757..88879,88883..89218,89222..89470,
FT                   89470..89529)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SpyM50072"
FT                   /EC_number="2.7.1.148"
FT                   /note="Similar to Escherichia coli
FT                   4-diphosphocytidyl-2-c-methyl-D-erythritol kinase ispE
FT                   SWALL:ISPE_ECOLI (SWALL:P62615) (283 aa) fasta scores: E():
FT                   1.5e-11, 28.09% id in 267 aa. CDS contains 3 nonsense
FT                   mutations after codons 21, 62 and 174 which are opal,ochre
FT                   and opal respectively, and a frameshift mutation after
FT                   codon 257"
FT                   /db_xref="PSEUDO:CAM29416.1"
FT   misc_feature    88934..89461
FT                   /gene="ispE"
FT                   /locus_tag="SpyM50072"
FT                   /note="HMMPfam hit to PF00288, GHMP kinases putative
FT                   ATP-binding protei, score 1.2e-23"
FT                   /inference="protein motif:HMMPfam:PF00288"
FT   CDS             89598..90041
FT                   /transl_table=11
FT                   /locus_tag="SpyM50075"
FT                   /product="MarR-family regulatory protein"
FT                   /db_xref="GOA:A2RC45"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC45"
FT                   /protein_id="CAM29417.1"
FT                   /translation="MGTLEKKLDNLVNTILLKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQQRLTNTDLAKALNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   ASEHTHHHDETLNVYNRLLQKFSAKELEIVDKFVTVFAEELEG"
FT   misc_feature    89703..90020
FT                   /locus_tag="SpyM50075"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 5.8e-15"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    89751..89816
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2008.000, SD 6.03 at aa 52-73, sequence
FT                   LTNTDLAKALNISQAAVTKAIK"
FT   CDS             90045..90764
FT                   /transl_table=11
FT                   /locus_tag="SpyM50076"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RC46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC46"
FT                   /protein_id="CAM29418.1"
FT                   /translation="MRYISVENLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILQPKAGRVTIAKKNKDGKQLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWENRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHQHGKSVLMITHDPEEVKAYADRNIHLVRNQKLPWRCF
FT                   NIHEVETDDEKGGHGHA"
FT   misc_feature    90129..90689
FT                   /locus_tag="SpyM50076"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-43"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    90456..90500
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             90757..91572
FT                   /transl_table=11
FT                   /locus_tag="SpyM50077"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="GOA:A2RC47"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC47"
FT                   /protein_id="CAM29419.1"
FT                   /translation="MLDILSYDFMQRAVMAVVAISIFAPILGIFLILRRQSLMSDTLSH
FT                   VSLAGVALGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEISTAILMSLGLALSLI
FT                   IMSKSHSSSSMSLEQYLFGSIITISMEQVVALFAIAAIILILTVLFIRPMYILTFDEDT
FT                   AFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIAMRLGKNFKTVILL
FT                   GIVIGFSGMLSGIFLSYFFETPASATITMIFISIFLLVSLGGMLKKRLF"
FT   misc_feature    90772..91548
FT                   /locus_tag="SpyM50077"
FT                   /note="HMMPfam hit to PF00950, ABC 3 transport family,score
FT                   1.6e-98"
FT                   /inference="protein motif:HMMPfam:PF00950"
FT   misc_feature    order(90793..90855,90916..90984,91012..91071,91156..91224,
FT                   91282..91350,91411..91479,91489..91548)
FT                   /locus_tag="SpyM50077"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50077 by TMHMM2.0 at aa 15-35,
FT                   56-78,88-107,136-158,178-200, 221-243 and 247-266"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(join(91612..91980,91980..91994))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50078"
FT                   /EC_number="3.6.1.17"
FT                   /note="CDS contains a frameshift mutation after codon 4.
FT                   Frameshift occurs at a poly T pentamer"
FT                   /db_xref="PSEUDO:CAM29420.1"
FT   misc_feature    complement(91684..91986)
FT                   /locus_tag="SpyM50078"
FT                   /note="HMMPfam hit to PF01230, HIT domain, score 1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   CDS             complement(92045..93301)
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SpyM50079"
FT                   /product="putative tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="GOA:A2RC49"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /protein_id="CAM29421.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNDKHNVTLQIGGSDQWGNMTAGTELLRKKADKTGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIAEIE
FT                   TQFNAARHERLAQKILAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSEDSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGDRVQDLDYQLSNDDKT
FT                   DDQLTVIRRGKKKYAVLTY"
FT   misc_feature    complement(92105..92248)
FT                   /gene="tyrS"
FT                   /locus_tag="SpyM50079"
FT                   /note="HMMPfam hit to PF01479, S4 domain, score 6.7e-08"
FT                   /inference="protein motif:HMMPfam:PF01479"
FT   misc_feature    complement(92306..92347)
FT                   /note="PS00287 Cysteine proteases inhibitors signature"
FT                   /inference="protein motif:Prosite:PS00287"
FT   misc_feature    complement(92333..93226)
FT                   /gene="tyrS"
FT                   /locus_tag="SpyM50079"
FT                   /note="HMMPfam hit to PF00579, tRNA synthetases class I (W
FT                   and Y), score 2.5e-107"
FT                   /inference="protein motif:HMMPfam:PF00579"
FT   misc_feature    complement(93155..93187)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             93405..95705
FT                   /transl_table=11
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM50080"
FT                   /product="putative penicillin-binding protein 1B"
FT                   /db_xref="GOA:A2RC50"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC50"
FT                   /protein_id="CAM29422.1"
FT                   /translation="MVKWNTKQKRISHQRLGLLDLGPVLLRTLRLLSNFFYIVIFLFGM
FT                   MGFGMAFGYLASQIESVKVPSKESLVKQVESLTMISQMNYSDNSLISTLDTDLLRTPVA
FT                   NDAISENIKKAIVSTEDEHFQEHKGVVPKAVFRATLASVLGFGEASGGSTLTQQLVKQQ
FT                   VLGDDPTFKRKSKEIVYALALERYMSKDNILCDYLNVSPFGRNNKGQNIAGVEEAARGI
FT                   FGVSAKDLTVPQAAFLAGLPQSPIVYSPYLSTGQLKSEKDMAYGIKRQQNVLYNMYRTG
FT                   VLSKKEYEDYKAYPIQKDFIQPGSAIVNNHDYLYYTVLADAKKAMYSYLIKRDKVSSRD
FT                   LKNDETKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTVQMGN
FT                   VLTDNATGAVLGFVGGRDYALNQNNHAFNTVRSPGSSIKPIIAYGPAIDQGLMGSASVL
FT                   SNYPTTYSSGQKIMHADSEGTAMMPLQEALNTSWNIPAFWTQKLLREKGVDVENYMTKM
FT                   GYKIADYSIESLPLGGGIEVSVAQQTNAYQMLSNNGLYQKQYIVDKITASDGTVVYKHE
FT                   NKPIRIFSAATATILQELLRGPITSGATTTFKNRLAAINPWLANADWIGKTGTTENYTD
FT                   VWLVLSTPKVTLGGWAGHDDNTSLAPLTGYNNNSNYLAYLANAINQADPNVIGVGQRFN
FT                   LDPGVIKANVLKSTGLQPGTVNVNGHTFSVGGEMTTSLWSQKGPGAMTYRFAIGGTDAD
FT                   YQKAWGNFGFRKN"
FT   misc_feature    93495..93563
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM50080"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50080 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    93645..94166
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM50080"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   6.8e-81"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   misc_feature    94593..95447
FT                   /gene="pbp1B"
FT                   /locus_tag="SpyM50080"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 3.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   CDS             95969..99535
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GOA:A2RC51"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /protein_id="CAM29423.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EIRRQDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREIPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDIMHVDD
FT                   LEKAREKQAQETQEVSETTDEK"
FT   misc_feature    96050..97375
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /note="HMMPfam hit to PF04563, RNA polymerase beta subunit,
FT                   score 7.6e-16"
FT                   /inference="protein motif:HMMPfam:PF04563"
FT   misc_feature    96386..96952
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /note="HMMPfam hit to PF04561, RNA polymerase
FT                   Rpb2,domain,score 9e-12"
FT                   /inference="protein motif:HMMPfam:PF04561"
FT   misc_feature    97376..97594
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /note="HMMPfam hit to PF04565, RNA polymerase
FT                   Rpb2,domain,score 7.1e-41"
FT                   /inference="protein motif:HMMPfam:PF04565"
FT   misc_feature    97997..99163
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /note="HMMPfam hit to PF00562, RNA polymerase
FT                   Rpb2,domain,score 7.7e-246"
FT                   /inference="protein motif:HMMPfam:PF00562"
FT   misc_feature    98720..98758
FT                   /note="PS01166 RNA polymerases beta chain signature"
FT                   /inference="protein motif:Prosite:PS01166"
FT   misc_feature    99167..99397
FT                   /gene="rpoB"
FT                   /locus_tag="SpyM50081"
FT                   /note="HMMPfam hit to PF04560, RNA polymerase
FT                   Rpb2,domain,score 3.4e-49"
FT                   /inference="protein motif:HMMPfam:PF04560"
FT   CDS             99626..103267
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GOA:A2RC52"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /protein_id="CAM29424.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPKDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFVAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFNKSGN
FT                   KPEWMVLNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDNQRLKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDGLEINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQNPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAMNEIEVIDHTEVSAEAVFTAEAE"
FT   misc_feature    99635..100621
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /note="HMMPfam hit to PF04997, RNA polymerase
FT                   Rpb1,domain,score 7.2e-144"
FT                   /inference="protein motif:HMMPfam:PF04997"
FT   misc_feature    100625..101053
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /note="HMMPfam hit to PF00623, RNA polymerase
FT                   Rpb1,domain,score 1.5e-83"
FT                   /inference="protein motif:HMMPfam:PF00623"
FT   misc_feature    101060..101617
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /note="HMMPfam hit to PF04983, RNA polymerase
FT                   Rpb1,domain,score 4.3e-73"
FT                   /inference="protein motif:HMMPfam:PF04983"
FT   misc_feature    101690..101932
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /note="HMMPfam hit to PF05000, RNA polymerase
FT                   Rpb1,domain,score 2.1e-24"
FT                   /inference="protein motif:HMMPfam:PF05000"
FT   misc_feature    101936..103042
FT                   /gene="rpoC"
FT                   /locus_tag="SpyM50082"
FT                   /note="HMMPfam hit to PF04998, RNA polymerase
FT                   Rpb1,domain,score 1e-67"
FT                   /inference="protein motif:HMMPfam:PF04998"
FT   CDS             103419..103784
FT                   /transl_table=11
FT                   /locus_tag="SpyM50083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC53"
FT                   /protein_id="CAM29425.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDIIDEQQFSDWQEALDYFNQEWQ
FT                   RMKAIFPSYHSQKNLLATFWEKEDKRWCEDCDEDLQQFHSLLLLKNKDIVPSNNYIPEF
FT                   EQRNDSPQVAYLCKLNL"
FT   misc_feature    103419..103781
FT                   /locus_tag="SpyM50083"
FT                   /note="HMMPfam hit to PF06279, Protein of unknown function
FT                   (DUF1033), score 5.7e-85"
FT                   /inference="protein motif:HMMPfam:PF06279"
FT   CDS             103877..104815
FT                   /transl_table=11
FT                   /locus_tag="SpyM50084"
FT                   /product="putative competence protein"
FT                   /db_xref="GOA:A2RC54"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC54"
FT                   /protein_id="CAM29426.1"
FT                   /translation="MVQVLAKAILAKAEQVQAQDIYILPRADQYDLFLRIGDERRLVDV
FT                   YQSDRMAPLISHFKFVAGMIVGEKRRCQVGSCDYKLSKDKQLSLRLSSVGDYRGQESLV
FT                   IRLLHHQNKSVHYWFDGLTKVANQVGGRGLYLFAGPVGSGKTTLMYQLISNYHQEAQVI
FT                   SIEDPVEIKNHQILQLQVNDDIGMTYDNLIKLSLRHRPDILVIGEIRDSQTARAVIRAS
FT                   LTGAMVFSTVHAKSISGVYARLLELGITKAELSNCLALIAYQRLLNGGALIDSTQNEFE
FT                   YYSSSNWNQQIDQLLEAGHLNPKQAKLEKII"
FT   misc_feature    103877..104686
FT                   /locus_tag="SpyM50084"
FT                   /note="HMMPfam hit to PF00437, Type II/IV secretion system
FT                   protein, score 1.6e-27"
FT                   /inference="protein motif:HMMPfam:PF00437"
FT   misc_feature    104291..104314
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    104465..104509
FT                   /note="PS00662 Bacterial type II secretion system protein E
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00662"
FT   CDS             104799..105785
FT                   /transl_table=11
FT                   /locus_tag="SpyM50085"
FT                   /product="putative competence protein"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC55"
FT                   /protein_id="CAM29427.1"
FT                   /translation="MKKLSSKHQHKFIQLLANLLSTGFSFAEVIAFLKRSQLLQLDYVL
FT                   KMEESLLKGQGLADMLSGLGFSDAILTQISLADRHGNIETTLVAIQHYLNQMARIRRKT
FT                   VEVITYPLILLLFLFVMMLGLRRYLVPQLETQNQITYFLNHFPAFFIGFCSGLILLFGM
FT                   VWLRWRSQSRLKLYSRLSRYPFLGKLLKQYLTSYYAREWGTLIGQGLDLMTILDIMAIE
FT                   KSSLMKELAEDIRMSLLEGQAFHIKVATYPFFKKELSLMIEYGEIKSKLGAELEIYAQE
FT                   SWEQFFSQLYQVTQLIQPAIFLVVAVTIVMIYAAILLPIYQNMGGIF"
FT   sig_peptide     104799..104879
FT                   /locus_tag="SpyM50085"
FT                   /note="Signal peptide predicted for SpyM50085 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.920) with cleavage
FT                   site probability 0.816 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    104832..105191
FT                   /locus_tag="SpyM50085"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 3.4e-14"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   misc_feature    order(105117..105185,105228..105296,105693..105761)
FT                   /locus_tag="SpyM50085"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50085 by TMHMM2.0 at aa 107-129, 144-166 and 299-321"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    105390..105755
FT                   /locus_tag="SpyM50085"
FT                   /note="HMMPfam hit to PF00482, Bacterial type II secretion
FT                   system protein F, score 1.7e-17"
FT                   /inference="protein motif:HMMPfam:PF00482"
FT   CDS             105787..106113
FT                   /transl_table=11
FT                   /gene="comYC"
FT                   /locus_tag="SpyM50086"
FT                   /product="putative competence protein"
FT                   /db_xref="GOA:A2RC56"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC56"
FT                   /protein_id="CAM29428.1"
FT                   /translation="MINQWNNLRHKKLKGFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKADGSITEKQEKAYQDYYDKHKNEKA
FT                   RLSN"
FT   sig_peptide     105787..105909
FT                   /gene="comYC"
FT                   /locus_tag="SpyM50086"
FT                   /note="Signal peptide predicted for SpyM50086 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.995) with cleavage
FT                   site probability 0.534 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    105826..105888
FT                   /note="PS00409 Prokaryotic N-terminal methylation site"
FT                   /inference="protein motif:Prosite:PS00409"
FT   misc_feature    105829..105897
FT                   /gene="comYC"
FT                   /locus_tag="SpyM50086"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50086 by TMHMM2.0 at aa 15-37"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             106088..106516
FT                   /transl_table=11
FT                   /locus_tag="SpyM50087"
FT                   /product="putative competence protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC57"
FT                   /protein_id="CAM29429.1"
FT                   /translation="MKKPVLAIKAFTLLETLLSLSVMSFIILGLSVPVTKSYQKVEEHL
FT                   FFSHFEHLYRHQQKLAILQQKQRVLDISSTKIVTEGNSLTVPKSITVNHPYRLVIDQMG
FT                   GNHSLAKIIFDMTDRRFKYQFYLGSGNYQKTSQSLHSP"
FT   sig_peptide     106088..106204
FT                   /locus_tag="SpyM50087"
FT                   /note="Signal peptide predicted for SpyM50087 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.980) with cleavage
FT                   site probability 0.449 between residues 39 and 40"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    106115..106183
FT                   /locus_tag="SpyM50087"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50087 by TMHMM2.0 at aa 10-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             106521..106757
FT                   /transl_table=11
FT                   /locus_tag="SpyM50088"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC58"
FT                   /protein_id="CAM29430.1"
FT                   /translation="MIATGILFSIVILVLSSLQQSQAALMYYRKQQEKLNLALMAVQTR
FT                   TKEMTLNGCHITILRTDRYISIHDDEGEVMKIE"
FT   sig_peptide     106521..106589
FT                   /locus_tag="SpyM50088"
FT                   /note="Signal peptide predicted for SpyM50088 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.943) with cleavage
FT                   site probability 0.813 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             106750..107184
FT                   /transl_table=11
FT                   /locus_tag="SpyM50089"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC59"
FT                   /protein_id="CAM29431.1"
FT                   /translation="MSKQLSNIKAFTLLEALIALLVISGSLLVYQGLTQTLLKRSHYLA
FT                   RHDQDNWLLFSHQLREELSGARFYKVADNKLYVEKGKKVLAFGQFKSHDFRKSASNGKG
FT                   YQPMLFGISRSHIHIGQSQICITLKWKSGLERTFYYAFQD"
FT   misc_feature    106783..106851
FT                   /locus_tag="SpyM50089"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50089 by TMHMM2.0 at aa 12-34"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             107168..107494
FT                   /transl_table=11
FT                   /locus_tag="SpyM50090"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC60"
FT                   /protein_id="CAM29432.1"
FT                   /translation="MPFKTNLKAGILLYAMFMASIFLLVLQVYLSQVTALHKEYQAQTD
FT                   YVKARLIAEIVYQDHRYKASNPVSFKGGQVICRERKERWMLIVKLDQQRQYQFEYLKPK
FT                   QYSQ"
FT   sig_peptide     107168..107272
FT                   /locus_tag="SpyM50090"
FT                   /note="Signal peptide predicted for SpyM50090 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.993) with cleavage
FT                   site probability 0.518 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    107195..107263
FT                   /locus_tag="SpyM50090"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50090 by TMHMM2.0 at aa 10-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             107592..108545
FT                   /transl_table=11
FT                   /locus_tag="SpyM50091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RC61"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC61"
FT                   /protein_id="CAM29433.1"
FT                   /translation="MTFEKIEEAYQLLLENCQLIENDLKTHIYDAIVEQNSFYLGAEGA
FT                   SPQVAQNSDKLKALCLTKEEWRKAYQFLFIKAAQTEQLQANHQFTPDAIGFILLYLLEQ
FT                   LSDKDSLEVLEIGSGTGNLAQTLLNNTSKSLDYVGIELDDLLIDLSASIAEIMDSSAHF
FT                   IQEDAVRPQLLKESDIVISDLPVGYYPNDDIAKRYKVASSDKHTYAHHLLMEQSLKYLK
FT                   KDGFAIFLAPVNLLTSPQSQLLKQWLKDYAQVVALITLPDSIFGHPSNAKSIIVLQKQT
FT                   DHPMETFVYPIRDLKLAENIHDFMENFKKWKLSNVN"
FT   CDS             108604..109800
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SpyM50092"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /db_xref="GOA:A2RC62"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /protein_id="CAM29434.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEEVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHTEAVKILLNDLIHFGIIAAYDEITGVGHRVVAGGELFKESVVVN
FT                   DKVLEHIEELSVLAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKHTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAQEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLSGVSGIS
FT                   SDMRDIEAGLQEDNPDAVLAYNIFIDRIKKYIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   misc_feature    108610..109770
FT                   /gene="ackA"
FT                   /locus_tag="SpyM50092"
FT                   /note="HMMPfam hit to PF00871, Acetokinase family, score
FT                   7.9e-200"
FT                   /inference="protein motif:HMMPfam:PF00871"
FT   misc_feature    109207..109260
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS             109987..110295
FT                   /transl_table=11
FT                   /locus_tag="SpyM50093"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC63"
FT                   /protein_id="CAM29435.1"
FT                   /translation="MYVFIEPNDLKDYLITIYDERNRAIRKQTQVYCFYLMIVLFVALF
FT                   FFFPCLTIRDLVSYKLPLIFAYLYLIIRSLVAKKMEALGKIATNSQKPPFDTSQVLC"
FT   misc_feature    order(110077..110145,110173..110217)
FT                   /locus_tag="SpyM50093"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50093 by TMHMM2.0 at aa 31-53 and 63-77"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(110378..111148)
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SpyM50094"
FT                   /product="putative pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="GOA:A2RC64"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC64"
FT                   /protein_id="CAM29436.1"
FT                   /translation="MKIGIIGVGKMASAIIKGLKQTPHELIISGSSLERSKEIAEQLTL
FT                   PYAMSHQDLIDQVDLVILGIKPQLFETVLKPLHFKQPIISMAAGISLQRLATFVGQDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVKNGMPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSP
FT                   GGTTIAGLMELERLGLTTTVSSAIDKTIDKAKSL"
FT   misc_feature    complement(110426..111148)
FT                   /gene="proC"
FT                   /locus_tag="SpyM50094"
FT                   /note="HMMPfam hit to PF01089, Delta
FT                   1-pyrroline-5-carboxylate reductase, score 1.4e-64"
FT                   /inference="protein motif:HMMPfam:PF01089"
FT   CDS             complement(111196..112263)
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SpyM50095"
FT                   /product="putative glutamyl-aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /db_xref="GOA:A2RC65"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC65"
FT                   /protein_id="CAM29437.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKVEKAPRILVAAHMDEVGFMVSDIKVDGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQVIPLISGSVPPHFLRGANGSASLPHIEDIVFDGGFTDKAEAERFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMITEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNSGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEA
FT                   GVNIQYYCGKGGTDAGAAHLQNGGVPSTTIGVCARYIHSHQTLYAMDDFVEAQAFLQAI
FT                   IKKLDRSTVDLIKCY"
FT   misc_feature    complement(111256..112131)
FT                   /gene="pepA"
FT                   /locus_tag="SpyM50095"
FT                   /note="HMMPfam hit to PF05343, M42 glutamyl aminopeptidase,
FT                   score 1.4e-136"
FT                   /inference="protein motif:HMMPfam:PF05343"
FT   misc_feature    complement(112177..112263)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             complement(112373..112537)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50095A"
FT                   /product="hypothetical protein"
FT                   /note="Identical to Streptococcus pyogenes MGAS10394
FT                   hypothetical protein. UniProt:Q5XE82 (EMBL:CP000003) (54
FT                   aa) fasta scores: E()=7.8e-20, 100.000% id in 54 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC66"
FT                   /protein_id="CAM29438.1"
FT                   /translation="MTPLSLLFASEESFRILSALLFLLTSLCFIILMISLLPKKTGYRQ
FT                   KTNTSSRDL"
FT   CDS             112728..113012
FT                   /transl_table=11
FT                   /locus_tag="SpyM50096"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC67"
FT                   /protein_id="CAM29439.1"
FT                   /translation="MSKKKIGMISGIFGFSLAIGLGVVIKDYCQDRQRRQMTRDLRTFF
FT                   SPLGQIEVLYINPCQVKQDYISGGVVMSNGKQYQFTYHSRQISFEEDKG"
FT   sig_peptide     112728..112805
FT                   /locus_tag="SpyM50096"
FT                   /note="Signal peptide predicted for SpyM50096 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.774) with cleavage
FT                   site probability 0.629 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    112743..112802
FT                   /locus_tag="SpyM50096"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50096 by TMHMM2.0 at aa 6-25"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             113009..113326
FT                   /transl_table=11
FT                   /locus_tag="SpyM50097"
FT                   /product="putative thioredoxin"
FT                   /db_xref="GOA:A2RC68"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC68"
FT                   /protein_id="CAM29440.1"
FT                   /translation="MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAE
FT                   LTDMTLVCVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   Q"
FT   misc_feature    113009..113293
FT                   /locus_tag="SpyM50097"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 4.8e-06"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   CDS             113344..113970
FT                   /transl_table=11
FT                   /locus_tag="SpyM50098"
FT                   /product="putative tRNA-binding protein"
FT                   /db_xref="GOA:A2RC69"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC69"
FT                   /protein_id="CAM29441.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEESGKT
FT                   LAWNIFEASSLITIEGNGQIFLTDEDLARLNAELAKEGFSERLEPTVGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAIMPNGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   misc_feature    113629..113940
FT                   /locus_tag="SpyM50098"
FT                   /note="HMMPfam hit to PF01588, Putative tRNA binding
FT                   domain, score 2.6e-24"
FT                   /inference="protein motif:HMMPfam:PF01588"
FT   CDS             114121..114516
FT                   /transl_table=11
FT                   /locus_tag="SpyM50099"
FT                   /product="putative single stranded DNA-binding protein"
FT                   /db_xref="GOA:A2RC70"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC70"
FT                   /protein_id="CAM29442.1"
FT                   /translation="MYNKVIAIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   misc_feature    114124..114429
FT                   /locus_tag="SpyM50099"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 1.7e-29"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS             complement(114776..115417)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50100"
FT                   /product="putative deoxyadenosine kinase protein"
FT                   /EC_number="2.7.1.76"
FT                   /db_xref="GOA:A2RC71"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC71"
FT                   /protein_id="CAM29443.1"
FT                   /translation="MLIVLAGTIGAGKSSLAAALGEHLGTDVFYEAVDNNPVLDLYYQD
FT                   PKKYAFLLQIYFLNKRFKSIKEAYRADNNILDRSIFEDELFLKLNYKNGNVTKTELDIY
FT                   QELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSFEQVDGNPSLEQYYHQV
FT                   HSEYPTWYEDYKVSPKMKIDGNSLDFVQNPQDLATVLKMIDTKLKELHLL"
FT   misc_feature    complement(114803..115261)
FT                   /locus_tag="SpyM50100"
FT                   /note="HMMPfam hit to PF01712, Deoxynucleoside kinase,score
FT                   2.3e-52"
FT                   /inference="protein motif:HMMPfam:PF01712"
FT   misc_feature    complement(115376..115399)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(115437..116414)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50101"
FT                   /product="putative tRNA-dihydrouridine synthase"
FT                   /db_xref="GOA:A2RC72"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC72"
FT                   /protein_id="CAM29444.1"
FT                   /translation="MIKLNSSFRIGDVEIPHRTVLAPMAGVTNSAFRTIAKEFGAGLVV
FT                   MEMISEKGLLYNNEKTLHMLHIDENEHPMSIQLFGGDAEGLKRAADFIQTNTKADIVDI
FT                   NMGCPVNKVVKNEAGAKWLRDPNKIYHIVKEVTSVLDIPLTVKMRTGWADSSLAVENAL
FT                   AAESAGVSALAMHGRTREQMYTGTCDHKTLARVSKAITKIPFIGNGDVRSVQDAKFMIE
FT                   EIGVDAVMIGRAAMNNPYLFTQINHFFETGQELADLPFAKKLDIAKDHLKRLINLKGET
FT                   IAVREFRGLAPHYLRGTAGAAKVRGAVSRAETLAEVEAIFETVR"
FT   misc_feature    complement(115440..116357)
FT                   /locus_tag="SpyM50101"
FT                   /note="HMMPfam hit to PF01207, Dihydrouridine synthase
FT                   (Dus), score 4.1e-100"
FT                   /inference="protein motif:HMMPfam:PF01207"
FT   misc_feature    complement(116055..116111)
FT                   /note="PS01136 Uncharacterized protein family UPF0034
FT                   signature"
FT                   /inference="protein motif:Prosite:PS01136"
FT   CDS             complement(116401..117273)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50102"
FT                   /product="33 kDa chaperonin (heat shock protein 33
FT                   homolog)"
FT                   /db_xref="GOA:A2RC73"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /protein_id="CAM29445.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   MEALINDKA"
FT   misc_feature    complement(116437..117273)
FT                   /locus_tag="SpyM50102"
FT                   /note="HMMPfam hit to PF01430, Hsp33 protein, score
FT                   1.3e-156"
FT                   /inference="protein motif:HMMPfam:PF01430"
FT   CDS             complement(117399..118934)
FT                   /transl_table=11
FT                   /gene="rofA"
FT                   /locus_tag="SpyM50103"
FT                   /product="RofA transcriptional regulator"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC74"
FT                   /protein_id="CAM29446.1"
FT                   /translation="MPYVKKKKDSFLVETYLEQSIRDKSELVLLLFKSPTIIFSHVAKQ
FT                   TGLTAVQLKYYCKELDDFFGNNLDITIKKGKIICCFVKPVKEFYLHQLYDTSTILKLLV
FT                   FFIKNGTSSQPLIKFSKKYFLSSSSAYRLRESLIKLLREFGLRVSKNTIVGEEYRIRYL
FT                   IAMLYSKFGIVIYPLDHLDNQIIYRFLSQSATNLRTSPWLEEPFSFYNMLLALSWKRHQ
FT                   FAVSIPQTRIFRQLKKLFIYDCLTRSSRQVIENAFSLMFSQGDLDYLFLIYITTNNSFA
FT                   SLQWTPQHIETCCHIFEKNDTFRLLLEPILKRLPQLNHSKQDLIKALMYFSKSFLFNLQ
FT                   HFVIEIPSFSLPTYTGNSNLYKALKNIVNQWLAQLPGKRHLNEKHLQLFCSHIEQILKN
FT                   KQPALTVVLISSNFINAKLLTDTIPRYFSDKGIHFYSFYLLRDDIYQIPSLKPDLVITH
FT                   SRLIPFVKNDLVKGVTVAEFSFDNPDYSIASIQNLIYQLKDKKYQDFLNEQLQ"
FT   misc_feature    complement(117834..118622)
FT                   /gene="rofA"
FT                   /locus_tag="SpyM50103"
FT                   /note="HMMPfam hit to PF07003, RofA transcriptional
FT                   regulator, score 1.5e-166"
FT                   /inference="protein motif:HMMPfam:PF07003"
FT   misc_feature    complement(118761..118826)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1169.000, SD 3.17 at aa 37-58, sequence
FT                   IIFSHVAKQTGLTAVQLKYYCK"
FT   CDS             119366..120937
FT                   /transl_table=11
FT                   /locus_tag="SpyM50104"
FT                   /product="putative surface-anchored protein"
FT                   /note="CDS contains a putative sortase processing motif
FT                   (VPXTG) after codon 486"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC75"
FT                   /protein_id="CAM29447.1"
FT                   /translation="MQKRDKTNYGSANNKRRQTTIGLLKVFLTFVALIGIVGFSIRAFG
FT                   AEEKSTETKKTSVIIRKYAEGDYSKLLEGATLRLTGEDIPDFQEKVFQSNGTGEKIELS
FT                   NGTYTLTETSSPDGYKITEPIKFRVVNKKVFIVQKDGSQVENPNKELGSPYTIEAYNDF
FT                   DEFGLLSTQNYAKFYYGKNYDGSSQIVYCFNANLKSPPDSEDHGATINPDFTTGDIRYS
FT                   HIAGSDLIKYANTARDEDPQLFLKHVKKVIENGYHKKGQAIPYNGLTEAQFRAATQLAI
FT                   YYFTDSVDLTKDRLKDFHGFGDMNDQTLGVAKKIVEYALSDEDSKLTNLDFFVPNNSKY
FT                   QSLIGTEYHPDDLVDVIRMEDKKQEVIPVTHSLTVQKTVVGELGDKTKGFQFELELKDK
FT                   TGQPIVNTLKTNNQDLVAKDGKYSFNLKHGDTIRIEGLPTGYSYTLKETEAKDYIVTVD
FT                   NKVSQEAQSASENVTADKEVTFENRKDLVPPTGLTTDGAIYLWLLLLVPFGLLVWLFGR
FT                   KGLKND"
FT   sig_peptide     119366..119500
FT                   /locus_tag="SpyM50104"
FT                   /note="Signal peptide predicted for SpyM50104 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.998) with cleavage
FT                   site probability 0.785 between residues 45 and 46"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(119426..119494,120854..120913)
FT                   /locus_tag="SpyM50104"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50104 by TMHMM2.0 at aa 21-43 and 497-516"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    119579..119776
FT                   /locus_tag="SpyM50104"
FT                   /note="HMMPfam hit to PF05738, Cna protein B-type
FT                   domain,score 6.3e-09"
FT                   /inference="protein motif:HMMPfam:PF05738"
FT   CDS             120930..121451
FT                   /transl_table=11
FT                   /locus_tag="SpyM50105"
FT                   /product="putative signal peptidase"
FT                   /db_xref="GOA:A2RC76"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC76"
FT                   /protein_id="CAM29448.1"
FT                   /translation="MTNYLNRLNENSLFKAFIRLVLKISIIGFLGYILFQYVFGVMIIN
FT                   TNDMSPALSAGDGVLYYRLTDRYHINDVVVYEVDNTLKVGRIVAQAGDEVSFTQEGGLL
FT                   INGHPPEKEVPYLTYPHSSGPNFPYKVPTGKYFILNDYREERLDSRYYGALPVNQIKGK
FT                   ISTLLRVRGI"
FT   misc_feature    120990..121058
FT                   /locus_tag="SpyM50105"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50105 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             121458..122516
FT                   /transl_table=11
FT                   /locus_tag="SpyM50106"
FT                   /product="putative surface-anchored protein"
FT                   /note="CDS contains a putative sortase processing motif
FT                   (QVXTG) after codon 319"
FT                   /db_xref="InterPro:IPR017503"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC77"
FT                   /protein_id="CAM29449.1"
FT                   /translation="MEREKMKKNKLLLATAILATALGTASLNQNVKAETAGVVTGKSLQ
FT                   VTKTMTYDDEEVLMPETAFTFTIEPDMTASGKEGSLDIKNGIVEGLDKQVTVKYKNTDK
FT                   TSQKTKIAQFDFSKVKFPAIGVYRYMVSEKNDKKDGITYDDKKWTVDVYVGNKANNEEG
FT                   FEVLYIVSKEGTSSTKKPIEFTNSIKTTSLKIEKQITGNAGDRKKSFNFTLTLQPSEYY
FT                   KTGSVVKIEQDGSKKDVTIGTPYKFTLGHGKSVMLSKLPIGINYYLSEDEANKDGYTTT
FT                   ATLKEQGKEKSSDFTLSTQNQKTDESADEIVVTNKRDTQVPTGVVGTLAPFAVLSIVAI
FT                   GGVIYITKRKKA"
FT   sig_peptide     121458..121556
FT                   /locus_tag="SpyM50106"
FT                   /note="Signal peptide predicted for SpyM50106 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.993 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    121563..121586
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    122427..122495
FT                   /locus_tag="SpyM50106"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50106 by TMHMM2.0 at aa 324-346"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             122517..123257
FT                   /transl_table=11
FT                   /gene="srtB"
FT                   /locus_tag="SpyM50107"
FT                   /product="sortase B"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR009835"
FT                   /db_xref="InterPro:IPR015986"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC78"
FT                   /protein_id="CAM29450.1"
FT                   /translation="MISQRMMMTIVQVINKAIDTLILIFCLVVLFLAGFGLWDSYHLYQ
FT                   QADASNFKKFKTAQQQPKFEDLLALNEDVIGWLNIPGTHIDYPLVQGKTNLEYINKAVD
FT                   GSVAMSGSLFLDTRNHNDFTDDYSLIYGHHMAGNAMFGEIPKFLKKDFFNKHNKAIIET
FT                   KERKKLTVTIFACLKTDAFDQLVFNPNAITNQDQQKQLVDYISKRSKQFKPVKLKHHTK
FT                   FVAFSTCENFSTDNRVIVVGTIQE"
FT   misc_feature    122577..122645
FT                   /gene="srtB"
FT                   /locus_tag="SpyM50107"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50107 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    122700..123248
FT                   /gene="srtB"
FT                   /locus_tag="SpyM50107"
FT                   /note="HMMPfam hit to PF07170, Sortase B, score 1.6e-126"
FT                   /inference="protein motif:HMMPfam:PF07170"
FT   CDS             123274..123861
FT                   /transl_table=11
FT                   /locus_tag="SpyM50106"
FT                   /product="putative surface-anchored protein"
FT                   /note="CDS contains a putative sortase processing motif
FT                   (LPXAG) after codon 161"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC79"
FT                   /protein_id="CAM29451.1"
FT                   /translation="MRKYWKMLFSVVMILTMLAFNQTVLAKDSTVQTSISVENVLERAG
FT                   DSTPFSVALESIDAMKTIDEITIAGSGKASFSPLTFTTVGQYTYRVYQKPSQNKDYQAD
FT                   TTVFDVLVYVTYDEDGTLVAKVISRRAGDEEKSAITFKPKRLVKPIPPRQPNIPKTPLP
FT                   LAGEVKSLLGILSIVLLGLLVLLYVKKLKSRL"
FT   sig_peptide     123274..123351
FT                   /locus_tag="SpyM50108"
FT                   /note="Signal peptide predicted for SpyM50108 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.985 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(123292..123351,123784..123837)
FT                   /locus_tag="SpyM50108"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50108 by TMHMM2.0 at aa 7-26 and 171-188"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(124021..125226)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50109"
FT                   /product="AraC family regulatory protein"
FT                   /db_xref="GOA:A2RC80"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024022"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC80"
FT                   /protein_id="CAM29452.1"
FT                   /translation="MVIFDLKHVQTLHSLSQLPISVMSQDKALIQVYGNDDYLLCYYQF
FT                   LKHLAIPQAAQDVIFYEGLFEESFMIFPLCHYIIAIGPFYPYSLNKDYQEQLANNFLKH
FT                   SSHRSKEELLSYMALVPHFPINNVRNLLIAIDAFFDTQFETTCQQTIHQLLQHSKQMTA
FT                   DPDIIHRLKHISKASSQLPPVLEHLNHIMDLVKLGNPQLLKQEINRIPLSSITSSSISA
FT                   LRAEKNLTVIYLTRLLEFSFVENTDVAKHYSLVKYYMALNEEASDLLKVLRIRCAAIIH
FT                   FSESLTNKSISDKRQMYNSVLHYVDSHLYSKLKVSDIAKRLYVSESHLRSVFKKYSNVS
FT                   LQHYILSTKIKEAQLLLKRGIPVGEVAKSLYFYDTTHFHKIFKKYTGISSKDYLAKYRD
FT                   NI"
FT   misc_feature    complement(124042..124173)
FT                   /locus_tag="SpyM50109"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.6e-06"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(124189..124329)
FT                   /locus_tag="SpyM50109"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix protei, score 2.5e-08"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    complement(124225..124290)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1574.000, SD 4.55 at aa 324-345, sequence
FT                   LKVSDIAKRLYVSESHLRSVFK"
FT   CDS             125608..127698
FT                   /transl_table=11
FT                   /locus_tag="SpyM50110"
FT                   /product="protein F2 like fibronectin-binding protein"
FT                   /note="CDS contains a putative sortase processing motif
FT                   (LPXTG) after codon 657"
FT                   /db_xref="InterPro:IPR004237"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR008970"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC81"
FT                   /protein_id="CAM29453.1"
FT                   /translation="MTQKNSYKLSFLLSLTGFILGLLLVFIGLSGVSVGHAETRNGANK
FT                   QGAFEIKKNKSQEEYNYEVYDNRNILQDGEHKLEIKRVDGTGKTYQGFCFQLTKNFPTA
FT                   QGVSKKLYKKLSSSDEETLKQYASKYTSNRRGDTSGNLKKQIAKVLTEGYPTNKSDWLN
FT                   GLTENEKIEVTQDAIWYFTETTVPADRSYTNRNVNSQKMKEVYQKLIDTTDIDKYEDVQ
FT                   FDLFVPQDTNLQAVISVEPVIESLPWTSLKPIAQKDITAKKIWVDAPKEKPIIYFKLYR
FT                   QLPGEKEVAVDDAELKQINSEGQQEISVTWTNQLVTDEKGMAYIYSVKEVDKNGELLEP
FT                   KDYIKKEDGLTVTNTYVKPTSGHYDIEVTFGNGHIDITEDTTPDIVSGENQMKQIEGED
FT                   SKPIDEVTENNLIEFGKNTMPGEEDGTNSNKYEEVEDSRPVDTLSGLSSEQGQSGDMTI
FT                   EEDSATHIKFSKRDIDGKELAGATMELRDSSGKTISTWISDGQVKDFYLMPGKYTFVET
FT                   AAPDGYEIATAITFTVNEQGQVTVNGKATKGDAHIVMVDAYKPTKGSGQVIDIEEKLPD
FT                   EQGHSGSTTEIEDSKSSDVIIGGQGQIVETTEDTQTGMHGDSGCKTEVEDTKLVQSFHF
FT                   DNKESESNSEIPKKDKPKSNTSLPATGEKQHNMFFWMVTSCSLISSVFVISLKTKKRLS
FT                   SC"
FT   sig_peptide     125608..125718
FT                   /locus_tag="SpyM50110"
FT                   /note="Signal peptide predicted for SpyM50110 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.905 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(125641..125709,127609..127668)
FT                   /locus_tag="SpyM50110"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50110 by TMHMM2.0 at aa 12-34 and 668-687"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    126901..127038
FT                   /locus_tag="SpyM50110"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding
FT                   repeat,score 0.43"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    127039..127239
FT                   /locus_tag="SpyM50110"
FT                   /note="HMMPfam hit to PF05738, Cna protein B-type
FT                   domain,score 1.8e-18"
FT                   /inference="protein motif:HMMPfam:PF05738"
FT   misc_feature    127303..127407
FT                   /locus_tag="SpyM50110"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding
FT                   repeat,score 0.00021"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    127411..127524
FT                   /locus_tag="SpyM50110"
FT                   /note="HMMPfam hit to PF02986, Fibronectin binding
FT                   repeat,score 1e-19"
FT                   /inference="protein motif:HMMPfam:PF02986"
FT   misc_feature    127579..127596
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide"
FT                   /inference="protein motif:Prosite:PS00343"
FT   CDS             complement(127964..128629)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50111"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC82"
FT                   /protein_id="CAM29454.1"
FT                   /translation="MKRCNKYLFTSLLAASMLFSSYKSVHAHDNIDEKGKVHLYWQGNY
FT                   YVDSYVDYTKTLVDNNNSIEWTVTFNSAKEQWVYPDFSVFLPKGVKAPKEITYEHHYWD
FT                   GTVHSEKRSNTQWHYDWENQKTNFNQEFDKFPGYTGWSPSLDKFYKLKNDGKFSHILVD
FT                   TYGRQSHTYFSHKMVWKFKTELEEGNKDKWNKLPFIAGIKQNNPLAASFPSYKGEFGE"
FT   sig_peptide     complement(128549..128629)
FT                   /locus_tag="SpyM50111"
FT                   /note="Signal peptide predicted for SpyM50111 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.988) with cleavage
FT                   site probability 0.794 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             128982..130388
FT                   /transl_table=11
FT                   /locus_tag="SpyM50112"
FT                   /product="putative short-chain fatty acids transporter"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC83"
FT                   /protein_id="CAM29455.1"
FT                   /translation="MNNIKTKKRFMDRYIDGFMKWMPESLFICFILTFLVVTMSVLMTD
FT                   SPFIGTEKTGGIIYGWVNGFWGLLSFAMQMTILLATGNAVVSSPPAHKMFKFLAKLPQT
FT                   RTQIFIFSIVVGSIFGFLHWGLGMMVAIVFGKELLVQARQKGIKVHTPLFVATLFFTFL
FT                   PATSGLSGAAVLYSATPDYLRNSVADAYKQVVPESVPLTESVLNLPFISLLVVCMLVPL
FT                   CFALLAHPKDETKIMELDDEIYHHSLDTASHVVIARNTPAEKMNASRLVMYLVGGAIVS
FT                   YSLYHFSVVGLSGLDLNSFNFLFLGLGLPLCGQQGPEYYGSLFKDGVMSSWGLVLQFPF
FT                   YAGIFGIIQSTGLGLEISHFFVAISNGTTWPVFAYLYSALLNIAVPSGGSKFVIEAPYI
FT                   VPATIEVGNDLGKILQAYQLGDATTNLIVPFWALSYLSNFKLKFNQIVAYTIPCVLVVT
FT                   GIAIIYLFVF"
FT   sig_peptide     128982..129131
FT                   /locus_tag="SpyM50112"
FT                   /note="Signal peptide predicted for SpyM50112 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.809) with cleavage
FT                   site probability 0.610 between residues 50 and 51"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    128988..130385
FT                   /locus_tag="SpyM50112"
FT                   /note="HMMPfam hit to PF02667, Short chain fatty acid
FT                   transporter, score 1.1e-47"
FT                   /inference="protein motif:HMMPfam:PF02667"
FT   misc_feature    order(129042..129110,129174..129242,129303..129371,
FT                   129594..129662,129789..129857,129978..130046,
FT                   130065..130133,130314..130382)
FT                   /locus_tag="SpyM50112"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50112 by TMHMM2.0 at aa 21-43,
FT                   65-87,108-130,205-227,270-292, 333-355, 362-384 and
FT                   445-467"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(130457..131368)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50113"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="GOA:A2RC84"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC84"
FT                   /protein_id="CAM29456.1"
FT                   /translation="MNISSLAYFIEIVNCDFNLTKAAQKSHISQPALSSYIKTIEKEEG
FT                   VVLFQRQKGRLVGLTSVGERFFENAKVVIASHEQLMADLRSESKKYKGEISIGIPQLIS
FT                   GIVFSELIPKLIEENPEVKFHIVETGAYELQKKLFLKEVDFAILLTPTTLDATIADIDI
FT                   LLRDQLCLYMSHKTFQETFDSNPNISIKALHRQNLVTFDKTFMINHQLTTLFEEANSLP
FT                   VVKCYSASWDFLLNCTRYSSYLTILPRPITHFAHMDGLVEVQLTEHPKWEVVLASLKHN
FT                   KTSHLKHYIKHTILDYFTNQRF"
FT   misc_feature    complement(130472..131107)
FT                   /locus_tag="SpyM50113"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 3.8e-11"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   misc_feature    complement(130742..130774)
FT                   /note="PS00284 Serpins signature"
FT                   /inference="protein motif:Prosite:PS00284"
FT   misc_feature    complement(131177..131362)
FT                   /locus_tag="SpyM50113"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 1e-13"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    complement(131225..131317)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(131255..131320)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1880.000, SD 5.59 at aa 17-38, sequence
FT                   FNLTKAAQKSHISQPALSSYIK"
FT   CDS             131489..132673
FT                   /transl_table=11
FT                   /gene="atoB1"
FT                   /locus_tag="SpyM50114"
FT                   /product="acetyl-CoA acetyltransferase 1"
FT                   /note="Similar to SpyM50447, 64.872% identity (64.872%
FT                   ungapped) in 390 aa overlap"
FT                   /db_xref="GOA:A2RC85"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC85"
FT                   /protein_id="CAM29457.1"
FT                   /translation="MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLK
FT                   SDAIDEVIFGNVLHAGLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAHKIQ
FT                   TGNADIVLVGGTENMSQAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAE
FT                   NIVQQYGLTREEQDAFAADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLIDQDEYPK
FT                   FGTTVDKLAKLRPAFIKDEGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSY
FT                   ASAGVDPSIMGCGPIPATKKALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKV
FT                   NVNGGAIALGHPIGASGARILVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR"
FT   misc_feature    131492..132283
FT                   /gene="atoB1"
FT                   /locus_tag="SpyM50114"
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 2.1e-151"
FT                   /inference="protein motif:HMMPfam:PF00108"
FT   misc_feature    132302..132670
FT                   /gene="atoB1"
FT                   /locus_tag="SpyM50114"
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 1.1e-74"
FT                   /inference="protein motif:HMMPfam:PF02803"
FT   misc_feature    132509..132559
FT                   /note="PS00737 Thiolases signature 2"
FT                   /inference="protein motif:Prosite:PS00737"
FT   misc_feature    132614..132655
FT                   /note="PS00099 Thiolases active site"
FT                   /inference="protein motif:Prosite:PS00099"
FT   CDS             132685..133344
FT                   /transl_table=11
FT                   /gene="atoD1"
FT                   /locus_tag="SpyM50115"
FT                   /product="acetate CoA-transferase alpha subunit 1"
FT                   /note="Similar to SpyM50446, 74.057% identity (74.057%
FT                   ungapped) in 212 aa overlap"
FT                   /db_xref="GOA:A2RC86"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC86"
FT                   /protein_id="CAM29458.1"
FT                   /translation="MKENKRIAIAEAISHIKDGDTIMVGGFMANGTPEALIDALVDKGT
FT                   KDLTLICNDAGFVDRGVGKMVANHQFKTIYATHIGLNKEAGRQMTAGETTIELIPQGTF
FT                   AEKIRIGAYGIGGFYTPTGVGTLVAEGKETKTIKGKTYLLEYPFEADVALIFANKADEM
FT                   GNLQYSGSENNFNQLMAACAKTTIVQAREIVPVGTIQPECVHTPHIFVDYIVKEGV"
FT   misc_feature    132700..133335
FT                   /gene="atoD1"
FT                   /locus_tag="SpyM50115"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,score
FT                   3.5e-82"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    132736..132783
FT                   /note="PS01273 CoA transferases signature 1"
FT                   /inference="protein motif:Prosite:PS01273"
FT   CDS             133347..133994
FT                   /transl_table=11
FT                   /gene="atoA1"
FT                   /locus_tag="SpyM50116"
FT                   /product="acetate CoA-transferase beta subunit 1"
FT                   /note="Similar to SpyM50445, 68.571% identity (68.900%
FT                   ungapped) in 210 aa overlap"
FT                   /db_xref="GOA:A2RC87"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC87"
FT                   /protein_id="CAM29459.1"
FT                   /translation="MAVALSKEEIQNRIAKRVAKELEDGTLVNLGIGLPTKVANFVPEE
FT                   MTVYFQSENGFIGLGPKSDDPNSTIVNAGGQPVTVYPGAAFFNSADSFGIIRGGHVDLT
FT                   VLGALEIAENGDIANYLIPGKMVPGMGGAMDLLVGAKKVIVAMEHTNKGKHKLLKECTL
FT                   PLTAKGVVDLIITEMGVFKVTPDGIQVIEISEGFTFDEVQAATGVPLSIAEG"
FT   misc_feature    133377..133961
FT                   /gene="atoA1"
FT                   /locus_tag="SpyM50116"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,score
FT                   3.6e-45"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    133494..133520
FT                   /note="PS01274 CoA transferases signature 2"
FT                   /inference="protein motif:Prosite:PS01274"
FT   CDS             complement(134116..134796)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50117"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RC88"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC88"
FT                   /protein_id="CAM29460.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKQSPLTTFALDLITNKVYKEKDFVTNYKAIVSPQHKEVRGSTFFIKDKKGNLEG
FT                   MLCINLDISAYQGVARDLLKLVNLNLEHFIPTAKEPKTVTPQPEEAVEILTSNIQDIIG
FT                   QIIDPSLLRHNVHLSQDVKIDIVAKLYEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   EADQ"
FT   misc_feature    complement(134137..134202)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1700.000, SD 4.98 at aa 199-220, sequence
FT                   GAVSKVADILCISEPSVYRYLK"
FT   CDS             134970..135335
FT                   /transl_table=11
FT                   /locus_tag="SpyM50118"
FT                   /product="Endoribonuclease L-PSP family protein"
FT                   /db_xref="GOA:A2RC89"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC89"
FT                   /protein_id="CAM29461.1"
FT                   /translation="MKSYPEPMGPYSTYTIEGHFLYTAGQLPLNPVTGQLSDGFEAQCR
FT                   QVFVNLQSILAEQKLDLNHIYKLNVYLTDVTNVEILNHVMTDLFEEPYPVRTAVQVSAL
FT                   PLQALIEVEAVARVKQL"
FT   misc_feature    134970..135323
FT                   /locus_tag="SpyM50118"
FT                   /note="HMMPfam hit to PF01042, Endoribonuclease L-PSP,score
FT                   3.3e-37"
FT                   /inference="protein motif:HMMPfam:PF01042"
FT   CDS             135372..136391
FT                   /transl_table=11
FT                   /locus_tag="SpyM50119"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RC90"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC90"
FT                   /protein_id="CAM29462.1"
FT                   /translation="MDIIIGTSLLILVLAIFSLFNYKAPHGAKAMGALASAACASFLVE
FT                   AFQDSFFGKVLGFQFLSEVGGANGSLSGVAAAILVAIAIGVSPGYAVLIGLSVSGTGII
FT                   PGFVAGYVVSFLIKWMEKNIPGGLDLISIIIVGAPLTRFLAQLITPVINSTLLTIGDIL
FT                   TSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSFMNGV
FT                   LFYRLKLGERKDNIAFAIEPLTQADVTSANPIPIYVTNFVGGAACGVLIALMKLVNDTP
FT                   GTATPIAGFAVMFAYNPVAKVLITALGCIIISLIVGYIGGSVFKNYRLVTKQELQARN"
FT   sig_peptide     135372..135476
FT                   /locus_tag="SpyM50119"
FT                   /note="Signal peptide predicted for SpyM50119 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.923) with cleavage
FT                   site probability 0.270 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(135381..135437,135450..135503,135561..135629,
FT                   135648..135716,135759..135827,135864..135932,
FT                   135975..136043,136131..136190,136275..136343)
FT                   /locus_tag="SpyM50119"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SpyM50119 by TMHMM2.0 at aa 4-22,
FT                   27-44,64-86,93-115,130-152, 165-187, 202-224, 254-273 and
FT                   302-324"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             136840..137163
FT                   /transl_table=11
FT                   /locus_tag="SpyM50120"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC91"
FT                   /protein_id="CAM29463.1"
FT                   /translation="MMNTLLSLMNSIEQEARTIYDSYDAKKKALADKKEEELKQLFLEY
FT                   EQETQLLLEAKREVFFEANRQEQKASKKRLATQQLALHAILEEHKLTVVRELVDKVVET
FT                   YGH"
FT   CDS             137153..139153
FT                   /transl_table=11
FT                   /gene="ntpI"
FT                   /locus_tag="SpyM50121"
FT                   /product="V-type sodium ATP synthase subunit I"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC92"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC92"
FT                   /protein_id="CAM29464.1"
FT                   /translation="MAISQMKKLAMVFEKDYLDLVLKTLQQSQLVEVRDMKQLKHWQDA
FT                   FNQGNVKLPQIVQYDLTHQKPLLDDEALQYLLQSQQELENGLASLSAFLPPIGKLTALR
FT                   QKTPSLSFKQFEESHRQQAAQTALKMMSQKIERLEQLQNKIDQLTEYCQELEKWRSLTV
FT                   LPQDLAQFHFLSARVGTIPSTANDHFYHQLKQHKGLFIEEVYHTEFEYGLVLFWQAQDT
FT                   IHLQKYQFKPLLYKEQLLPSEQLRINKELLTNWLAEKDSLLKELRQSQKILAQLQVEID
FT                   YVLSQYQRQQTKKQLLGTRHLIALEGWIEADSVNQLKGLMTKTLGDMFYLDSYDVTPDD
FT                   WEDVPIKLRNHRYIAPFELVTEMYALPKYQEKDPTPFLAPLYLTFFGMMVADLGYGLLL
FT                   YAVTLAALVFFNLQKTSKRLVTFFNILAISVAIWGLIYGSFFGFDLPVALLSTKTDVIT
FT                   ILVVSLLFGFVTLIFGLLLGAWQQVRMKAYATAYTSSLAWTFILLGLLLFILGKNVSGL
FT                   AYLSVIGKWLALGNAFGILVVSLLKSKSLLGLGSGLYNLYGISSYLSDLVSFTRLMALG
FT                   LSGASIGAAFNMIVGIFPPVTRFTVGIFIFILLHAINIFLSMLSGYVHGARLIFVEFFG
FT                   KFYEGGGKAFNPLKLADNYVNVNEETDLEDN"
FT   misc_feature    137216..139105
FT                   /gene="ntpI"
FT                   /locus_tag="SpyM50121"
FT                   /note="HMMPfam hit to PF01496, V-type ATPase 116kDa subunit
FT                   family, score 3e-18"
FT                   /inference="protein motif:HMMPfam:PF01496"
FT   misc_feature    order(138320..138388,138407..138475,138518..138586,
FT                   138611..138679,138707..138775,138788..138856,
FT                   138866..138934,138953..139021)
FT                   /gene="ntpI"
FT                   /locus_tag="SpyM50121"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50121 by TMHMM2.0 at aa
FT                   390-412,419-441,456-478,487-509, 519-541, 546-568, 572-594
FT                   and 601-623"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             139155..139634
FT                   /transl_table=11
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM50122"
FT                   /product="V-type sodium ATP synthase subunit K"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC93"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC93"
FT                   /protein_id="CAM29465.1"
FT                   /translation="MEHLAHYFTAHGGVFFAALGIVLAVALSGMGSAYGVGKGGQAAAA
FT                   LLKEESEKFTSALILQLLPGSQGIYGFAIGILIWMKLTPELSVNQGLAYFLVSLPIAIV
FT                   GYFSAKHQGNVSVAGMQILAKRPKDFMKGVILAAMVETYAILAFVVSFILLNKIG"
FT   sig_peptide     139155..139259
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM50122"
FT                   /note="Signal peptide predicted for SpyM50122 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.933) with cleavage
FT                   site probability 0.548 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(139197..139265,139326..139394,139422..139481,
FT                   139551..139619)
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM50122"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50122 by TMHMM2.0 at aa 15-37, 58-80, 90-109 and
FT                   133-155"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    139200..139397
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM50122"
FT                   /note="HMMPfam hit to PF00137, ATP synthase subunit C,score
FT                   6.5e-05"
FT                   /inference="protein motif:HMMPfam:PF00137"
FT   misc_feature    139428..139625
FT                   /gene="ntpK"
FT                   /locus_tag="SpyM50122"
FT                   /note="HMMPfam hit to PF00137, ATP synthase subunit C,score
FT                   6.2e-09"
FT                   /inference="protein motif:HMMPfam:PF00137"
FT   CDS             139702..140286
FT                   /transl_table=11
FT                   /gene="ntpE"
FT                   /locus_tag="SpyM50123"
FT                   /product="V-type sodium ATP synthase subunit E"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC94"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC94"
FT                   /protein_id="CAM29466.1"
FT                   /translation="MNDITQLRQNVLEKAHQEGQQCLKIATDSLDTDFKERQQQGLHDL
FT                   KAKRQKELKALEQQFQVAQQQLKNQERQALLALKQDSIKELFEASLEKMTNFSKEEELA
FT                   FLKQVLSKYPEQPLQVTFGEKTGQKFSSYDCAELRLAFPQLSYNQELIPQEAGFLVSLD
FT                   QVDDNYLYRYLLESVLKEESSRIIDMLFSEI"
FT   misc_feature    139852..139917
FT                   /note="Predicted helix-turn-helix motif with score 980.000,
FT                   SD 2.52 at aa 51-72, sequence KELKALEQQFQVAQQQLKNQER"
FT   CDS             140302..141300
FT                   /transl_table=11
FT                   /gene="ntpC"
FT                   /locus_tag="SpyM50124"
FT                   /product="V-type sodium ATP synthase subunit C"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC95"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC95"
FT                   /protein_id="CAM29467.1"
FT                   /translation="MPTFLELNTTISVKEKELLTKEQFDKLLQAPNTTTLARLLHQSVY
FT                   HLTVDDLNDLDRLESILMAELTKTYRWAFAETPQPDIVQLFTLRYTYHNVKVLLKAKAS
FT                   QADLSHLLLPIGDKPLVALEHLIRTMTSDEFPKEVVTEIQSIWAEYQDYQDIRVLEIGT
FT                   DLAYFKALKQIAQRLEDPVFQQAVLIVIDLYNLITVRRAKSQNKPISFMMQLLSDEASR
FT                   PSKTFITLEDDKDLMTWFENVTPDSYMTALKPYSEKLRQGTLQTTELEYLVDECLYHLF
FT                   AKAKYQVDGPYVLARFLLAKSFEVKNLRLLAAALANDLPKERVIERMRPIA"
FT   misc_feature    140320..141288
FT                   /gene="ntpC"
FT                   /locus_tag="SpyM50124"
FT                   /note="HMMPfam hit to PF01992, ATP synthase (C/AC39)
FT                   subunit, score 9.2e-09"
FT                   /inference="protein motif:HMMPfam:PF01992"
FT   CDS             141297..141617
FT                   /transl_table=11
FT                   /locus_tag="SpyM50125"
FT                   /product="V-type sodium ATP synthase subunit F"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC96"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="UniProtKB/TrEMBL:A2RC96"
FT                   /protein_id="CAM29468.1"
FT                   /translation="MTKTLYKVGVIGNRDVILPFQMIGFQTFPVIKPQDAINQLRQLAM
FT                   EDFGIIYITEDIAAAIPEALAHYDNQVLPAVIPLPTHQGAQGIGLSRIQAMVEKAVGQN
FT                   IL"
FT   misc_feature    141318..141584
FT                   /locus_tag="SpyM50125"
FT                   /note="HMMPfam hit to PF01990, ATP synthase (F/14-kDa)
FT                   subunit, score 2.5e-07"
FT                   /inference="protein motif:HMMPfam:PF01990"
FT   CDS             141818..143593
FT                   /transl_table=11
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM50126"
FT                   /product="V-type sodium ATP synthase subunit A"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC97"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29469.1"
FT                   /translation="MNQGKIITVSGPLVVASGMQEANIQDICRVGHLGLVGEIIEMRRD
FT                   QASIQVYEETSGIGPGEPVVTTGCPLSVELGPGLISEMFDGIQRPLDRFQKATDSDFLI
FT                   RGVAIPSLDRKAKWAFIPKLSVGQEVVAGDILGTVQETAVIEHRIMVPYKVSGTLVAIH
FT                   AGDFTVTDTVYEIKQEDGSIYQGSLMQTWPVRQSRPVAQKLIPVEPLVTGQRVIDTFFP
FT                   VTKGGAAAVPGPFGAGKTVVQHQIAKFANVDIVIYVGCGERGNEMTDVLNEFPELIDPN
FT                   TGQSIMERTVLIANTSNMPVAAREASIYTGITIAEYFRDMGYSVAIMADSTSRWAEALR
FT                   EMSGRLQEMPGDEGYPAYLGSRIAEYYERAGRVRTLGSQEREGTITAIGAVSPPGGDIS
FT                   EPVTQNTLRIVKVFWGLDAPLAQRRHFPAINWLTSYSLYQDDVGSYIDRKQQSNWSNKV
FT                   TRAMAILQREASLEEIVRLVGLDSLSEQDRLTMAVARQIREDYLQQNAFDSVDTFTSFP
FT                   KQEAMLTNILTFNEEASKALSLGAYFNEIMEGTAQVRDRIARSKFIPEENLEQIKGFTQ
FT                   KVTKEIHHVLAKGGI"
FT   misc_feature    141833..142021
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM50126"
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 1e-13"
FT                   /inference="protein motif:HMMPfam:PF02874"
FT   misc_feature    142451..143125
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM50126"
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 1.6e-95"
FT                   /inference="protein motif:HMMPfam:PF00006"
FT   misc_feature    142514..142537
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    143096..143125
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00152"
FT   misc_feature    143180..143578
FT                   /gene="ntpA"
FT                   /locus_tag="SpyM50126"
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 9.9e-36"
FT                   /inference="protein motif:HMMPfam:PF00306"
FT   CDS             143594..145009
FT                   /transl_table=11
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM50127"
FT                   /product="V-type sodium ATP synthase subunit B"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC98"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29470.1"
FT                   /translation="MSVLKEYRTVSEVVGPLMIVDQVAGVHYNELVDITLHNGERRKGQ
FT                   VLEVQGDKAMVQLFEGSTGINLAKTKVRFTGHPLELAVSEDMVGRIFDGMGQPIDGGPE
FT                   LIPEKYLDIDGQAINPVARDYPDEFIQTGISAIDHLNTLVRGQKLPVFSGSGLPHNELA
FT                   AQIARQATVLNSDDNFAVVFAAMGITFEEAEFFMNDLRETGAIDRSVLFINLANDPAIE
FT                   RIATPRIALTTAEYLAYEKGMHVLVIMTDMTNYCEALREVSAARREVPGRRGYPGYLYT
FT                   NLSTLYERAGRLIGKKGSVTQIPILTMPEDDITHPIPDLTGYITEGQIILSQELYKNGF
FT                   RPPINVLPSLSRLKDKGSGEGKTRQDHAATMNQLFAAYAQGKQAKELAVVLGESALSET
FT                   DKLYVAFTNRFEEEYINQGFYTNRSIEESLDLGWELLSILPRTELKRIKDDMLDRYLPK
FT                   ADTTMTKVFVAND"
FT   misc_feature    143621..143821
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM50127"
FT                   /note="HMMPfam hit to PF02874, ATP synthase alpha/beta
FT                   family, beta-ba, score 2.8e-13"
FT                   /inference="protein motif:HMMPfam:PF02874"
FT   misc_feature    143987..144646
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM50127"
FT                   /note="HMMPfam hit to PF00006, ATP synthase alpha/beta
FT                   family, nucleot, score 2.2e-97"
FT                   /inference="protein motif:HMMPfam:PF00006"
FT   misc_feature    144617..144646
FT                   /note="PS00152 ATP synthase alpha and beta subunits
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00152"
FT   misc_feature    144695..144973
FT                   /gene="ntpB"
FT                   /locus_tag="SpyM50127"
FT                   /note="HMMPfam hit to PF00306, ATP synthase alpha/beta
FT                   chain, C termin, score 3.4e-21"
FT                   /inference="protein motif:HMMPfam:PF00306"
FT   CDS             145054..145680
FT                   /transl_table=11
FT                   /gene="ntpD"
FT                   /locus_tag="SpyM50128"
FT                   /product="V-type sodium ATP synthase subunit D"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="GOA:A2RC99"
FT                   /db_xref="InterPro:IPR002699"
FT                   /protein_id="CAM29471.1"
FT                   /translation="MARLNVKPTRMELSNLKNRLKTATRGHKLLKDKRDELMRRFVDLI
FT                   RENNELRQTIEKELAANMKEFVLAKASENSLMVEELFAVPVHEVTLWIDIENIMSVNVP
FT                   KFHVQSNTAREQEQGEFAYSYLSSNSEMDNTIQKTKELLEKLLRLAEVEKTCQLMADDI
FT                   EKTRRRVNGLEYAIIPQLEETIHYIELKLEEAERASLVRIMKITS"
FT   misc_feature    145084..145674
FT                   /gene="ntpD"
FT                   /locus_tag="SpyM50128"
FT                   /note="HMMPfam hit to PF01813, ATP synthase subunit D,score
FT                   2.2e-57"
FT                   /inference="protein motif:HMMPfam:PF01813"
FT   CDS             complement(145800..147062)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA0"
FT                   /protein_id="CAM29472.1"
FT                   /translation="MADFNFDIDQIADNAVVKTDKTTDIISDLPTDTNGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPVDLDKKPNFLQKLFKQSRDTLQEFYFDSQNIEQKMDSMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIEHLVGVIAFIEASQKEASQRAAALQKDLKTKDS
FT                   ATPDYQIKADLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIINANNAALQMLAETSKEAIPALEQSAQ
FT                   RPTLSMKSVTSLAESLVAQNNGIIAAIDRGRKERAQLESAIIRSAETINDSVKLRDQNI
FT                   VQALLSEGKETQKTIDKTTHA"
FT   CDS             complement(147075..147953)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50130"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA1"
FT                   /protein_id="CAM29473.1"
FT                   /translation="MIRKYDRTSTKKKSLNWIWLIIAFFMISSFIGGSSFTESLLDILP
FT                   AIAIGGTGYAIFRVRSHQKRLAKAKIAKQLEDLKAKIQLADRKVRLLDTYLADHDDFQY
FT                   NVLAQQLLPQLSDIKAKAITLKDQLDPKIYRRITKKANDVESDITLQLETLQIATTLNP
FT                   QPLKTPSPNLINKAPELKPYYDNIQTDHQAILAKIQGADNQEELLALHEANMRRFEDIL
FT                   TGYLKIKEEPKNYYNAAARLEQAKQAIQQFDEDLDETLRRLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   misc_feature    complement(order(147783..147836,147849..147917))
FT                   /locus_tag="SpyM50130"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50130 by TMHMM2.0 at aa 13-35 and 40-57"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(147810..147953)
FT                   /locus_tag="SpyM50130"
FT                   /note="Signal peptide predicted for SpyM50130 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.981) with cleavage
FT                   site probability 0.641 between residues 48 and 49"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             148391..149683
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SpyM50131"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="GOA:A2RCA2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29474.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPQKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEDAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDRKRIDYYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   misc_feature    148397..149656
FT                   /gene="purA"
FT                   /locus_tag="SpyM50131"
FT                   /note="HMMPfam hit to PF00709, Adenylosuccinate synthetase,
FT                   score 6e-277"
FT                   /inference="protein motif:HMMPfam:PF00709"
FT   misc_feature    148418..148441
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site"
FT                   /inference="protein motif:Prosite:PS01266"
FT   misc_feature    148781..148816
FT                   /note="PS00513 Adenylosuccinate synthetase active site"
FT                   /inference="protein motif:Prosite:PS00513"
FT   CDS             150010..151053
FT                   /transl_table=11
FT                   /locus_tag="SpyM50132"
FT                   /product="basic lipoprotein"
FT                   /note="Similar to SpyM50856, 65.043% identity (65.607%
FT                   ungapped) in 349 aa overlap"
FT                   /db_xref="GOA:A2RCA3"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA3"
FT                   /protein_id="CAM29475.1"
FT                   /translation="MNKKVMSLGLVSTALFTLGGCTNNSAKQTTDNSLKIAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLEKGKGYDYFQSANESEFTTNLESAVTNGYNLVFGIGF
FT                   PLHDAVEKVAANNPDNHFAIVDDVIKGQKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGDVVKRFEKGFEAGVKSVDDTIKVRVAYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YHAAGGTGAGVFSEAKSINEKCKEEDKVWVIGVDRDQSEDGKYTTKDGKSANFVLTSSI
FT                   KEVGKALVKVAVKTSEGQFPGGQITTFGLKEGGVSLTTDALTQDTKKAIEAAKKAIIEG
FT                   TITVPEN"
FT   sig_peptide     150010..150090
FT                   /locus_tag="SpyM50132"
FT                   /note="Signal peptide predicted for SpyM50132 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.459 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    150037..151050
FT                   /locus_tag="SpyM50132"
FT                   /note="HMMPfam hit to PF02608, Basic membrane protein,score
FT                   2.1e-84"
FT                   /inference="protein motif:HMMPfam:PF02608"
FT   misc_feature    150040..150072
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    150613..150636
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    150685..150705
FT                   /note="PS00227 Tubulin subunits alpha, beta, and gamma
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00227"
FT   CDS             151227..151766
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="SpyM50133"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="GOA:A2RCA4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA4"
FT                   /protein_id="CAM29476.1"
FT                   /translation="MLDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIP
FT                   TQTVNVEKNGQTKEIEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTP
FT                   LLEEEIRAILLSMGQTIDVFDTNIKEGDVVQIIDGAFMGQEGRVVEIENNKVKLMLNMF
FT                   GSETVAEVELYQIAEL"
FT   misc_feature    151242..151373
FT                   /gene="nusG"
FT                   /locus_tag="SpyM50133"
FT                   /note="HMMPfam hit to PF02357, Transcription termination
FT                   factor nusG, score 1.3e-17"
FT                   /inference="protein motif:HMMPfam:PF02357"
FT   misc_feature    151608..151709
FT                   /gene="nusG"
FT                   /locus_tag="SpyM50133"
FT                   /note="HMMPfam hit to PF00467, KOW motif, score 1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00467"
FT   CDS             152138..153493
FT                   /transl_table=11
FT                   /gene="nga"
FT                   /locus_tag="SpyM50134"
FT                   /product="nicotine adenine dinucleotide glycohydrolase
FT                   precursor"
FT                   /EC_number="3.2.2.5"
FT                   /db_xref="GOA:A2RCA5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010900"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA5"
FT                   /protein_id="CAM29477.1"
FT                   /translation="MRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKK
FT                   SGVKYETTKVMEANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFASPMRI
FT                   GRILIVNGDTSSKENYYKKNRIAKADVKYYNGNKLVLFHKIELGDTYTKKPHHIEIDKK
FT                   LDVDRIDIEVTEVHQGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADEFIE
FT                   TADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDLM
FT                   LAFDDAKNKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKDVDSGKYSDGV
FT                   YQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISV
FT                   KDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK"
FT   misc_feature    152138..153475
FT                   /gene="nga"
FT                   /locus_tag="SpyM50134"
FT                   /note="HMMPfam hit to PF07461, Nicotine adenine
FT                   dinucleotide glycohydrola, score 0"
FT                   /inference="protein motif:HMMPfam:PF07461"
FT   sig_peptide     152138..152248
FT                   /gene="nga"
FT                   /locus_tag="SpyM50134"
FT                   /note="Signal peptide predicted for SpyM50134 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.863 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    152186..152254
FT                   /gene="nga"
FT                   /locus_tag="SpyM50134"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50134 by TMHMM2.0 at aa 20-42"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             153627..153983
FT                   /transl_table=11
FT                   /locus_tag="SpyM50135"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA6"
FT                   /protein_id="CAM29478.1"
FT                   /translation="MGDISDPEVILEYGVYPAFIKGYTQLKANIEEALLEMSNSGQALD
FT                   IYQAVQTLNAENMLLNYYESLPFYLNRQSILANMTKALKDAHIREAMAHYKLGEFAHYQ
FT                   DTMLDMVERTIKTF"
FT   CDS             153998..155722
FT                   /transl_table=11
FT                   /gene="slo"
FT                   /locus_tag="SpyM50136"
FT                   /product="streptolysin O precursor (thiol-activated
FT                   cytolysin)"
FT                   /db_xref="GOA:A2RCA7"
FT                   /db_xref="InterPro:IPR001869"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA7"
FT                   /protein_id="CAM29479.1"
FT                   /translation="MKDMSNKKTFKKYSRVAGLLTAALIIGNLVTANAESNKQNTASTE
FT                   TTTTNEQPKPESSELTTEKAGQKTDDMLNSNDMIKLAPKEMPLESAEKEEKKSEDKKKS
FT                   EEDHTEEINDKIYSLNYNELEVLAKNGETIENFVPKEGVKKADKFIVIERKKKNINTTP
FT                   VDISIIDSVTDRTYPAALQLANKGFTENKPDAVVTKRNPQKIHIDLPGMGDKATVEVND
FT                   PTYANVSTAIDNLVNQWHDNYSGGNTLPARTQYTESMVYSKSQIEAALNVNSKILDGTL
FT                   GIDFKSISKGEKKVMIAAYKQIFYTVSANLPNNPADVFDKSVTFKDLQRKGVSNEAPPL
FT                   FVSNVAYGRTVFVKLETSSKSNDVEAAFSAALKGTDVKTNGKYSDILENSSFTAVVLGG
FT                   DAAEHNKVVTKDFDVIRNVIKDNATFSRKNPAYPISYTSVFLKNNKIAGVNNRTEYVET
FT                   TSTEYTSGKINLSHQGAYVAQYEILWDEINYDDKGKEVITKRRWDNNWYSKTSPFSTVI
FT                   PLGANSRNIRIMARECTGLAWEWWRKVIDERDVKLSKEINVNISGSTLSPYGSITYK"
FT   sig_peptide     153998..154099
FT                   /gene="slo"
FT                   /locus_tag="SpyM50136"
FT                   /note="Signal peptide predicted for SpyM50136 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.965 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    154034..154093
FT                   /gene="slo"
FT                   /locus_tag="SpyM50136"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50136 by TMHMM2.0 at aa 13-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    154319..155716
FT                   /gene="slo"
FT                   /locus_tag="SpyM50136"
FT                   /note="HMMPfam hit to PF01289, Thiol-activated
FT                   cytolysin,score 0"
FT                   /inference="protein motif:HMMPfam:PF01289"
FT   misc_feature    155588..155623
FT                   /note="PS00481 Thiol-activated cytolysins signature"
FT                   /inference="protein motif:Prosite:PS00481"
FT   CDS             complement(155861..156103)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50137"
FT                   /product="putative exported protein"
FT                   /note="Similar to SpyM50138, 58.730% identity (72.549%
FT                   ungapped) in 63 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA8"
FT                   /protein_id="CAM29480.1"
FT                   /translation="MKKKLSLFMIATAAVVGLSLATPKNQTVSANEAVATQACADGTNC
FT                   CGYNFYGYCRPISWLFYKTKHLLMGDQPTTDIVTK"
FT   sig_peptide     complement(155984..156103)
FT                   /locus_tag="SpyM50137"
FT                   /note="Signal peptide predicted for SpyM50137 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.476 between residues 42 and 43"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(156038..156091)
FT                   /locus_tag="SpyM50137"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50137 by TMHMM2.0 at aa 7-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(156504..156671)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50138"
FT                   /product="putative exported protein"
FT                   /note="similar to SpyM50137, 58.730% identity (72.549%
FT                   ungapped) in 63 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCA9"
FT                   /protein_id="CAM29481.1"
FT                   /translation="MKKKLSLFMIATAAVAGLSLATLGNHQTVSANDASYSNGFYGQNA
FT                   PDNWLLYTVW"
FT   sig_peptide     complement(156579..156671)
FT                   /locus_tag="SpyM50138"
FT                   /note="Signal peptide predicted for SpyM50138 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.996 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(156585..156653)
FT                   /locus_tag="SpyM50138"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50138 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(156856..157122)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50139"
FT                   /product="putative exported protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB0"
FT                   /protein_id="CAM29482.1"
FT                   /translation="MKNKLFLVTLATVTVLGPSLANPHHGTVHTTEYCTYVTGKPEVGG
FT                   CYERKDGMPIEENIIKKSNDFSLLNWFWEIITNWWSKITGYFS"
FT   sig_peptide     complement(157033..157122)
FT                   /locus_tag="SpyM50139"
FT                   /note="Signal peptide predicted for SpyM50139 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.632 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             157606..158745
FT                   /transl_table=11
FT                   /locus_tag="SpyM50140"
FT                   /product="putative cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="GOA:A2RCB1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB1"
FT                   /protein_id="CAM29483.1"
FT                   /translation="MRENTTLLHGYTVIDEFTGAASVPIYQTSTFHNSELYCPSQKHLY
FT                   TRFSNPTTEALEDGLACLEKATYAVAYASGMAAISTVLMLLKAGDHVIFPLEVYGGTCQ
FT                   FATAILPNYQIETSFVDMADLATVKASIRPNTRMIYLETPSNPLLKICDISELVQLAKA
FT                   YGVLTVADNTFMTSLYQEPLAMGVDIVVESVTKFINGHSDVVAGLAATNNEAIYNQLKL
FT                   FQKNFGAIVGVEDAWLILRGMKTMGIRMEQAVKNAQQLANYLAKHPKVLKVHYPGLDSH
FT                   PNHDTHLQQAKNGGAVLSFELASKEELMTFTHRIQLPILAVSLGGVESILSHPATMSHA
FT                   CLSSQARLEQGVVDGLLRLSCGVENIEDLLADFEQALAF"
FT   misc_feature    157615..158739
FT                   /locus_tag="SpyM50140"
FT                   /note="HMMPfam hit to PF01053, Cys/Met metabolism
FT                   PLP-dependent enzy, score 3.6e-178"
FT                   /inference="protein motif:HMMPfam:PF01053"
FT   CDS             158957..161458
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="SpyM50141"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="GOA:A2RCB2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /protein_id="CAM29484.1"
FT                   /translation="MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSG
FT                   AGLHVGHPEGYTATDILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAEN
FT                   IANFKRQINALGFSYDWDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELG
FT                   TAIANEEVLPDGTSERGGYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRN
FT                   WIGKSTGANVTFKVKDTDKDFTVFTTRPDTLFGATYAVLAPEHALVDAITTADQAEAVA
FT                   DYKRQASLKSDLARTDLAKEKTGVWTGSYAINPVNGNEMPVWIADYVLASYGTGAIMAV
FT                   PAHDERDWEFAKQFNLDIIPVLEGGNVEEAAFTEDGLHINSGFLDGLDKASAIAKMVEW
FT                   LEAEGVGNEKVTYRLRDWLFSRQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIR
FT                   PSGTGESPLANVTDWLEVTREDGVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEE
FT                   LLKQWLPVDIYVGGAEHAVLHLLYARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYR
FT                   DSRGALVATDKVEKRDGSFFHLETGEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRV
FT                   YEMFMGPLDASIAWSEEGLEGSRKFLDRVYRLITTKEITEENSGALDKVYNETVKAVTE
FT                   QVDQMKFNTAIAQLMVFVNAANKEDKLFSDYAKGFVQLIAPFAPHLGEELWQALTASGE
FT                   SISYVPWPSYDESKLVENDVEIVVQIKGKVKAKLVVAKDLSREELQEVALANEKVQAEI
FT                   AGKDIIKVIAVPNKLVNIVIK"
FT   misc_feature    158990..160906
FT                   /gene="leuS"
FT                   /locus_tag="SpyM50141"
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 6.6e-213"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    159083..159115
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             161765..163198
FT                   /transl_table=11
FT                   /locus_tag="SpyM50142"
FT                   /product="putative sugar-specific permease, SgaT/UlaA
FT                   family"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCB3"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB3"
FT                   /protein_id="CAM29485.1"
FT                   /translation="MEMLLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPIYEVFAGF
FT                   VKATVGYLILNVGAGGLVTTFRPILVALAKKFELKAAVIDPYFGLAAANTKLEEMGFIS
FT                   VATTALLIGFGVNILLVALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQFQNAFGA
FT                   WAVGIICGLYWAISSNMTVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLD
FT                   NLKLPTFLNIFHDTVVASATLMLVFFGVILAVLGPDIMSDVDLIGPGAFNPAKQAFFMY
FT                   ILQTSLTFSVYLFILMQGVRMFVSELTNAFQGISSKLLPGSFPAVDVAASYGFGSSNAV
FT                   LSGFAFGLIGQLITIALLVIFKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSF
FT                   ISGILQVALGAVAVGLLGLTGGYHGNIDLVLPWLPFGYLFKFLGIAGYVLVCIFLLAIP
FT                   QLQFAKAKDKEAYYRGEAQ"
FT   misc_feature    161777..163057
FT                   /locus_tag="SpyM50142"
FT                   /note="HMMPfam hit to PF04215, Putative sugar-specific
FT                   permease, SgaT/UlaA, score 1.9e-263"
FT                   /inference="protein motif:HMMPfam:PF04215"
FT   misc_feature    order(161807..161866,161885..161953,162065..162133,
FT                   162158..162226,162242..162295,162473..162541,
FT                   162584..162652,162779..162847,162857..162919,
FT                   162956..163024,163067..163135)
FT                   /locus_tag="SpyM50142"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50142 by TMHMM2.0 at aa 15-34,
FT                   41-63,101-123,132-154,160-177, 237-259, 274-296,
FT                   339-361,365-385,398-420 and 435-457"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             163269..163547
FT                   /transl_table=11
FT                   /locus_tag="SpyM50143"
FT                   /product="sugar phosphotransferase system
FT                   (PTS),lactose/cellobiose-specific family, IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCB4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB4"
FT                   /protein_id="CAM29486.1"
FT                   /translation="MVKVLTACGNGMGSSMVIKMKVENALRQLGVTDIQSASCSVGEAK
FT                   GLASGYDIVVASNHLIHELDGRTKGHLVGLDNLMDDNEIKTKLQEVL"
FT   misc_feature    163275..163544
FT                   /locus_tag="SpyM50143"
FT                   /note="HMMPfam hit to PF02302, PTS
FT                   system,Lactose/Cellobiose specific IIB, score 1.4e-30"
FT                   /inference="protein motif:HMMPfam:PF02302"
FT   CDS             163670..164155
FT                   /transl_table=11
FT                   /locus_tag="SpyM50144"
FT                   /product="sugar phosphotransferase system (PTS), IIA
FT                   component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCB5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB5"
FT                   /protein_id="CAM29487.1"
FT                   /translation="MNLKQAFIDNNSIRLGLSADTWQEAVRLAVQPLIDSKAVTSAYYD
FT                   AIIASTEKYGPYYVLMPGMAMPHAEAGLGVNRNAFALITLTKPVTFSDGKEVSVLLTLA
FT                   ATDPSIHTTVAIPQIVALFELDNAIERLVACQSPKEVLEMVEESKDSPYLEGMDLNA"
FT   misc_feature    163685..164113
FT                   /locus_tag="SpyM50144"
FT                   /note="HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent
FT                   sugar phosph, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   CDS             164246..164908
FT                   /transl_table=11
FT                   /locus_tag="SpyM50145"
FT                   /product="putative hexulose-6-phosphate synthase"
FT                   /db_xref="GOA:A2RCB6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB6"
FT                   /protein_id="CAM29488.1"
FT                   /translation="MTHIPNLQVALDHSDLQGAVKAAVAVGHEVDVIEAGTVCLLQVGS
FT                   ELVEVLRSLFPEKIIVADTKCADAGGTVAKNNAKRGADWMTCICCATIPTMEAALKAMK
FT                   EERGDRGEIQIELYGDWTYEQAQLWLDAGISQAIYHQSRDALLAGETWGEKDLNKVKTL
FT                   IDMGFRVSVTGGLDVDTLKLFEGVDVFTFIAGRGITEAEDPAAAARAFKDEIKRIWG"
FT   misc_feature    164258..164878
FT                   /locus_tag="SpyM50145"
FT                   /note="HMMPfam hit to PF00215, Orotidine 5'-phosphate
FT                   decarboxylase / HUMP, score 1.9e-55"
FT                   /inference="protein motif:HMMPfam:PF00215"
FT   CDS             164913..165776
FT                   /transl_table=11
FT                   /locus_tag="SpyM50146"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /db_xref="GOA:A2RCB7"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB7"
FT                   /protein_id="CAM29489.1"
FT                   /translation="MARPIGIYEKATPKQFTWRERLQFAKDLGFDFVEMSVDESDARLA
FT                   RLEWTKEERLDLVKAIYETGIRIPTICFSGHRRYPLGSNDPATEAKSLKLMKQCIELAQ
FT                   DLGVRTIQLAGYDVYYEEKSPETRARFIKNLRQSCDWAEEAQVMLSIEIMDDPFINSIE
FT                   KYLAVEKEIDSPYLFVYPDAGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTETSKGQ
FT                   FRDVPFGQGCVDWQELFAVLKKTNYNGPFLIEMWSENCDTVEETKAAIKEAQDFLYPLI
FT                   EKAGLA"
FT   misc_feature    164976..165611
FT                   /locus_tag="SpyM50146"
FT                   /note="HMMPfam hit to PF01261, Xylose isomerase-like TIM
FT                   barrel, score 5.5e-46"
FT                   /inference="protein motif:HMMPfam:PF01261"
FT   CDS             165778..166482
FT                   /transl_table=11
FT                   /locus_tag="SpyM50147"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="GOA:A2RCB8"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB8"
FT                   /protein_id="CAM29490.1"
FT                   /translation="MAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCRELGRIVIK
FT                   PSGVDYDLLTPENMVVTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIVHTHSTEAV
FT                   GWAQAGRDIPFYGTTHADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEFSKRSLDPM
FT                   AVPGIVVRNHGPFTWGKTPEQAVYHSVVLEEVAKMNRLTEQINPRVEPAPRYIMDKHYL
FT                   RKHGPNAYYGQK"
FT   misc_feature    165805..166437
FT                   /locus_tag="SpyM50147"
FT                   /note="HMMPfam hit to PF00596, Class II Aldolase and
FT                   Adducin N-terminal, score 1.9e-99"
FT                   /inference="protein motif:HMMPfam:PF00596"
FT   misc_feature    166297..166320
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             166540..166686
FT                   /transl_table=11
FT                   /locus_tag="SpyM50147A"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /note="Doubtful CDS"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCB9"
FT                   /protein_id="CAM29491.1"
FT                   /translation="MLIIVWASPFDLSFSMNCLNANEHKLDESYVVEFLETRYKVLVLD
FT                   QLR"
FT   CDS             166807..168453
FT                   /transl_table=11
FT                   /locus_tag="SpyM50148"
FT                   /product="putative transcriptional antiterminator"
FT                   /note="Possible alternate translational start site after
FT                   codon 1"
FT                   /db_xref="GOA:A2RCC0"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC0"
FT                   /protein_id="CAM29492.1"
FT                   /translation="MMILDKKSYDLLSYLLKLETPETVMAISHALNQSRRKVYYQLDKI
FT                   NQALPKGVDQIISYPRLGILLTADQKAACRLLLEEVTDYNYVMKSDERRRLSSIYIAVS
FT                   TERVTIDKLMQINDVSRNTILNDLTELREELEDKQYKIQLHATKARGYYFGCHPMALIQ
FT                   YLYKLLVDVYQGGNTSFIDIFKRKLSEIQGLSVYFSKDILTYFHEYLFLSQASLGKTIN
FT                   TQDSQFMLQILPFMLLSYRNMRLDSETKSALKQEFHLIWKRKEYHIAQDLARELYHNFK
FT                   LHLDDIEVSMVAMLMLSFRKDQDHHVESQDYDDMRATISHFIDQLESRYQLHFTHKQDL
FT                   LKQLTTHCKALVYRKAYGIFLVNPLTDHIKEKYEELFAMTQSCATILEQDWTISLTDDD
FT                   IAYLTIHLGGELRHNNTEQEKTKLVIVSDDGIGIQKLLFKQCQRYLANGQIEAVFTTEQ
FT                   YQSVYDLLAVDMIVATTDTLKTKIPMLIVNPILSDDDIIKLIRFSKQGRLSEHSRFSTE
FT                   LTKAIEAVVKDESDRYALVSKIEKLIHRELL"
FT   misc_feature    167413..167703
FT                   /locus_tag="SpyM50148"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 2.3e-14"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   misc_feature    167764..168036
FT                   /locus_tag="SpyM50148"
FT                   /note="HMMPfam hit to PF00874, PRD domain, score 1.3e-15"
FT                   /inference="protein motif:HMMPfam:PF00874"
FT   CDS             168706..169797
FT                   /transl_table=11
FT                   /locus_tag="SpyM50149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC1"
FT                   /protein_id="CAM29493.1"
FT                   /translation="MTKVQDITRESWILNTFPEWGTWLNEEIEQEVVPADNFAMWWLGN
FT                   CGIWIKTPGGANVVMDLWSNRGKATKQVKDMVRGHQMANMAGARKLQPNLRAQPMVIDP
FT                   FMINELDYYLVSHYHSDHIDINTAAAIINNPKLNHVKFVGPYECGEVWKNWGVPKDRIM
FT                   ILKPGDSFEFKDIKITAVESFDRTCLVTLPIQGADAQDGDLAGLAITDDDMARKAVNYI
FT                   FETPGGTIYHGADSHFSNYFAKHGRDYDIDVVLNNYGENPIGIQDKMTSVDLLRMAENL
FT                   RAKVVIPVHYDIWSNFMASTDEILELWKMRKERLQYDFHPFIWEVGGKYTYPQDQNRIE
FT                   YHHPRGFDDCFLEDSNIQFKALL"
FT   CDS             170285..171481
FT                   /transl_table=11
FT                   /locus_tag="SpyM50150"
FT                   /product="putative glycine betaine transport ATP-binding
FT                   protein"
FT                   /db_xref="GOA:A2RCC2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC2"
FT                   /protein_id="CAM29494.1"
FT                   /translation="METILEVKHLSKIFGKKQKAALEMVKTGKNKSEIFKKTGATVGVY
FT                   DASFEVKKGEIFVIMGLSGSGKSTLVRMLNRLIEPSAGSILLEGKDISTMSADQLREVR
FT                   RHDINMVFQSFALFPHKTILENTEFGLELRGVPKEERQRLAEKALDNSGLLDFKDQYPN
FT                   QLSGGMQQRVGLARALANSPKILLMDEAFSALDPLIRREMQDELLDLQDSMKQTIIFIS
FT                   HDLNEALRIGDRIALMKDGQIMQIGTGEEILTNPANDFVREFVEDVDRSKVLTAQNIMI
FT                   KPLTTTVELDGPQVALNRMHNEEVSMLMATNRRRQLVGSLTADAAIEARKKGLPLSEVI
FT                   DRDVRTVSKDTIITDILPLIYDSSAPIAVTDDNNRLLGVIIRGRVIEALANISDEDLN"
FT   misc_feature    170444..171007
FT                   /locus_tag="SpyM50150"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.2e-68"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    170465..170488
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    170777..170821
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    171116..171277
FT                   /locus_tag="SpyM50150"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 0.057"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   misc_feature    171296..171454
FT                   /locus_tag="SpyM50150"
FT                   /note="HMMPfam hit to PF00571, CBS domain, score 0.0001"
FT                   /inference="protein motif:HMMPfam:PF00571"
FT   CDS             171497..173224
FT                   /transl_table=11
FT                   /locus_tag="SpyM50151"
FT                   /product="putative glycine-betaine binding permease
FT                   protein"
FT                   /db_xref="GOA:A2RCC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC3"
FT                   /protein_id="CAM29495.1"
FT                   /translation="METILQTKLPVAQLVEQLTEWLTKTFSGLFDIMQVVGSFLMDWMT
FT                   KTLLFIHPLLFIVLVTAGMFFLAKKKWPLPTFTLLGLLFIYNQGLWKQLMNTFTLVLVA
FT                   SLISVLIGIPLGIWMAKNATVRQIVNPILDFMQTMPAFVYLIPAVAFFGIGMVPGVFAS
FT                   VIFALPPTVRFTNLAIRDIPTELIEASDAFGSTGKQKLFKVELPLAKNTIMAGVNQTMM
FT                   LALSMVVTGSMIGAPGLGREVLSALQHADIGSGFVSGLALVILAIVLDRMTQLFNSKPQ
FT                   EKAKAGKTNKWIGLAALAIFLIAALGRGIMTMASGMADKGETVNIAYVQWDSEVASTHV
FT                   IAEVLKNEGYHVTLTPLDNAVMWQTVANGNADFSTSAWLPVTHGQQYQKYKSKLDDLGP
FT                   NLKGTKLGLAVPKYMTDVNSIEDLSKQADQKITGIEPGAGIMAAAKKTLKEYHNLSSWE
FT                   LVAASTGAMTTSLDQAIKKKDPIVVTAWSPHWMFAKYDLKYLKDPKETFGSTENINTIA
FT                   RKGLKKDLPNVYKIIDKFHWTQKDMEAVMLDINKGMSPEAAAKKWVEANKSKVSSWTK"
FT   misc_feature    order(171638..171697,171710..171769,171788..171856,
FT                   171926..171994,172139..172207,172250..172303,
FT                   172364..172432)
FT                   /locus_tag="SpyM50151"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50151 by TMHMM2.0 at aa 48-67,
FT                   72-91,98-120,144-166,215-237, 252-269 and 290-312"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    171776..172342
FT                   /locus_tag="SpyM50151"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 2.9e-32"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    172031..172117
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    172463..173221
FT                   /locus_tag="SpyM50151"
FT                   /note="HMMPfam hit to PF04069, Substrate binding domain of
FT                   ABC-type gly, score 5.1e-103"
FT                   /inference="protein motif:HMMPfam:PF04069"
FT   CDS             173355..175997
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /gene_synonym="pol"
FT                   /locus_tag="SpyM50152"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GOA:A2RCC4"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC4"
FT                   /protein_id="CAM29496.1"
FT                   /translation="MENKNKLLLIDGSSVAFRAFFALYNQIDRFKNHSGLHTNAIYGFH
FT                   LMLDHMMKRVRPTHVLVAFDAGKTTFRTEMYADYKAGRAKTPDEFREQFPYIREMLTAL
FT                   GIAYYELEHYEADDIIGTLDKMAERTEVPFDVTIVSGDKDLIQLTDENTVVEISKKGVA
FT                   EFEEFTPAYLMEKMGLTPNQFIDLKALMGDKSDNIPGVTKIGEKTGLKLLHEFGSLEGI
FT                   YEHIDGFKASKMKENLINDRDQAFLSKTLATINTASPITIGLDDIVYNGPDVASLSQFY
FT                   DEMDFVQLKKGLASQMPQEPVAAISYQEVTNVSADLFSAEDIFYFETLRDNYHREAIIG
FT                   FAWGHGEQIYASTDLSLLATDSFKQVFQKPIATYDFKRSKVLLSHLGIELVAPSYDARL
FT                   ANYLLSTVEDNELSTIARIFTDISLEEDDTVYGKGAKRAVPDKDVLLEHLARKVKVLLD
FT                   SKSQMLDKLTAHEQLDLYQNIELPLANVLAKMEIEGIKVNRATLQDMAEQNKVIIEALT
FT                   QEIYDMAGQEFNINSPKQLGSILFEKMQLPLEMTKKTKTGYSTAVDVLERLAPIAPIVA
FT                   KILDYRQITKLQSTYVIGLQDYILADGKIHTRYVQDLTQTGRLSSVDPNLQNIPIRLEQ
FT                   GRLIRKAFTPSHEDAVLLSSDYSQIELRVLAHISGDEHLIAAFNEGADIHTSTAMRVFG
FT                   IDKAADVTANDRRNAKAVNFGIVYGISDFGLSNNLGITRKQAKSYIDTYFERYPGIKAY
FT                   MENVVREAKDKGYVETLFKRRRELPDINSRNFNVRSFAERTAINSPIQGSAADILKIAM
FT                   INLDKALQAGGFRAKMLLQVHDEIVLEVPNDELTAIKKLVKDTMEAAVDLAVPLCVDES
FT                   TGQSWYEAK"
FT   misc_feature    173367..173885
FT                   /gene="polA"
FT                   /gene_synonym="pol"
FT                   /locus_tag="SpyM50152"
FT                   /note="HMMPfam hit to PF02739, 5'-3' exonuclease,N-terminal
FT                   resolvase-, score 2.7e-98"
FT                   /inference="protein motif:HMMPfam:PF02739"
FT   misc_feature    173889..174191
FT                   /gene="polA"
FT                   /gene_synonym="pol"
FT                   /locus_tag="SpyM50152"
FT                   /note="HMMPfam hit to PF01367, 5'-3' exonuclease,C-terminal
FT                   SAM fold, score 1.1e-49"
FT                   /inference="protein motif:HMMPfam:PF01367"
FT   misc_feature    174843..175991
FT                   /gene="polA"
FT                   /gene_synonym="pol"
FT                   /locus_tag="SpyM50152"
FT                   /note="HMMPfam hit to PF00476, DNA polymerase family
FT                   A,score 3e-215"
FT                   /inference="protein motif:HMMPfam:PF00476"
FT   misc_feature    175470..175529
FT                   /note="PS00447 DNA polymerase family A signature"
FT                   /inference="protein motif:Prosite:PS00447"
FT   CDS             176175..176630
FT                   /transl_table=11
FT                   /locus_tag="SpyM50153"
FT                   /product="putative CoA binding protein"
FT                   /db_xref="GOA:A2RCC5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC5"
FT                   /protein_id="CAM29497.1"
FT                   /translation="MIYSFQNPSEDVLKAYLESAKTIAIVGLSDRKDTAAYGVAKFMQA
FT                   MDYRIIPVNPKLAGQLILGEKVYASIKAIPFEVDIVDVFRRSEFLPEVARDFLAGQAKV
FT                   FWAQLGLENQEAQTILRSAGKEAIVMNRCLKIDYLQLVAKPECITNH"
FT   misc_feature    176223..176552
FT                   /locus_tag="SpyM50153"
FT                   /note="HMMPfam hit to PF02629, CoA binding domain, score
FT                   6e-18"
FT                   /inference="protein motif:HMMPfam:PF02629"
FT   CDS             176682..177149
FT                   /transl_table=11
FT                   /locus_tag="SpyM50154"
FT                   /product="ferric uptake regulator family protein"
FT                   /db_xref="GOA:A2RCC6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC6"
FT                   /protein_id="CAM29498.1"
FT                   /translation="MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHP
FT                   SADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVC
FT                   EICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQAKDQPDF"
FT   misc_feature    176745..177104
FT                   /locus_tag="SpyM50154"
FT                   /note="HMMPfam hit to PF01475, Ferric uptake regulator
FT                   family, score 1.6e-52"
FT                   /inference="protein motif:HMMPfam:PF01475"
FT   CDS             complement(177252..178115)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50155"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC7"
FT                   /protein_id="CAM29499.1"
FT                   /translation="MSIKAIKGQARDTLKNLSGKYLLFLIPTLLFMFHFGIEIHQGYVL
FT                   SSGIEVSLAASYFPLLLGLILSLFILSASFTMIDVVRHFRQKVSFAESTTAFSKEFFGN
FT                   LLVLAITKWLFFLIWSLIWFFGLFIFLSGLSAFLVNAKSGSSTVISLIFLLFGAVLSLI
FT                   GFSIYINRYYAYSLSEYLLYDEVKEGTYLGAIAVIETSVAMMKGYKWKLFFLQLSFTGW
FT                   FLLNIVTFGLLNIYLLPYFTTANVIFYDQLKKRFKDKDDPIEGEHLSLHQLNKKPTPMM
FT                   YDDQKD"
FT   misc_feature    complement(177348..178115)
FT                   /locus_tag="SpyM50155"
FT                   /note="HMMPfam hit to PF06161, Protein of unknown function
FT                   (DUF975), score 1.2e-116"
FT                   /inference="protein motif:HMMPfam:PF06161"
FT   misc_feature    complement(order(177369..177437,177495..177548,
FT                   177609..177677,177705..177773,177891..177959,
FT                   177987..178055))
FT                   /locus_tag="SpyM50155"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50155 by TMHMM2.0 at aa 21-43,
FT                   53-75,115-137,147-169,190-207 and 227-249"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             178152..178337
FT                   /transl_table=11
FT                   /locus_tag="SpyM50156"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCC8"
FT                   /protein_id="CAM29500.1"
FT                   /translation="MRQLTIILTILFWESMTNYGFFDKMIGARTTCHLEALHYDGNSGR
FT                   SKKLKTVYLDSKEEST"
FT   CDS             178334..179476
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="SpyM50157"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="GOA:A2RCC9"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /protein_id="CAM29501.1"
FT                   /translation="MTDYPIKYRLIKTEKHTGARLGEIITPHGTFPTPMFMPVGTQATV
FT                   KTQSPEELKAIGSGIILSNTYHLWLRPGDELIARSGGLHKFMNWDQPILTDSGGFQVYS
FT                   LADSRNITEEGVTFKNHLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVK
FT                   KSIERTSRWAERGLKAHRRPHDQGLFGIVQGAGFEDLRRQSAADLVAMDFPGYSIGGLA
FT                   VGESHEEMNAVLDFTTPLLPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNG
FT                   TCMTSEGRLVIKNAKFAEDFTPLDHDCDCYTCQNYSRAYIRHLLKADETFGIRLTSYHN
FT                   LYFLVNLMKKVRQAIMDDNLLEFRQDFLERYGYNKSNRNF"
FT   misc_feature    178727..179440
FT                   /gene="tgt"
FT                   /locus_tag="SpyM50157"
FT                   /note="HMMPfam hit to PF01702, Queuine
FT                   tRNA-ribosyltransferase, score 5.8e-147"
FT                   /inference="protein motif:HMMPfam:PF01702"
FT   CDS             179694..180005
FT                   /transl_table=11
FT                   /locus_tag="SpyM50158"
FT                   /product="CHY zinc finger protein"
FT                   /db_xref="GOA:A2RCD0"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD0"
FT                   /protein_id="CAM29502.1"
FT                   /translation="MTDCFGIDLDQEYRCLHYHTPLDIVGLKCAFCQTYYACYHCHDQL
FT                   TDHAFVPTGHQETSPVICGHCRKLLSLAEYGCGCCPYCQSPFNPACHRHKDIYFLKES"
FT   misc_feature    179736..179954
FT                   /locus_tag="SpyM50158"
FT                   /note="HMMPfam hit to PF05495, CHY zinc finger, score
FT                   2.3e-33"
FT                   /inference="protein motif:HMMPfam:PF05495"
FT   misc_feature    179805..179822
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS             180009..180548
FT                   /transl_table=11
FT                   /locus_tag="SpyM50159"
FT                   /product="BioY family protein"
FT                   /db_xref="GOA:A2RCD1"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD1"
FT                   /protein_id="CAM29503.1"
FT                   /translation="MFTTKELVKVAIMTTLIIILGFIPAIPLGFIPVPIVLQNLGVMLA
FT                   GLMLGGKKGTLSVFLFLVIGLFLPVFSGSRTTIPVLMGPSAGYVIAYLLVPIVFSLLYR
FT                   NWFSKSTPLAFLALLISGVVLVDVLGAIWLAAYTGMSLVTSLLSNLVFIPGDTIKAIIA
FT                   TIIAVKYKDSFLNTKQ"
FT   sig_peptide     180009..180161
FT                   /locus_tag="SpyM50159"
FT                   /note="Signal peptide predicted for SpyM50159 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.880) with cleavage
FT                   site probability 0.238 between residues 51 and 52"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(180027..180086,180096..180155,180174..180242,
FT                   180270..180329,180348..180416,180444..180512)
FT                   /locus_tag="SpyM50159"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50159 by TMHMM2.0 at aa 7-26,
FT                   30-49,56-78,88-107,114-136 and 146-168"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    180084..180530
FT                   /locus_tag="SpyM50159"
FT                   /note="HMMPfam hit to PF02632, BioY family, score 7e-21"
FT                   /inference="protein motif:HMMPfam:PF02632"
FT   CDS             180688..181467
FT                   /transl_table=11
FT                   /locus_tag="SpyM50160"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD2"
FT                   /protein_id="CAM29504.1"
FT                   /translation="MKLTTLGSWGAYPYQDAGTTSYLVTGHDGFQLLMDAGSRALNELE
FT                   KEISPLDLDAVIISHYHPDHVADLGVLRHYFQLYPKHLWQPKVLPIYGHDEDRHEFAKL
FT                   SIPDVSEGRAYDVTGVERIGPFDITFLKTVHPVVCYAFRIVERATGQVLVFTGDSGYFE
FT                   GLADFAKEADLFLADVYLYEGNENHMAHLTSKEAGLMASQAGVKKLVLTHMPPVPPDGI
FT                   NSKNHLEVLRQETQAYAGNIPVDLALPHKSWNLGSLS"
FT   misc_feature    180739..181326
FT                   /locus_tag="SpyM50160"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 6.1e-16"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS             181467..181940
FT                   /transl_table=11
FT                   /locus_tag="SpyM50161"
FT                   /product="putative deaminase"
FT                   /db_xref="GOA:A2RCD3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD3"
FT                   /protein_id="CAM29505.1"
FT                   /translation="MPYSLEEQTYFMQEALKEAEKSLQKAEIPIGCVIVKDGEIIGRGH
FT                   NAREESNQAIMHAEIMAINEANAHEGNWRLLDTTLFVTIEPCVMCSGAIGLARIPHVIY
FT                   GASNQKFGGADSLYQILTDERLNHRVQVERGLLAADCANIMQTFFRQGRERKK"
FT   misc_feature    181482..181784
FT                   /locus_tag="SpyM50161"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminase, score 1.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00383"
FT   misc_feature    181635..181748
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature"
FT                   /inference="protein motif:Prosite:PS00903"
FT   CDS             complement(182595..183827)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50162"
FT                   /product="putative lipoprotein"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD4"
FT                   /protein_id="CAM29506.1"
FT                   /translation="MGVMMKQKIKILTVIGLMTVGMSACHNTSKPSNTDSVFSLTGKKR
FT                   QQIVKQVRQRYYFQQLSKTEQENYLTLYDSLAQFREIISLTPASKKSLIKTIDAFVMDN
FT                   PEFYWITSADYRFEFSDQTVFVTFPIPEDAKNVYQDLQAIGNDIVANTPSKDRYEQVKY
FT                   FYEVIIRDTDYNKKAFEAYQSGSQAQVASNQDIKSVFIDHLSVCNGYAQAFQFLCQKAG
FT                   IPVAYIRGTGTSQQPQQSFAHAWNAVQINNTYYGVDVTWGDPVFDNHLSHQKQGTINYS
FT                   FLCLPDYLMALSHQPSKDIAFNTKERFENVWTIPSCTDDSLLYSKRHQSYISTFDSDAI
FT                   LASLENQLLNRQEQLSLQFAHQDDYQQMVTDLTTNQTGYHNLFNQYWNNYTGFTYGLLP
FT                   ETLSISFASRN"
FT   sig_peptide     complement(183726..183827)
FT                   /locus_tag="SpyM50162"
FT                   /note="Signal peptide predicted for SpyM50162 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.975) with cleavage
FT                   site probability 0.522 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(183753..183785)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             183869..183976
FT                   /transl_table=11
FT                   /locus_tag="SpyM50163"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD5"
FT                   /protein_id="CAM29507.1"
FT                   /translation="MGRGKDFQKAKSCLERVMIFLGIQSILSQNEAMLT"
FT   misc_RNA        184026..184127
FT                   /note="Bacterial signal recognition particle RNA (RF00169)
FT                   as predicted by Rfam, score 61.20"
FT                   /inference="nucleotide motif:Rfam:RF00169"
FT   CDS             complement(184223..185221)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50164"
FT                   /product="insertion sequence IS1239 putative transposase"
FT                   /db_xref="GOA:A2RCD6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD6"
FT                   /protein_id="CAM29508.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSPGKEAMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSAQAVNEALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRLIRRCLPKG
FT                   NKTTTPKEVAAIEHWINHYPKRLFNYKSSVEMLKLANFNLKFGIVKMFVFI"
FT   CDS             join(184227..184235,185322..186017)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="SpyM50165"
FT                   /note="CDS is disrupted by the insertion of an IS element
FT                   after codon 3"
FT                   /db_xref="PSEUDO:CAM29509.1"
FT   repeat_region   complement(184236..184249)
FT                   /note="direct repeat"
FT   repeat_region   complement(184252..185321)
FT                   /note="IS1239"
FT   misc_feature    complement(184277..184714)
FT                   /locus_tag="SpyM50164"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   3.9e-18"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   misc_feature    complement(185075..185140)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1555.000, SD 4.48 at aa 28-49, sequence
FT                   RSNREIARLLGKAPQTIHNEIK"
FT   repeat_region   complement(185322..185335)
FT                   /note="direct repeat"
FT   misc_feature    185418..185663
FT                   /gene="speG"
FT                   /locus_tag="SpyM50165"
FT                   /note="HMMPfam hit to PF01123,Staphylococcal/Streptococcal
FT                   toxin, O, score 2.8e-26"
FT                   /inference="protein motif:HMMPfam:PF01123"
FT   misc_feature    185682..186008
FT                   /gene="speG"
FT                   /locus_tag="SpyM50165"
FT                   /note="HMMPfam hit to PF02876,Staphylococcal/Streptococcal
FT                   toxin, b, score 3.6e-19"
FT                   /inference="protein motif:HMMPfam:PF02876"
FT   CDS             186102..186221
FT                   /transl_table=11
FT                   /locus_tag="SpyM50166"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCD8"
FT                   /protein_id="CAM29510.1"
FT                   /translation="MRKYLQVIGASIAFAGVALCIDHMHDGVITRIEMIKSLK"
FT   misc_feature    186111..186164
FT                   /locus_tag="SpyM50166"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50166 by TMHMM2.0 at aa 4-21"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             186473..187822
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="SpyM50167"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="GOA:A2RCD9"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /protein_id="CAM29511.1"
FT                   /translation="MSHITFDYSKVLESFAGQHEIDFLQGQVTEADKLLREGTGPGSDF
FT                   LGWLDLPENYDKEEFARILTAAEKIKSDSEVLVVIGIGGSYLGAKAAIDFLNHHFANLQ
FT                   TAKERKAPQILYAGNSISSTYLADLVEYVQDKEFSVNVISKSGTTTEPAIAFRVFKELL
FT                   VKKYGQEEANKRIYATTDKVKGAVKVEADANNWETFVVPDNVGGRFSVLTAVGLLPIAA
FT                   SGADITALMEGANAARKDLSSDKISENIAYQYAAVRNVLYRKGYITEILANYEPSLQYF
FT                   GEWWKQLAGESEGKDQKGIYPTSANFSTDLHSLGQFIQEGYRNLFETVIRVDNPRKNVI
FT                   IPELAEDLDGLGYLQGKDVDFVNKKATDGVLLAHTDGGVPNMFVTLPAQDEFTLGYTIY
FT                   FFELAIAVSGYMNAVNPFDQPGVEAYKRNMFALLGKPGFEALSAELNARL"
FT   misc_feature    186491..187810
FT                   /gene="pgi"
FT                   /locus_tag="SpyM50167"
FT                   /note="HMMPfam hit to PF00342, Phosphoglucose
FT                   isomerase,score 1.6e-147"
FT                   /inference="protein motif:HMMPfam:PF00342"
FT   misc_feature    187079..187120
FT                   /note="PS00765 Phosphoglucose isomerase signature 1"
FT                   /inference="protein motif:Prosite:PS00765"
FT   CDS             complement(188170..189678)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50168"
FT                   /product="putative regulatory protein-RofA related"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE0"
FT                   /protein_id="CAM29512.1"
FT                   /translation="MLDYYLESDIIDQKILLAILLTEKELTMAAACSQTTLTALKIKQY
FT                   LRQFNALFKGYLRIELIKSRIYCEVLNDKREAFFYDIFALSDTLKMLTFLLLDNPKHKS
FT                   IAVYTRKQGISQSKAYRLIHKLKHYLQDIGLNIVDNTVIGDELKIRYLIALLHKEYGII
FT                   LYDIQPADIETIHAFIFATQKNLQPSAFLDRRFLFFDVLLMLTWKRHRYPVHLPHLALF
FT                   EHLKSLPIFDNIKTIAVDELAPRTRVTFSSDDFDYLFLIYLTTDNSFLSGYWTSHQRQH
FT                   LYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLIPFFKRTLYNLQTLITFDGYYFDQ
FT                   YQGNMLLLDKLETVIKDWLYDTGRQGSISSGHLHLMCLYLEQILESSIAPINITVIESQ
FT                   ETVGNVIANFITSTIPSYKVELSRVNILSDNIYPYDKPVDLVVTSQKLLPFLKELGVFP
FT                   KETRLFSLSLDCIQQQREDLIKTILALHQNHYQKRLEELWRVPS"
FT   misc_feature    complement(188545..188577)
FT                   /note="PS00626 Regulator of chromosome condensation (RCC1)
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00626"
FT   misc_feature    complement(188617..189399)
FT                   /locus_tag="SpyM50168"
FT                   /note="HMMPfam hit to PF07003, RofA transcriptional
FT                   regulator, score 9.3e-152"
FT                   /inference="protein motif:HMMPfam:PF07003"
FT   misc_feature    complement(188635..188682)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(189307..189372)
FT                   /note="Predicted helix-turn-helix motif with score 993.000,
FT                   SD 2.57 at aa 103-124, sequence KSIAVYTRKQGISQSKAYRLIH"
FT   CDS             189983..190114
FT                   /transl_table=11
FT                   /locus_tag="SpyM50169"
FT                   /product="hypothetical protein"
FT                   /note="Doubtful CDS. No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE1"
FT                   /protein_id="CAM29513.1"
FT                   /translation="MKRENKGKTYSPNGLGKPLFRMFSFYDSNLKVFLNDSLECLYF"
FT   CDS             190231..190338
FT                   /transl_table=11
FT                   /locus_tag="SpyM50170"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE2"
FT                   /protein_id="CAM29514.1"
FT                   /translation="MDVDLKRQNDQALLVDVVSNQAYQRANTIAKSNDL"
FT   CDS             190366..191037
FT                   /transl_table=11
FT                   /locus_tag="SpyM50171"
FT                   /product="rhomboid family membrane protein"
FT                   /db_xref="GOA:A2RCE3"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE3"
FT                   /protein_id="CAM29515.1"
FT                   /translation="MTRLLKRYPITIFLLGLTGLIFIAMQVVYGHLATGAQAIYQVGGM
FT                   FGLLVKAMPDQLWRLVTPIFIHIGFGHFFVNGLTLYFVGQIVEDLWGSRRFLLLYVLSG
FT                   VMGNAFTFWLTPETVAAGASTSLFGLFAAIVVLSFLGKNQALKDLGKSYQTLIVVNLLM
FT                   NLFMPNVSMAGHIGGVVGGALLSIVFPTKMRVITVKKTKRMLALVSYGIILVGVLVLGF
FT                   L"
FT   sig_peptide     190366..190479
FT                   /locus_tag="SpyM50171"
FT                   /note="Signal peptide predicted for SpyM50171 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.421 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(190402..190470,190546..190614,190651..190710,
FT                   190720..190788,190822..190881,190891..190959,
FT                   190978..191031)
FT                   /locus_tag="SpyM50171"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50171 by TMHMM2.0 at aa 13-35,
FT                   61-83,96-115,119-141,153-172, 176-198 and 205-222"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    190519..190947
FT                   /locus_tag="SpyM50171"
FT                   /note="HMMPfam hit to PF01694, Rhomboid family, score
FT                   1.7e-44"
FT                   /inference="protein motif:HMMPfam:PF01694"
FT   misc_feature    190798..190821
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(191136..192035)
FT                   /transl_table=11
FT                   /gene="hasC2"
FT                   /locus_tag="SpyM50172"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase 2"
FT                   /EC_number="2.7.7.9"
FT                   /note="Similar to SpyM51826, 90.268% identity (90.268%
FT                   ungapped) in 298 aa overlap"
FT                   /db_xref="GOA:A2RCE4"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE4"
FT                   /protein_id="CAM29516.1"
FT                   /translation="MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   LKSGIEEILIVTGKSKRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQS
FT                   HPRGLGDAVLQAKTFVGNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVM
FT                   RVPHEDVSNYGIIAPQAKAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILE
FT                   KQEPGAGNEVQLTDAIDTLNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKD
FT                   DLKAYIIQLGKALEKTKP"
FT   misc_feature    complement(191211..192020)
FT                   /gene="hasC2"
FT                   /locus_tag="SpyM50172"
FT                   /note="HMMPfam hit to PF00483, Nucleotidyl
FT                   transferase,score 5.6e-21"
FT                   /inference="protein motif:HMMPfam:PF00483"
FT   sig_peptide     complement(191958..192035)
FT                   /gene="hasC2"
FT                   /locus_tag="SpyM50172"
FT                   /note="Signal peptide predicted for SpyM50172 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.968) with cleavage
FT                   site probability 0.960 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(192068..193084)
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /gene_synonym="glyC"
FT                   /locus_tag="SpyM50173"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /db_xref="GOA:A2RCE5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /protein_id="CAM29517.1"
FT                   /translation="MTKQKVAILGPGSWGTALSQVLNDNGHDVRLWGNIPDQIEEINTK
FT                   HTNRHYFKDIVLDKNITATLDLGQALSDVDAVLFVVPTKVTRLVARQVAAILDHKVVVM
FT                   HASKGLEPETHERLSTILEEEIPAHFRSEVVVVSGPSHAEETIVRDITLITAASKDIEA
FT                   AKYVQSLFSNHYFRLYTNTDVIGVETAGALKNIIAVGAGALHGLGYGDNAKAAVITRGL
FT                   AEITRLGVKLGADPLTYSGLSGVGDLIVTGTSVHSRNWRAGAALGRGEKLEDIERNMGM
FT                   VIEGIATTKVAYEIAQDLGVYMPITTAIYKSIYEGADIKESILGMMSNEFRSENEWH"
FT   misc_feature    complement(192107..192541)
FT                   /gene="gpsA"
FT                   /gene_synonym="glyC"
FT                   /locus_tag="SpyM50173"
FT                   /note="HMMPfam hit to PF07479, NAD-dependent
FT                   glycerol-3-phosphate deh, score 4.9e-72"
FT                   /inference="protein motif:HMMPfam:PF07479"
FT   misc_feature    complement(192542..193078)
FT                   /gene="gpsA"
FT                   /gene_synonym="glyC"
FT                   /locus_tag="SpyM50173"
FT                   /note="HMMPfam hit to PF01210, NAD-dependent
FT                   glycerol-3-phosphate deh, score 5.9e-61"
FT                   /inference="protein motif:HMMPfam:PF01210"
FT   CDS             193382..193831
FT                   /transl_table=11
FT                   /locus_tag="SpyM50174"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="GOA:A2RCE6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE6"
FT                   /protein_id="CAM29518.1"
FT                   /translation="MSQVIGDLRELIHQIEQISDEIAKKYDVEHLAGPQGYVLVFLAKH
FT                   QNQEIFVKDIEKQLRISKSVASHLVKRMVKNGFINVMPSQVDKRYKQVVLAQVGRDKLP
FT                   LLRECRKDIEHYFLKEITKEELLTAKKVIEQLKQNMLTYKGDNDA"
FT   misc_feature    193472..193789
FT                   /locus_tag="SpyM50174"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.2e-09"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   CDS             193824..195530
FT                   /transl_table=11
FT                   /locus_tag="SpyM50175"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="GOA:A2RCE7"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE7"
FT                   /protein_id="CAM29519.1"
FT                   /translation="MLKDAILRYKWYALGSFFMVIGVVASSLLQPHYLKSVLSAVIQNN
FT                   QEKIYEVGKPLLIIALLGLMSGAINTVLAAKIAQGVSADMREKTFRKIQDFSYANIEAF
FT                   NAGNLVVRLTNDINQIQSLVMMMFQILFRLPILFIGAFIMAVQTFPQLWWVIVVMVILI
FT                   ALIMGLVMRQMGPRFGKFQRLMDKINHIAKENLRGVRVVKSFVQEQQQYTKFKETSNDL
FT                   LALNLSIGYGFSLMQPALMLVSYLAVYVSINVVSTMVETDPTVIGNIASFMTYMMQIMF
FT                   SIIMVGSMGMQVSRAFVSMARIRQILSTEPAMTFENEKEETISGSIVFDDVSFTYPNDD
FT                   EPTLKHISFAIEPGQMVGIVGATGSGKSTLAQLIPRLFDPQDGQILLGGKPIKTLSQTT
FT                   LRQSVSIVLQKAILFSGTIADNLRQGSAKADIDAMQKAAQIAQAKEFIDRMDSRYESQV
FT                   EERGSNLSGGQKQRLSIARGVINHPKILILDDSTSALDAKSEKRVQEALSHKLEGTTTV
FT                   IVAQKISSVVKADKILVLDQGQLIGEGTHAELVANNAIYREIYETQKGREE"
FT   sig_peptide     193824..193943
FT                   /locus_tag="SpyM50175"
FT                   /note="Signal peptide predicted for SpyM50175 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.600) with cleavage
FT                   site probability 0.321 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(193857..193925,193989..194048,194109..194162,
FT                   194190..194258,194277..194336,194511..194579,
FT                   194616..194684)
FT                   /locus_tag="SpyM50175"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50175 by TMHMM2.0 at aa 12-34,
FT                   56-75,96-113,123-145,152-171, 230-252 and 265-287"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    193860..194672
FT                   /locus_tag="SpyM50175"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 1.1e-24"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    194883..195437
FT                   /locus_tag="SpyM50175"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-51"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    194904..194927
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    195216..195260
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             195533..197317
FT                   /transl_table=11
FT                   /locus_tag="SpyM50176"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="GOA:A2RCE8"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE8"
FT                   /protein_id="CAM29520.1"
FT                   /translation="MKTARFFWFYFKRYRFSFTVIAVAVILATYLQVKAPVFLGKSLTE
FT                   LGKIGQAYYVAKMSGQTHFSPDLSAFNAVMFKLLMTYFFTVLANLIYSFLLTRVVSHST
FT                   NRMRKGLFGKLERLTVAFFDRHKDGEILSRFTSDLDNIQNSLNQSLVQVVTNIALYIGL
FT                   VWMMFRQDSRLALLTIASTPVALIFLVINIRLARKYTNIQQQEVSALNAFMDETISGQK
FT                   AIIVQGVQEDTMTAFLKHNERVRQATFKRRLFSGQLFPVMNGMSLINTAIVIFVGSTIV
FT                   LSDKSMPAAAALGLVVTFVQYSQQYYQPMMQIASSWGELQLAFTGAHRIQEMFDETEEV
FT                   RPQNAPAFTSLKEAVAINHVDFGYLPGQKVLSDVSIVAPRGKMIAVVGPTGSGKTTIMN
FT                   LINRFYDVDAGSITFDGRDIRDYDLDSLRQKVGIVLQESVLFSGTITDNIRFGDQTISQ
FT                   DMVETAARATHIHDFIMSLPKGYNTYVSDDDNVFSTGQKQLISIARTLLTDPEVLILDE
FT                   ATSNVDTVTESKIQRAMEAIVAGRTSFVIAHRLKTILNADHIIVLKDGKVIEQGNHHEL
FT                   LHQKGFYAELYHNQFVFE"
FT   sig_peptide     195533..195652
FT                   /locus_tag="SpyM50176"
FT                   /note="Signal peptide predicted for SpyM50176 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.914) with cleavage
FT                   site probability 0.339 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(195578..195631,195764..195832,195980..196039,
FT                   196052..196120,196307..196375)
FT                   /locus_tag="SpyM50176"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50176 by TMHMM2.0 at aa 17-34, 79-101, 151-170,175-197
FT                   and 260-282"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    195620..196462
FT                   /locus_tag="SpyM50176"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 5.7e-30"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    195635..195658
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    196673..197227
FT                   /locus_tag="SpyM50176"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   9.7e-56"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    196694..196717
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             197435..198202
FT                   /transl_table=11
FT                   /locus_tag="SpyM50177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCE9"
FT                   /protein_id="CAM29521.1"
FT                   /translation="MIDLQEILANMNPNQKINYDRVMQQMAKVWEKESVRPSILMHVCC
FT                   APCSTYTLEYLTQFADITVYFANSNIHPKDEYHRRAYVTQQFVSEFNAKTGNTVQFLEA
FT                   DYVPNEYVRQVRGLEEEPEGGDRCRVCFDYRLDKTAQKAVELGFDYFASALTISPHKNS
FT                   QTINDVGIDVQKVYTTKYLPSDFKKNNGYRRSVEMCEEYDIYRQCYCGCVYAAKMQGID
FT                   LVQVKKDAKAFMADKDLDNDFTHIRFSYRGDEM"
FT   misc_feature    197549..198148
FT                   /locus_tag="SpyM50177"
FT                   /note="HMMPfam hit to PF02677, Uncharacterized BCR,COG1636,
FT                   score 4.2e-47"
FT                   /inference="protein motif:HMMPfam:PF02677"
FT   CDS             198312..198758
FT                   /transl_table=11
FT                   /locus_tag="SpyM50178"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="GOA:A2RCF0"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF0"
FT                   /protein_id="CAM29522.1"
FT                   /translation="MTKIRGFELVSSFTNPDLLPKRETTHAAGYDLSVAEAVTIAPGEI
FT                   KLVPTGVKAYMQDGEVLYLYDRSSNPRKKGIILINSVGVIDADYYGNEANEGHIFAQMQ
FT                   NITDHPVTLAVGERIVQGVFMPFLIADGDQARGERTGGFGSTGQ"
FT   misc_feature    198354..198752
FT                   /locus_tag="SpyM50178"
FT                   /note="HMMPfam hit to PF00692, dUTPase, score 6.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00692"
FT   CDS             198839..200200
FT                   /transl_table=11
FT                   /gene="sms"
FT                   /gene_synonym="radA"
FT                   /locus_tag="SpyM50179"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="GOA:A2RCF1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF1"
FT                   /protein_id="CAM29523.1"
FT                   /translation="MAKKKATFICQECGYQSPKYLGRCPNCSAWSSFVEEVEVKEVKNA
FT                   RVSLAGEKSRPVKLKDVDNISYHRTQTDMSEFNRVLGGGVVPGSLILIGGDPGIGKSTL
FT                   LLQVSTQLANKGTVLYVSGEESAEQIKLRSERLGDIDNEFYLYAETNMQAIRTEIENIK
FT                   PDFLIIDSIQTIMSPDITGVQGSVSQVREVTAELMQLAKTNNIATFIVGHVTKEGTLAG
FT                   PRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFL
FT                   EERLDGATGSAVVVTMEGSRPILAEVQSLVTPTVFGNARRTTTGLDFNRVSLIMAVLEK
FT                   RCGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKEKPTSPQEAFLGEIGLTGEI
FT                   RRVTRIEQRINEAAKLGFTKVYAPKNALQGIDIPQGIEVVGVTTVGQVLKAVFS"
FT   misc_feature    199121..199144
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             200388..200885
FT                   /transl_table=11
FT                   /locus_tag="SpyM50180"
FT                   /product="putative carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="GOA:A2RCF2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF2"
FT                   /protein_id="CAM29524.1"
FT                   /translation="MSYFEHFMAANQAYVALHGTAHLPLKPKTKVAIVTCMDSRLHVAQ
FT                   ALGLALGDAHILRNAGGRVTEDMIRSLVISQQQMGTREIVVLHHTDCGAQTFTNEGFAK
FT                   HIHEHLGVDVSGQDFLPFQDVEDSVRKDMAKLRASSLIPDDVVINGAVYDVDTGKVTQV
FT                   ME"
FT   misc_feature    200457..200879
FT                   /locus_tag="SpyM50180"
FT                   /note="HMMPfam hit to PF00484, Carbonic anhydrase, score
FT                   9.1e-16"
FT                   /inference="protein motif:HMMPfam:PF00484"
FT   CDS             201016..201726
FT                   /transl_table=11
FT                   /locus_tag="SpyM50181"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF3"
FT                   /protein_id="CAM29525.1"
FT                   /translation="MVDNRMRFTIDQNMQFPLVEIDLEHGGSVYLQQGSMVYHTENVTL
FT                   NTKLNGKGSGLGKLVGAIGRSMVSGESMFITQAMSNGDGKLALAPNTPGQIVALELGEK
FT                   QYRLNDGAFLALDGSAQYKMERQNIGKALFGGQGELFVMTTEGLGTLLANSFGSIKKIT
FT                   LDGGTMTIDNAHVVAWSRELDYDIHLENGFMQSIGTGEGVVNTFRGHGEIYIQSLNLEQ
FT                   FAGTLKRYLPTSSN"
FT   misc_feature    201031..201708
FT                   /locus_tag="SpyM50181"
FT                   /note="HMMPfam hit to PF01987, Protein of unknown function
FT                   DUF124, score 3e-91"
FT                   /inference="protein motif:HMMPfam:PF01987"
FT   CDS             201908..203353
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="SpyM50182"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="GOA:A2RCF4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /protein_id="CAM29526.1"
FT                   /translation="MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIED
FT                   TDRKRHVEDGERSQLENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYK
FT                   SYVTEEELAAERERQEAAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNES
FT                   GIYKWTDMVKGDIEFEGGNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIA
FT                   NTPKQLMVYEALGWEAPEFGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVF
FT                   NFIALLGWNPGGEEEIFSREQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETV
FT                   YALCKPFLEEAGRLTEKAEKLVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAG
FT                   ETVSTVLQAFKAKLEAMSDEDFKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHG
FT                   PELPNTIYLLGRDKSIEHIKNML"
FT   misc_feature    201917..202885
FT                   /gene="gltX"
FT                   /locus_tag="SpyM50182"
FT                   /note="HMMPfam hit to PF00749, tRNA synthetases class I (E
FT                   and Q), cata, score 2.7e-159"
FT                   /inference="protein motif:HMMPfam:PF00749"
FT   misc_feature    201938..201973
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             203748..205094
FT                   /transl_table=11
FT                   /gene="fasB"
FT                   /locus_tag="SpyM50183"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="GOA:A2RCF5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF5"
FT                   /protein_id="CAM29527.1"
FT                   /translation="MANSEYMFLLLSIIVYYMTKIYIFSFLSDITLPVWKQLTILALAL
FT                   FFNQFPYLSPLLIDPLLFLVVLRQETKQLFSLKALFLAVAPSVLVDLLSRFMGTIVIPY
FT                   LFLSSGIYLGHIIFDLLAYLLIFPSFAIINYMIGKDYKMICQSGYSKRSHNFYQTLLIF
FT                   VLVYYVDIFVILGFTDPFLHFHHSLFVPTPYKLLFLMFILLLVYLLSYFNHSSKEYLKN
FT                   ELRREQQAYMTNLETYGKHLEKLYRDVRAFQSDYLSRIERLGQAIKSESITQIQDIYAQ
FT                   TVHEANDYWDDKHYNISKLRKINISSIKSLLSAKIISAEKSGIDLNVEVPDNIKETYIP
FT                   ELDLLLLMSIFCDNAIEAALEAQQPHMSIAYFLLDDYQMFVVTNTTKKKVDINKIFEEG
FT                   YSSKGSERGIGLSNAQRILKKYPYLSLRTKSFDKEFSQTLTMPKEEVDR"
FT   misc_feature    order(203784..203852,203880..203948,203982..204050,
FT                   204093..204161,204222..204290,204333..204392)
FT                   /gene="fasB"
FT                   /locus_tag="SpyM50183"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50183 by TMHMM2.0 at aa 13-35,
FT                   45-67,79-101,116-138,159-181 and 196-215"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    204651..204698
FT                   /note="PS00012 Phosphopantetheine attachment site"
FT                   /inference="protein motif:Prosite:PS00012"
FT   misc_feature    204762..205079
FT                   /gene="fasB"
FT                   /locus_tag="SpyM50183"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             join(205091..205588,205591..206373)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50184"
FT                   /EC_number="2.7.3.-"
FT                   /note="Previously sequenced as Streptococcus pyogenes
FT                   MGAS10394 putative histidine kinase FasC (ec 2.7.3.-).
FT                   UniProt:Q5XDZ2 (EMBL:CP000003) (EC 2.7.3.- aa) fasta
FT                   scores: E()=2.7e-150, 99.532% id in 427 aa. CDS contains a
FT                   frameshift mutation after codon 166. Frameshift occurs at a
FT                   poly T pentamer"
FT                   /db_xref="PSEUDO:CAM29528.1"
FT   misc_feature    order(205100..205159,205193..205288,205331..205399,
FT                   205436..205504,205547..205600)
FT                   /locus_tag="SpyM50184"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50184 by TMHMM2.0 at aa 4-23, 35-66, 81-103, 116-138
FT                   and 153-170"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             206377..207117
FT                   /transl_table=11
FT                   /gene="fasA"
FT                   /locus_tag="SpyM50186"
FT                   /product="response regulator protein"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCF7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF7"
FT                   /protein_id="CAM29529.1"
FT                   /translation="MMNIFILEDDFIQQTRIESIVVGILKETRIPCNQLEVFSTPQKLF
FT                   ESIQERGDHQLYFLDIEIGEYTRCGLELAAAIRQKDPNAVIVFVTTHSEFAPISFKYKV
FT                   SALDFIDKAGGQKQFKEQIEECIRYTYDMMSSRESKDMFLFETPQTRLKLPYKDILYFA
FT                   TATTPHKVCLWTQTERLEFYGNLSEIQAVAPKLFLCHRSYLVNLDKVVRIDKSKQLLYF
FT                   ENGDSCMVSRLKMKCLFERWEALR"
FT   misc_feature    206380..206769
FT                   /gene="fasA"
FT                   /locus_tag="SpyM50186"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 1.4e-05"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    206821..207105
FT                   /gene="fasA"
FT                   /locus_tag="SpyM50186"
FT                   /note="HMMPfam hit to PF04397, LytTr DNA-binding
FT                   domain,score 1.2e-25"
FT                   /inference="protein motif:HMMPfam:PF04397"
FT   misc_RNA        207230..207314
FT                   /note="Region contains putative fasX regulatory RNA"
FT   CDS             207657..208016
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SpyM50187"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="GOA:A2RCF8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /protein_id="CAM29530.1"
FT                   /translation="MKKTYRVKREKDFQAIFKDGKSTANRKFVIYHLNRSQDHFRVGIS
FT                   VGKKIGNAVTRNAVKRKIRHVIMALGHQLKSEDFVVIARKGVESLEYQELQQNLHHVLK
FT                   LAQLLEKGFESEEKH"
FT   misc_feature    207657..207977
FT                   /gene="rnpA"
FT                   /locus_tag="SpyM50187"
FT                   /note="HMMPfam hit to PF00825, Ribonuclease P, score
FT                   3.3e-33"
FT                   /inference="protein motif:HMMPfam:PF00825"
FT   misc_feature    207699..207722
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             208000..208809
FT                   /transl_table=11
FT                   /locus_tag="SpyM50188"
FT                   /product="membrane protein OxaA 1 precursor"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCF9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCF9"
FT                   /protein_id="CAM29531.1"
FT                   /translation="MKKNIKIARIVPLVLLLVACGRGEVTAQSSSGWDQLVYLFARAIQ
FT                   WLSFDGSIGVGIILFTLTIRLMLMPLFNMQIKSSQKMQDIQPELRELQKKYAGKDTQTR
FT                   MKLAEESQALYKKYGVNPYASLLPLLIQMPVMIALFQALTRVSFLKTGTFLWVELAQHD
FT                   HLYLLPVLAAVFTFLSTWLTNLAAKEKNVMMTVMIYVMPLMIFFMGFNLASGVVLYWTV
FT                   SNAFQVVQLLLLNNPFKIIAERQRLANEEKERRLRERRARKKAMKRK"
FT   sig_peptide     208000..208086
FT                   /locus_tag="SpyM50188"
FT                   /note="Signal peptide predicted for SpyM50188 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.571 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(208018..208077,208135..208203,208366..208434,
FT                   208492..208560,208597..208665)
FT                   /locus_tag="SpyM50188"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50188 by TMHMM2.0 at aa 7-26, 46-68, 123-145, 165-187
FT                   and 200-222"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    208150..208716
FT                   /locus_tag="SpyM50188"
FT                   /note="HMMPfam hit to PF02096, 60Kd inner membrane protein,
FT                   score 6.1e-55"
FT                   /inference="protein motif:HMMPfam:PF02096"
FT   CDS             208821..209735
FT                   /transl_table=11
FT                   /locus_tag="SpyM50189"
FT                   /product="putative ssDNA-binding protein"
FT                   /db_xref="GOA:A2RCG0"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG0"
FT                   /protein_id="CAM29532.1"
FT                   /translation="MVLFTGKTVEEAIETGLQELGLSRLKAHIKVISKEKKGFLGFGKK
FT                   PAQVDIEGISDKTVYKADKKATRGVPEDINQKHAPAVNSADVEPEEIKATQKLEAEDTK
FT                   VVPLMPEDSPAQTSSKLAETVTETKAQQPSIPVEESEVPQDAGNDGFSKDIEKAAQEVS
FT                   DYVTKIIYEMDIEATVETSNNRRQINLQIETPEAGRVIGYHGKVLKSLQLLAQNFLHDR
FT                   YSKNFSVSLNVHDYVEHRTETLIDFTQKVAKRVLESGQDYTMDPMSNSERKIVHKTVSS
FT                   IEGVDSYSEGNDPNRYVVVSLQR"
FT   misc_feature    209562..209729
FT                   /locus_tag="SpyM50189"
FT                   /note="HMMPfam hit to PF01424, R3H domain, score 1.2e-11"
FT                   /inference="protein motif:HMMPfam:PF01424"
FT   CDS             210050..210184
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SpyM50190"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="GOA:A2RCG1"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /protein_id="CAM29533.1"
FT                   /translation="MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLAARRRKGRKVLSA"
FT   misc_feature    210050..210181
FT                   /gene="rpmH"
FT                   /locus_tag="SpyM50190"
FT                   /note="HMMPfam hit to PF00468, Ribosomal protein L34,score
FT                   1.7e-19"
FT                   /inference="protein motif:HMMPfam:PF00468"
FT   misc_feature    210053..210112
FT                   /note="PS00784 Ribosomal protein L34 signature"
FT                   /inference="protein motif:Prosite:PS00784"
FT   CDS             210458..211162
FT                   /transl_table=11
FT                   /locus_tag="SpyM50191"
FT                   /product="putative N-acetylmannosamine-6-phosphate
FT                   2-epimerase"
FT                   /EC_number="5.1.3.9"
FT                   /db_xref="GOA:A2RCG2"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /protein_id="CAM29534.1"
FT                   /translation="MPDKPTKEKLMEQLKGGIIVSCQALPGEPLYSETGGIMPLLAKAA
FT                   QEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAV
FT                   IAMDCTKRDRHDGLDIASFIRQVKEKYPNQLLMADISTFDEGLVAHQAGIDFVGTTLSG
FT                   YTPYSCQEAGPDVALIEALCKVGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPK
FT                   EIAERFIEALKS"
FT   misc_feature    210569..211159
FT                   /locus_tag="SpyM50191"
FT                   /note="HMMPfam hit to PF04131, Putative
FT                   N-acetylmannosamine-6-phosphate epi, score 9.8e-139"
FT                   /inference="protein motif:HMMPfam:PF04131"
FT   CDS             211211..212530
FT                   /transl_table=11
FT                   /locus_tag="SpyM50192"
FT                   /product="extracellular solute-binding lipoprotein"
FT                   /db_xref="GOA:A2RCG3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG3"
FT                   /protein_id="CAM29535.1"
FT                   /translation="MNMKKLASLAMLGASVLGLAACGGKSQKEAGASKSDTAKTEITWW
FT                   AFPVFTQEKAEDGVGTYEKKLIAAFEKANPEIKVKLETIDFTSGPEKITTAIEAGTAPD
FT                   VLFDAPGRIIQYGKNGKLADLNDLFTEEFTKDVNNDKLIQASKAGDTAYMYPISSAPFY
FT                   MALNKKMLKDAGVLDLVKEGWTTDDFEKVLKALKDKGYNPGSFFANGQGGDQGPRAFFA
FT                   NLYSSHITDDKVTKYTTDDANSIKAMTKISNWIKDGLMMNGSQYDGSADIQNFANGQTS
FT                   FTILWAPAQPGIQAKLLEASKVDYLEIPFPSDDGKPELEYLVNGFAVFNNKDEQKVAAS
FT                   KTFIQFIADDKEWGPKNVVRTGAFPVRTSYGDLYKDKRMKKIAEWTKFYSPYYNTIDGF
FT                   AEMRTLWFPMVQAVSNGDEKPEDALKAFTEKANKTIKKTQ"
FT   sig_peptide     211211..211306
FT                   /locus_tag="SpyM50192"
FT                   /note="Signal peptide predicted for SpyM50192 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.389 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    211226..212272
FT                   /locus_tag="SpyM50192"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 5.1e-23"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   misc_feature    211244..211276
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             212635..213522
FT                   /transl_table=11
FT                   /locus_tag="SpyM50193"
FT                   /product="putative transport system permease"
FT                   /db_xref="GOA:A2RCG4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG4"
FT                   /protein_id="CAM29536.1"
FT                   /translation="MNVNKLKMRETLISYAFLAPVLVFFVIFVLIPMIMGFVTSFFNYS
FT                   MTDFTFVGFANYVRMFQDPIFMKSLINTLIIVIGSVPVVVFFSLFVAAKTYDKNVVARS
FT                   FYRAVFFLPVVTGSVAVTVVWKWIYDPMSGILNYVLKYAHVIEQNISWLGDKHWALLAI
FT                   IVILLTTSVGQPIILYIAAMGNIDNSLVEAARVDGATEFQVFWNIKWPSLLPTTLYIAV
FT                   ITTINSFQCFALIQLLTSGGPNYSTSTLMYYLYEKAFKLSEYGYANTMGVFLAVMIAII
FT                   SFAQFKILGNDVEY"
FT   sig_peptide     212635..212742
FT                   /locus_tag="SpyM50193"
FT                   /note="Signal peptide predicted for SpyM50193 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.959) with cleavage
FT                   site probability 0.406 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(212668..212736,212842..212910,212947..213015,
FT                   213106..213174,213424..213492)
FT                   /locus_tag="SpyM50193"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50193 by TMHMM2.0 at aa 12-34, 70-92, 105-127, 158-180
FT                   and 264-286"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    212830..213519
FT                   /locus_tag="SpyM50193"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5.6e-13"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS             213535..214365
FT                   /transl_table=11
FT                   /locus_tag="SpyM50194"
FT                   /product="putative transport system permease"
FT                   /db_xref="GOA:A2RCG5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG5"
FT                   /protein_id="CAM29537.1"
FT                   /translation="MTKKKLTASDILTTVMLCVLTILFIFPFYWIMTGAFKAQADTIMI
FT                   PPQWWPKAPTIENFKALVVQNPALKWLWNSIFISVATMFLVCGTSSLAGYALAKKWFYG
FT                   QRLLFSIFIAAMALPKQVVLVPLVRIVNFMGIHDTLAAVILPLVGWPFGVFLMKQFSEN
FT                   IPTELLESAKIDGCGEIRTFFNVAFPIVKPGFAALAIFTFINTWNDYFMQLVMLTSREN
FT                   LTISLGVATMQAEMATNYGLIMAGAAMAAVPIVTVFLVFQKSFTQGITMGAVKG"
FT   sig_peptide     213535..213648
FT                   /locus_tag="SpyM50194"
FT                   /note="Signal peptide predicted for SpyM50194 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.482 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(213568..213636,213760..213828,213853..213921,
FT                   213934..214002,214078..214146,214249..214317)
FT                   /locus_tag="SpyM50194"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50194 by TMHMM2.0 at aa 12-34,
FT                   76-98,107-129,134-156,182-204 and 239-261"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    213748..214347
FT                   /locus_tag="SpyM50194"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.1e-21"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS             214522..215184
FT                   /transl_table=11
FT                   /locus_tag="SpyM50195"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG6"
FT                   /protein_id="CAM29538.1"
FT                   /translation="MTSKKQGLLYSLFNLDSKWMRASAALFDLLVFNLLFVLSCLPLLT
FT                   IGVAKMALYASLLDWREGQVSQLFTTYSSYFKNYFKRGMRLGLIELLIMSICVLDLFLI
FT                   RNQSGLVFQGFKVLCIAVLFLVVILFLYAYPQAVRKELPLLILFKRSLLLAGIFFPWTF
FT                   AFLVVIGLLVFTLPLTLLTLFCGLSLLATMGISSLTYFYLLIMESLLRRFPLNNDIE"
FT   misc_feature    order(214591..214659,214777..214833,214846..214914,
FT                   214975..215043,215071..215139)
FT                   /locus_tag="SpyM50195"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50195 by TMHMM2.0 at aa 24-46, 86-104, 109-131,152-174
FT                   and 184-206"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    214606..214824
FT                   /locus_tag="SpyM50195"
FT                   /note="HMMPfam hit to PF04854, Protein of unknown function,
FT                   DUF624, score 5.8e-26"
FT                   /inference="protein motif:HMMPfam:PF04854"
FT   misc_feature    215017..215091
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00043"
FT   CDS             215196..216110
FT                   /transl_table=11
FT                   /gene="nanH"
FT                   /locus_tag="SpyM50196"
FT                   /product="putative N-acetylneuraminate lyase"
FT                   /EC_number="4.1.3.3"
FT                   /db_xref="GOA:A2RCG7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG7"
FT                   /protein_id="CAM29539.1"
FT                   /translation="MTDLTKYQGIIPAFYACYDDQGAISPERVRALTQYYIDKGVQGLY
FT                   INGSSGECIYQSVFDRQLVLENVMAVAKGKLTIINHVACNNTKDSIELAAHSERLGVDA
FT                   IAAIPPIYFRLPEYAVADYWNAISSAAPHTDFIIYNIPQLAGVALTPSLYKTMLANKRV
FT                   IGVKNSSMPVQDIQTFCAIGGDDRIVFNGPDEQFLGGRLMGAAAGIGGTYGAMPELFLR
FT                   LNQLIADKDLEKAKALQYTINEIIGVLVSAHGNMYGVIKEVLRINEGLDIGSVRSPLAE
FT                   LVEEDRVICQRAAALINQAKETF"
FT   misc_feature    215211..216089
FT                   /gene="nanH"
FT                   /locus_tag="SpyM50196"
FT                   /note="HMMPfam hit to PF00701, Dihydrodipicolinate
FT                   synthetase family, score 4.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00701"
FT   CDS             216132..217070
FT                   /transl_table=11
FT                   /locus_tag="SpyM50197"
FT                   /product="ROK family protein"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG8"
FT                   /protein_id="CAM29540.1"
FT                   /translation="MKHYLAIDIGGTAIKYGLISETGDLLEKEEMATEAYKGGPSILEK
FT                   VKGLVKTYQDQMDLAGVAISSAGMVNPDEGEIFYAGPQIPNYAGTQFKKEIEETFGLPC
FT                   EVENDVNCAGLAEAISGSAKDYPVALCLTIGTGIGGCLLFNSQVFHGSSHSACEVGYLH
FT                   LSDGQFQDLASTTALVQEVALAYGDDISQWDGRRIFEQAKAGDAICIAAISKQVDYLGQ
FT                   GIANICYVVNPNVVVLGGGIMAQKDYLADKLKTALDSYLVSSLAKKTQLKFASHGNNAG
FT                   ILGAYYHFKQKNERSCSFITLEKIENNLASS"
FT   misc_feature    216147..216665
FT                   /locus_tag="SpyM50197"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 6.1e-29"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   CDS             complement(217181..218011)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50198"
FT                   /product="putative transcription regulator"
FT                   /db_xref="GOA:A2RCG9"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCG9"
FT                   /protein_id="CAM29541.1"
FT                   /translation="MPKNHRLITKIEASLEHMTSLEKGIAHFFITTDLTPQELTASEIV
FT                   KRLHISQAALTRFAKKCGFTGYRAFAFDYLHSLQESQETFQSIHLELTKRVLMDYDALI
FT                   NKTYELVNEEKLLNLAKLIDASERVYFFGKGSSGLVAREMKLRFMRLGLICDAYSDTDG
FT                   FTWANSLVNENCLVFGFSLSGKTNSVITALHQASQRGAKTVLLTTDNQTEFDDSLDIIP
FT                   VSSTHQLHYGNRVSPQFPLLIMMDIIYAYVLAIDKPHKEKIFKNTIIDKENNDL"
FT   misc_feature    complement(217250..217654)
FT                   /locus_tag="SpyM50198"
FT                   /note="HMMPfam hit to PF01380, SIS domain, score 2.3e-09"
FT                   /inference="protein motif:HMMPfam:PF01380"
FT   misc_feature    complement(217454..217477)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(217832..217897)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1116.000, SD 2.99 at aa 39-60, sequence
FT                   LTASEIVKRLHISQAALTRFAK"
FT   CDS             218263..219087
FT                   /transl_table=11
FT                   /locus_tag="SpyM50199"
FT                   /product="TatD related DNase"
FT                   /EC_number="3.1.21.-"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCH0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH0"
FT                   /protein_id="CAM29542.1"
FT                   /translation="MWLRSLCYNNIMTNKVEKLTIFDTHTHLNVAEFQGHEAEELALAQ
FT                   EMGVAYHNVVGFDQATISGALALADQYPNVYATIGWHPTEAGSYSEAVEESIVSQLSHP
FT                   KVIALGEIGLDYHWMEDPKEVQIEVFKRQMQLAKDHDLPFVVHTRDALEDTYEVIKAAG
FT                   VGPRGGIMHSYSGSLEMAERFIELGMMISFSGVVTFKKALDIQEAAQHLPLDKILVETD
FT                   APYLTPVPKRGKQNHTAYTRYVVDKIAELRGMTVEEVAKATTANAKRVFKLD"
FT   misc_feature    218317..219078
FT                   /locus_tag="SpyM50199"
FT                   /note="HMMPfam hit to PF01026, TatD related DNase, score
FT                   2e-123"
FT                   /inference="protein motif:HMMPfam:PF01026"
FT   misc_feature    218323..218349
FT                   /note="PS01137 Uncharacterized protein family UPF0006
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS01137"
FT   CDS             219080..219649
FT                   /transl_table=11
FT                   /locus_tag="SpyM50200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RCH1"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH1"
FT                   /protein_id="CAM29543.1"
FT                   /translation="MTEKINIQEVLVVEGKDDTANLRRFYEVDTYETRGSAITEEDLER
FT                   INRLNDLRGVIVLTDPDYNGERIRKLIMAAVPTARHAFLNRNEAVPSSKSKGRSLGVEH
FT                   ARFEDLQKALAHVTQQYDDESYFDIRQTDLIRLGLLMASDSRKRREYLGEKLRIGYANG
FT                   KQLLKRLELFGITLAEVEEVMETYGE"
FT   misc_feature    219101..219334
FT                   /locus_tag="SpyM50200"
FT                   /note="HMMPfam hit to PF01751, Toprim domain, score 8e-07"
FT                   /inference="protein motif:HMMPfam:PF01751"
FT   CDS             219763..220635
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="SpyM50201"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GOA:A2RCH2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="CAM29544.1"
FT                   /translation="MRIADYSVTKAVLDRHGFTFKKSFGQNFLTDTNILQKIVDTAEID
FT                   QNVNVIEIGPGIGALTEFLAENAAEVMAFEIDDRLVPILADTLRDFDNVQVVNQDILKA
FT                   DLQTQIKQFKNPDLPIKVVANLPYYITTPILMHLIESKIPFQEFVVMMQREVADRISAE
FT                   PNTKAYGSLSIAVQYYMTAKVAFIVPRTVFVPAPNVDSAILKMVRRDQPLIEIKDEDFF
FT                   FRVSRLSFVHRRKTLWNNLTSHFGKSEDIKTKLEKGLALADIKPSIRGEALSIQDFGKL
FT                   ADALKEVGL"
FT   misc_feature    219811..220623
FT                   /gene="ksgA"
FT                   /locus_tag="SpyM50201"
FT                   /note="HMMPfam hit to PF00398, Ribosomal RNA adenine
FT                   dimethylase, score 2.2e-76"
FT                   /inference="protein motif:HMMPfam:PF00398"
FT   misc_feature    219910..219993
FT                   /note="PS01131 Ribosomal RNA adenine dimethylases
FT                   signature"
FT                   /inference="protein motif:Prosite:PS01131"
FT   CDS             221059..221931
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="SpyM50202"
FT                   /product="probable GTPase EngC"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="GOA:A2RCH3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH3"
FT                   /protein_id="CAM29545.1"
FT                   /translation="MQGKIIKSLAGFYYVESEGQVYQTRARGNFRKRGETPYVGDIVDF
FT                   SAEDNSEGYILAIHPRKNSLVRPPIVNIDQAVVIMSAKEPEFNSNLLDRFLILLEHKAI
FT                   HPVVYISKMDLLDSPEEIKAIGRQYQAIGYNFVTSLEELLPLLADKITVFMGQTGVGKS
FT                   TLLNRIAPELAIETGEISDSLGRGRHTTRAVSFYNTHGGKIADTPGFSSLDYDIANAED
FT                   LNEAFPELRRLSHKCKFRSCTHTHEPKCAVKAALETGELWPVRYEHYLQFLSEIENRRE
FT                   TYKKVIKRK"
FT   misc_feature    221062..221880
FT                   /gene="engC"
FT                   /locus_tag="SpyM50202"
FT                   /note="HMMPfam hit to PF03193, Protein of unknown function,
FT                   DUF258, score 7.3e-158"
FT                   /inference="protein motif:HMMPfam:PF03193"
FT   misc_feature    221524..221547
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             221941..222603
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="SpyM50203"
FT                   /product="putative ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="GOA:A2RCH4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH4"
FT                   /protein_id="CAM29546.1"
FT                   /translation="MSTLKIAPSILAADYANFASELARIEETDAEYVHIDIMDGQFVPN
FT                   ISFGADVVASMRKHSKLVFDCHLMVVDPERYVEAFAQAGADIMTIHTESTRHIHGALQK
FT                   IKAAGMKAGVVINPGTPATALEPLLDLVDQVLIMTVNPGFGGQAFIPECLEKVATVAKW
FT                   RDEKGLSFDIEVDGGVDNKTIRACYEAGANVFVAGSYLFKASDLVSQVQTLRTALNV"
FT   misc_feature    221953..222555
FT                   /gene="rpe"
FT                   /locus_tag="SpyM50203"
FT                   /note="HMMPfam hit to PF00834, Ribulose-phosphate 3
FT                   epimerase family, score 3.2e-109"
FT                   /inference="protein motif:HMMPfam:PF00834"
FT   misc_feature    222037..222081
FT                   /note="PS01085 Ribulose-phosphate 3-epimerase family
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS01085"
FT   misc_feature    222343..222411
FT                   /note="PS01086 Ribulose-phosphate 3-epimerase family
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS01086"
FT   CDS             222596..223228
FT                   /transl_table=11
FT                   /gene="thiN"
FT                   /locus_tag="SpyM50204"
FT                   /product="putative thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="GOA:A2RCH5"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH5"
FT                   /protein_id="CAM29547.1"
FT                   /translation="MSKVALFAGGDLSYISRDFDYFVGIDRGSLFLLENGLPLNMAVGD
FT                   FDSVSQKAFTDIKEKAELFITAHPEKSDTDTELALKEVFARFPEAEVTIFGAFGGRMDH
FT                   LLSNIFLPSDPGIAPFMAQIALRDQQNMITYRPAGQHLIHQEEGMTYVAFMAEGEADLT
FT                   ITGAKFELTQDNFFKKKIYSSNAFIHQPITVSLPSGYLIIIQSKDWS"
FT   misc_feature    222617..222982
FT                   /gene="thiN"
FT                   /locus_tag="SpyM50204"
FT                   /note="HMMPfam hit to PF04263, Thiamin
FT                   pyrophosphokinase,catalytic d, score 2.4e-48"
FT                   /inference="protein motif:HMMPfam:PF04263"
FT   misc_feature    223010..223204
FT                   /gene="thiN"
FT                   /locus_tag="SpyM50204"
FT                   /note="HMMPfam hit to PF04265, Thiamin
FT                   pyrophosphokinase,vitamin B1, score 4.1e-27"
FT                   /inference="protein motif:HMMPfam:PF04265"
FT   CDS             223230..224501
FT                   /transl_table=11
FT                   /locus_tag="SpyM50205"
FT                   /product="RmuC family protein"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH6"
FT                   /protein_id="CAM29548.1"
FT                   /translation="MDLILFLLVLVLLGLGAYLLFKVNGLQHQLAQTLEGNADNLSDQM
FT                   TYQLDTANKQQLLELTQLMNRQQADLYQQLTDIRDVLHRSLSDSRDRSDKRLEEINQQV
FT                   NQSLKNMQESNEKRLEEMRQIVEEKLEETLKNRLHASFDSVSKQLESVNKGLGEMRSVA
FT                   QDVGTLNKVLSNTKTRGILGELQLGQIIEDIMTSSQYEREFVTVSGSSERVEYAIKLPG
FT                   NGQGGYIYLPIDSKFPLEDYYRLEDAYEVGDKLAIEASRKALLAAIKRFAKDIHKKYLN
FT                   PPETTNFGVMFLPTEGLYSEVVRNAAFFDSLRREENIVVAGPSTLSALLNSLSVGFKTL
FT                   NIQKNADDISKILGNVKLEFDKFGGLLAKAQKQMNTANNTLDQLISTRTNAIVRALNTV
FT                   ETYQDQATKSLLNMPLLEEENNEN"
FT   sig_peptide     223230..223337
FT                   /locus_tag="SpyM50205"
FT                   /note="Signal peptide predicted for SpyM50205 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.665) with cleavage
FT                   site probability 0.301 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    223236..223292
FT                   /locus_tag="SpyM50205"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50205 by TMHMM2.0 at aa 3-21"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    223575..224477
FT                   /locus_tag="SpyM50205"
FT                   /note="HMMPfam hit to PF02646, RmuC family, score 4.9e-141"
FT                   /inference="protein motif:HMMPfam:PF02646"
FT   CDS             224491..225429
FT                   /transl_table=11
FT                   /locus_tag="SpyM50206"
FT                   /product="putative 3'-5' exoribonuclease"
FT                   /db_xref="GOA:A2RCH7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH7"
FT                   /protein_id="CAM29549.1"
FT                   /translation="MKINQMKKDQLFEGFYLIKSAEVRKTRAGKDFISLTFQDDTGEIS
FT                   GNLWDAQPYNVEEFTAGKVVFMKGRREVYNGTPQVNQITLRNVRPGEPNDPKDFKEKAP
FT                   VSVTEVRDYLEQMLFKIENATWQRIVRALYRKYDKEFYTYPAAKTNHHAFESGLAYHTA
FT                   TMVRLADSIGDIYPDLNKSLLFAGIMLHDLAKVIELTGPDNTEYTVRGNLIGHISLINE
FT                   EITKVISELQIDDTKEEVIVLRHVILSHHGQLEYGSPVRPRIMEAEIIHMIDNIDANMM
FT                   MMTTALSRVSEGEMTSRIFAMDNRSFYKPNY"
FT   misc_feature    224536..224748
FT                   /locus_tag="SpyM50206"
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 0.0011"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    224962..225327
FT                   /locus_tag="SpyM50206"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 1.6e-06"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS             225696..226535
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="SpyM50207"
FT                   /product="putative pur operon repressor"
FT                   /db_xref="GOA:A2RCH8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH8"
FT                   /protein_id="CAM29550.1"
FT                   /translation="MKLRRSERMVVISNYLINNPYKLTSLNTFATKYEAAKSSISEDIA
FT                   IIKKAFEEANIGDIDTLTGASGGVIFTPSISETEARTIVEDLCQRLSESDRILPGGYIY
FT                   LSDLLSTPKILQNIGRIIANAFKGEKIDAVMTVATKGVPLANAVANILSVPFVIVRRDL
FT                   KITEGSTVSVNYASASSDRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTITGMISLLTEF
FT                   DSTLVGVAVFAENAQSEREQMTFKSLLKVSEIDVKNNNVVVEVGNIFDKWKKEREWT"
FT   misc_feature    226005..226421
FT                   /gene="purR"
FT                   /locus_tag="SpyM50207"
FT                   /note="HMMPfam hit to PF00156, Phosphoribosyl transferase
FT                   domain, score 9.1e-18"
FT                   /inference="protein motif:HMMPfam:PF00156"
FT   CDS             226526..229147
FT                   /transl_table=11
FT                   /locus_tag="SpyM50208"
FT                   /product="putative membrane anchored protein"
FT                   /db_xref="InterPro:IPR027607"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCH9"
FT                   /protein_id="CAM29551.1"
FT                   /translation="MDLEQTKPNQVKQKIALTSTIALLSASVGVSHQVKADDRASGETK
FT                   ASNTHDDSLPKPETIQEAKATIDAVEKTLSQQKAELTELATALTKTTAEINHLKEQQDN
FT                   EQKALTSAQEIYTNTLASSEETLLAQGAEHQRELTATETELHNAQVDQHSKETALSEQK
FT                   ASISAETTRAQDLVEQVKTSEQNIAKLNAMISNPDAITKAAQTANDNTKALSSELEKAK
FT                   ADLENQKAKVKKQLTEELAAQKAALAEKEAELSRLKSSAPSTQDSIVGNNTMKAPQGYP
FT                   LEELKKLEASGYIGSASYNNYYKEHADQIIAKASPGNQLNQYQDIPADRNRFVDPDNLT
FT                   PEVQNELAQFAAHMINSVRRQLGLPPVTVTAGSQEFARLLSTSYKKTHGNTRPSFVYGQ
FT                   PGVSGHYGVGPHDKTIIEDSAGASGLIRNDDNMYENIGAFNDVHTVNGIKRGIYDSIKY
FT                   MLFTDHLHGNTYGHAINFLRVDKRNPNAPVYLGFSTSNVGSLNEHFVMFPESNIANHQR
FT                   FNKTPIKAVGSTKDYAQRVGTVSDTIAAIKGKVSSLENRLSAIHQEADIMAAQAKVSQL
FT                   EGKLASTLKQSDSLNLQVRQLNDTKGSLRTELLAAKAKQAQLEATRDQSLAKLASLKAA
FT                   LHQTEALAEQAAARVTALVAKKAHLQYLRDFKLNPNRLQVIRERIDNTKQDLAKTTSSL
FT                   LNAQEALAVLQAKQSSLEATIATTEHQLTLLKTLANEKEYRHLDEDIATVPDLQVAPPL
FT                   TGVKPLSYSKIDTTPLVQEMVKETKQLLEASARLAAENTSLVAEALVGQTSEMVASNAI
FT                   VSKITSSITQPSSKTSYGSGSSTTSNLISDVDESTQRALKAGVVMLAAVGLTGFRFRKE
FT                   SR"
FT   sig_peptide     226526..226633
FT                   /locus_tag="SpyM50208"
FT                   /note="Signal peptide predicted for SpyM50208 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.972) with cleavage
FT                   site probability 0.936 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             229355..229768
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="SpyM50209"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="GOA:A2RCI0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /protein_id="CAM29552.1"
FT                   /translation="MPTINQLVRKPRKSKIEKSDSPALNIGYNSHKKVQTKMAAPQKRG
FT                   VATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGALDTAGVADRKQGRSKYGAKRPKG"
FT   misc_feature    229361..229762
FT                   /gene="rpsL"
FT                   /locus_tag="SpyM50209"
FT                   /note="HMMPfam hit to PF00164, Ribosomal protein S12,score
FT                   1.1e-69"
FT                   /inference="protein motif:HMMPfam:PF00164"
FT   misc_feature    229520..229543
FT                   /note="PS00055 Ribosomal protein S12 signature"
FT                   /inference="protein motif:Prosite:PS00055"
FT   CDS             229789..230259
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="SpyM50210"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="GOA:A2RCI1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /protein_id="CAM29553.1"
FT                   /translation="MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYD
FT                   AFSAIKEATGNDALEVFETAMDNIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWL
FT                   VNASRARGEHTMKDRLAKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW"
FT   misc_feature    229789..230235
FT                   /gene="rpsG"
FT                   /locus_tag="SpyM50210"
FT                   /note="HMMPfam hit to PF00177, Ribosomal protein
FT                   S7p/S5e,score 1.5e-78"
FT                   /inference="protein motif:HMMPfam:PF00177"
FT   misc_feature    229846..229926
FT                   /note="PS00052 Ribosomal protein S7 signature"
FT                   /inference="protein motif:Prosite:PS00052"
FT   CDS             230744..232822
FT                   /transl_table=11
FT                   /gene="fus"
FT                   /locus_tag="SpyM50211"
FT                   /product="elongation factor G (EF-G)"
FT                   /db_xref="GOA:A2RCI2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29554.1"
FT                   /translation="MAREFSLAKTRNIGIMAHVDAGKTTTTERILYYTGKIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWDGHRVNIIDTPGHVDFTIEVQRSLRVLDGAVT
FT                   VLDSQSGVEPQTETVWRQATEYGVPRIVFANKMDKIGADFLYSVQTLHDRLQANAHPIQ
FT                   LPIGAEDDFRGIIDLIKMKAEIYTNDLGTDILEEDIPEEYLEQAQEYREKLIEAVAETD
FT                   EDLMMKYLEGEKITNDELIAGIRKATINVEFFPVLCGSAFKNKGVQLMLDAVIAYLPSP
FT                   LDIPAIKGVNPDTDAEEERPASDEEPFAALAFKIMTDPFVGRLTFFRVYSGVLNSGSYV
FT                   MNTSKGKRERIGRILQMHANSRQEIETVYSGDIAAAVGLKDTTTGDSLTDEKAKVILES
FT                   IEVPEPVIQLMVEPKSKADQDKMGVALQKLAEEDPTFRVETNVETGETVIAGMGELHLD
FT                   VLVDRMKREFKVEANVGAPQVSYRETFRASTQARGFFKRQSGGKGQFGDVWIEFTPNEE
FT                   GKGFEFENAIVGGVVPREFIPAVEKGLIESMANGVLAGYPMVDVKAKLYDGSYHDVDSS
FT                   ETAFKIAASLALKEAAKSAQPAILEPMMLVTITAPEDNLGDVMGHVTARRGRVDGMEAH
FT                   GNSQIVRAYVPLAEMFGYATVLRSATQGRGTFMMVFDHYEDVPKSVQEEIIKKNKGE"
FT   misc_feature    230765..231589
FT                   /gene="fus"
FT                   /locus_tag="SpyM50211"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 5.4e-112"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    230792..230815
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    230894..230941
FT                   /note="PS00301 GTP-binding elongation factors signature"
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    231707..231910
FT                   /gene="fus"
FT                   /locus_tag="SpyM50211"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 8.6e-18"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   misc_feature    232172..232531
FT                   /gene="fus"
FT                   /locus_tag="SpyM50211"
FT                   /note="HMMPfam hit to PF03764, Elongation factor G, domain
FT                   IV, score 4.5e-67"
FT                   /inference="protein motif:HMMPfam:PF03764"
FT   misc_feature    232535..232798
FT                   /gene="fus"
FT                   /locus_tag="SpyM50211"
FT                   /note="HMMPfam hit to PF00679, Elongation factor G
FT                   C-terminus, score 3e-46"
FT                   /inference="protein motif:HMMPfam:PF00679"
FT   CDS             233163..234173
FT                   /transl_table=11
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SpyM50212"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase,plasmin
FT                   receptor"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="GOA:A2RCI3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCI3"
FT                   /protein_id="CAM29555.1"
FT                   /translation="MVVKVGINGFGRIGRLAFRRIQNIEGVEVTRINDLTDPNMLAHLL
FT                   KYDTTQGRFDGTVEVKEGGFEVNGNFIKVSAERDPENIDWATDGVEIVLEATGFFAKKE
FT                   AAEKHLHANGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKA
FT                   LHDAFGIQKGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVI
FT                   PELNGKLDGAAQRVPVPTGSVTELVVTLDKNVSVDEINAAMKAASNDSFGYTEDPIVSS
FT                   DIVGVSYGSLFDATQTKVMEVDGSQLVKVVSWYDNEMSYTAQLVRTLEYFAKIAK"
FT   misc_feature    233169..233618
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SpyM50212"
FT                   /note="HMMPfam hit to PF00044, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NA, score 1.1e-83"
FT                   /inference="protein motif:HMMPfam:PF00044"
FT   misc_feature    233610..233633
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site"
FT                   /inference="protein motif:Prosite:PS00071"
FT   misc_feature    233619..234104
FT                   /gene="plr"
FT                   /gene_synonym="gapA"
FT                   /locus_tag="SpyM50212"
FT                   /note="HMMPfam hit to PF02800, Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-, score 2.6e-107"
FT                   /inference="protein motif:HMMPfam:PF02800"
FT   CDS             complement(234399..234515)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50213"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCI4"
FT                   /protein_id="CAM29556.1"
FT                   /translation="MAEKTDLSSAYRRLKSPNIKTRKRALKIIHEYKRYGKK"
FT   CDS             complement(234657..235397)
FT                   /transl_table=11
FT                   /gene="glnQ2"
FT                   /locus_tag="SpyM50214"
FT                   /product="putative glutamine ABC transporter, ATP-binding
FT                   protein 2"
FT                   /note="Similar to SpyM50615, 57.143% identity (57.377%
FT                   ungapped) in 245 aa overlap, and to SpyM50788, 51.020%
FT                   identity (51.230% ungapped) in 245 aa overlap"
FT                   /db_xref="GOA:A2RCI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCI5"
FT                   /protein_id="CAM29557.1"
FT                   /translation="MSNSIIEIKNLKKSYGSNEVLKDISLSVNKGEVISIIGSSGSGKS
FT                   TLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYREKLGMVFQSFNLFENLNVLENAIV
FT                   AQTTVLKRDRAQAEQIAKENLNAVGMTEQYWQAKPKQLSGGQKQRVAIARALSVNPEAM
FT                   LFDEPTSALDPEMVGEVLKTMQDLAKSGLTMIIVTHEMEFARDVSDRIIFMDKGLIAEE
FT                   GSPQQIFENPTQDRTKEFLQRFLK"
FT   misc_feature    complement(234747..235307)
FT                   /gene="glnQ2"
FT                   /locus_tag="SpyM50214"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.3e-58"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    complement(234930..234974)
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(235263..235286)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(235390..236958)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50215"
FT                   /product="glutamine ABC transporter, glutamine-binding
FT                   protein/permease protein"
FT                   /db_xref="GOA:A2RCI6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCI6"
FT                   /protein_id="CAM29558.1"
FT                   /translation="MKKLILSCLVALALLFGGMSRAQANQYLRVGMEAAYAPFNWTQDD
FT                   ASNGAVPIEGTSQYANGYDVQVAKKVAKAMNKELLVVKTSWTGLIPALTSGKIDMIAAG
FT                   MSPTKERRNEISFSNSYYTSQPVLVVTANGKYAEAKSLKDFSGAKVTAQQGVWHVNLLT
FT                   QLKGAKLQTPMGDFSQMRQALTSGVIDAYISERPEAMTAEAADSRLKMITLKKGFAVAE
FT                   SDAAIAVGMKKNDDRMATVNQVLEGFSQTDRMALMDDMVTKQPVEKKAEDAKASFLGQM
FT                   WAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAALGQKLFGW
FT                   LLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSEIVRGGI
FT                   FAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLNVISVVE
FT                   LYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRHIERRFDADTYTTGANQMQIA
FT                   EVSNV"
FT   misc_feature    complement(235447..236085)
FT                   /locus_tag="SpyM50215"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.6e-25"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    complement(order(235474..235542,235555..235614,
FT                   235759..235827,235870..235938,235999..236067))
FT                   /locus_tag="SpyM50215"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50215 by TMHMM2.0 at aa 298-320,341-363,378-400,449-468
FT                   and 473-495"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(235678..235764)
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   misc_feature    complement(236170..236877)
FT                   /locus_tag="SpyM50215"
FT                   /note="HMMPfam hit to PF00497, Bacterial extracellular
FT                   solute-binding p, score 8.1e-31"
FT                   /inference="protein motif:HMMPfam:PF00497"
FT   sig_peptide     complement(236887..236958)
FT                   /locus_tag="SpyM50215"
FT                   /note="Signal peptide predicted for SpyM50215 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.916 between residues 24 and 25"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             237156..239081
FT                   /transl_table=11
FT                   /locus_tag="SpyM50216"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCI7"
FT                   /protein_id="CAM29559.1"
FT                   /translation="MKKILMTLVLCFSLLGIRIKAADVDYSITNYEGQLLLSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRTGHLPAGFAIDQKPKVEVYQNGQQVPVSQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVIWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGKEPVDVST
FT                   SKKDKIVALETKISRRRTLLQLLFGKVIPLVEVGFLLWQLIQFTRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEVRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQMTPAEKRKS
FT                   NSVQGLGCLLLILNSGLLIYLAIKESGLALIYLALMVLTMCLGFYISLKLDQYKKLGIE
FT                   TPEGGVRLHQWQSFKNMIRDIDKFEDVAIEGLVVWNRVLVYATLFGYAKKVERYLKAHR
FT                   IALPEVYQAVRPGELSMVMYATTPTFVSSLSSATTSSNFSVSSGGGISGGGGFSGGGGG
FT                   GGGGAF"
FT   sig_peptide     237156..237218
FT                   /locus_tag="SpyM50216"
FT                   /note="Signal peptide predicted for SpyM50216 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.965 between residues 21 and 22"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(237876..237944,238527..238595,238605..238673)
FT                   /locus_tag="SpyM50216"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50216 by TMHMM2.0 at aa 241-263, 458-480 and 484-506"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             239147..239986
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SpyM50217"
FT                   /product="undecaprenol kinase (bacitracin resistance
FT                   protein)"
FT                   /EC_number="2.7.1.66"
FT                   /db_xref="GOA:A2RCI8"
FT                   /db_xref="InterPro:IPR003824"
FT                   /protein_id="CAM29560.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPFQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTELVRMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFVVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   misc_feature    239168..239953
FT                   /gene="bacA"
FT                   /locus_tag="SpyM50217"
FT                   /note="HMMPfam hit to PF02673, Bacitracin resistance
FT                   protein BacA, score 5.8e-132"
FT                   /inference="protein motif:HMMPfam:PF02673"
FT   misc_feature    order(239174..239242,239279..239347,239390..239458,
FT                   239477..239545,239588..239656,239675..239743,
FT                   239813..239881,239918..239971)
FT                   /gene="bacA"
FT                   /locus_tag="SpyM50217"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50217 by TMHMM2.0 at aa 10-32,
FT                   45-67,82-104,111-133,148-170, 177-199, 223-245 and 258-275"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             240132..240893
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="SpyM50218"
FT                   /product="adapter protein MecA"
FT                   /db_xref="GOA:A2RCI9"
FT                   /db_xref="InterPro:IPR008681"
FT                   /protein_id="CAM29561.1"
FT                   /translation="MEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYSVM
FT                   DELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSEINKDINLEDLAEFGDMSQMTPEDFF
FT                   KSLEQSMREKGDVKAHEKLEKIEEIMEDVVEATLANQSEAADPSTNHESEPLDYVHYVL
FT                   DFSTITEAVAFAKTIDFSIEASELYKGSNCYHMTILLDVQQQPSYFANVMYARLIEHAN
FT                   PGSKTRAYLQEHGLQLMLDGAVEQLQKIELG"
FT   misc_feature    240132..240878
FT                   /gene="mecA"
FT                   /locus_tag="SpyM50218"
FT                   /note="HMMPfam hit to PF05389, Negative regulator of
FT                   genetic competence (Me, score 3.3e-133"
FT                   /inference="protein motif:HMMPfam:PF05389"
FT   CDS             240900..242069
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM50219"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="GOA:A2RCJ0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ0"
FT                   /protein_id="CAM29562.1"
FT                   /translation="MFSFTIDYVLVLIGALLMSLFLTPLVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAICMSFLVASLGLIPIASKGAMFFGQTYFSYILPVVIGATVITLTGFLD
FT                   DLYELSPKLKMFGILIGAVIVWAFTDFKFDSFKIPFGGPLLVFGPFLTLFLTVLWIVSI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQKDFFLTLTILVLISAIAGFFPYNY
FT                   HPAMIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GQKFYEPDKMHLHHRLLSMGFTHRGAVLVVYGITMLFSLISLLLNVSSRIGGVLLMLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNLLKFIGNSDYRQAMLLKWKEKKDLKH"
FT   sig_peptide     240900..241004
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM50219"
FT                   /note="Signal peptide predicted for SpyM50219 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.986) with cleavage
FT                   site probability 0.836 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(240927..240992,241053..241112,241140..241208,
FT                   241242..241286,241329..241388,241422..241490,
FT                   241500..241559,241578..241646,241659..241727,
FT                   241815..241883,241896..241964)
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM50219"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50219 by TMHMM2.0 at aa 10-31,
FT                   52-71,81-103,115-129,144-163, 175-197, 201-220,
FT                   227-249,254-276,306-328 and 333-355"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    241158..241661
FT                   /gene="rgpG"
FT                   /locus_tag="SpyM50219"
FT                   /note="HMMPfam hit to PF00953, Glycosyl transferase, score
FT                   2.2e-42"
FT                   /inference="protein motif:HMMPfam:PF00953"
FT   CDS             242191..242961
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="SpyM50220"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:A2RCJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ1"
FT                   /protein_id="CAM29563.1"
FT                   /translation="MSILEINNLHVSIEGKEILKGVNLTLKTGEVAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGQILLDGVNILDLEVDERARLGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDEKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDAALATRLEKEGYAGIAQDLGIEYKEES"
FT   misc_feature    242275..242856
FT                   /gene="sufC"
FT                   /locus_tag="SpyM50220"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.5e-31"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    242296..242319
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    242626..242670
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             243056..244318
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="SpyM50221"
FT                   /product="conserved hypothetical protein"
FT                   /note="CDS is involved in iron metabolism, and has a role
FT                   in oxidative stress resistance"
FT                   /db_xref="GOA:A2RCJ2"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ2"
FT                   /protein_id="CAM29564.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLAALEAIPELELPTIERVKFHR
FT                   WNLGDGTLTENESLASVPDFIAIGDNPKLVQVGTQTVLEQLPMALIDKGVVFSDFYTAL
FT                   EEIPEVIEAHFGQALAFDEDKLAAYHTAYFNSAAVLYVPDHLEITTPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNATQKISANISVEVIAQAGSQIKFSAIDRLGP
FT                   SVTTYISRRGRLEKDVNIDWALAVMNEGNVIADFDSDLIGQGSQADLKVVAASSGRQVQ
FT                   GIDTRVTNYGQRTVGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRVLMLSDQA
FT                   RADANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQETAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKVLDEKLLNR"
FT   misc_feature    243530..244231
FT                   /gene="sufD"
FT                   /locus_tag="SpyM50221"
FT                   /note="HMMPfam hit to PF01458, Uncharacterized protein
FT                   family (UPF0051), score 2.1e-44"
FT                   /inference="protein motif:HMMPfam:PF01458"
FT   CDS             244349..245575
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /gene_synonym="sufS"
FT                   /locus_tag="SpyM50222"
FT                   /product="putative cysteine desulfurase"
FT                   /EC_number="4.4.1.16"
FT                   /db_xref="GOA:A2RCJ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ3"
FT                   /protein_id="CAM29565.1"
FT                   /translation="MLDAKDIKQDFQILNQQVNDEPLVYLDNAATTQKPALVLEALQSY
FT                   YQEDNANVHRGVHTLAERATHKYEASRQQVADFIHAKSSKEVLFTRGTTTSLNWVARFA
FT                   EQVLTPEDEVLISIMEHHANIIPWQQACQKTGARLVYVYLKDGQLDMDDLTNKLTTKTR
FT                   FVSLVHVSNVLGCINPIKEIAKLAHAKGAYLVVDGAQSVPHLAIDVQDLDCDFFAFSAH
FT                   KMLGPTGLGVLYGKEELLNQVEPLEFGGEMIDFVYEQEATWKELPWKFEAGTPHIAGAI
FT                   GLSAAISYLQRLGMADIHAHEAELIAYVLPKLEAIEGLTIYGPSQSSARSGLISFNLDD
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLGVPATVRASFYIYNTKADCDRLVEAILK
FT                   AKEFFNGTL"
FT   misc_feature    244448..245527
FT                   /gene="csdB"
FT                   /gene_synonym="sufS"
FT                   /locus_tag="SpyM50222"
FT                   /note="HMMPfam hit to PF00266, Aminotransferase
FT                   class-V,score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00266"
FT   misc_feature    244988..245047
FT                   /note="PS00595 Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site"
FT                   /inference="protein motif:Prosite:PS00595"
FT   CDS             245562..246041
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="SpyM50223"
FT                   /product="NifU-like protein"
FT                   /note="CDS is involved in iron metabolism, and had a role
FT                   in oxidative stress resistance"
FT                   /db_xref="GOA:A2RCJ4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ4"
FT                   /protein_id="CAM29566.1"
FT                   /translation="MALSKLNHLYMAVVADHSKRPHHHGQLDGVEAVQLNNPTCGDVIS
FT                   LTVKFDEDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKEEALALADIFSEMVQGQENP
FT                   AQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIKRSANAQHLTDQNVKEGKNV"
FT   misc_feature    245586..245945
FT                   /gene="iscU"
FT                   /locus_tag="SpyM50223"
FT                   /note="HMMPfam hit to PF01592, NifU-like N terminal domain,
FT                   score 9.2e-29"
FT                   /inference="protein motif:HMMPfam:PF01592"
FT   CDS             246034..247452
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="SpyM50224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RCJ5"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ5"
FT                   /protein_id="CAM29567.1"
FT                   /translation="MSDINEKVEPKPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPE
FT                   KIKETFDRIGIPEAERAYLAGASAQYESEVVYHNMKGEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALTDATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKSGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   misc_feature    246664..247362
FT                   /gene="sufB"
FT                   /locus_tag="SpyM50224"
FT                   /note="HMMPfam hit to PF01458, Uncharacterized protein
FT                   family (UPF0051), score 4.2e-118"
FT                   /inference="protein motif:HMMPfam:PF01458"
FT   CDS             complement(247604..248785)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50225"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="GOA:A2RCJ6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ6"
FT                   /protein_id="CAM29568.1"
FT                   /translation="MTKRIILTIFTFICFSMMPLVHAEDVIDITRQAGYTVSEVNRPKS
FT                   SIVVDANSSDILWQDNIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAI
FT                   ANIYEISNNNIIAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   QLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISF
FT                   TNKSVVHTMVGTPYEEEFHTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETS
FT                   PKQQHFKATKKQSYLERVEDFMNHNHTFLLICLAIFIITILLLSLVVFAMGRQ"
FT   misc_feature    complement(247619..247687)
FT                   /locus_tag="SpyM50225"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50225 by TMHMM2.0 at aa 367-389"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(247910..248680)
FT                   /locus_tag="SpyM50225"
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 3.7e-39"
FT                   /inference="protein motif:HMMPfam:PF00768"
FT   sig_peptide     complement(248717..248785)
FT                   /locus_tag="SpyM50225"
FT                   /note="Signal peptide predicted for SpyM50225 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.999 between residues 23 and 24"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(248953..250185)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50226"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="GOA:A2RCJ7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ7"
FT                   /protein_id="CAM29569.1"
FT                   /translation="MIKRLISLVVIALFFAASTVSGEEYSVTAKHAIAVDLESGKVLYE
FT                   KDAKEVVPVASVSKLLTTYLVYKEVSKGKLNWDSPVTISNYPYELTTNYTISNVPLDKR
FT                   KYTVKELLSALVVNNANSPAIALAEKIGGTEPKFVDKMKKQLRQWGISDAKVVNSTGLT
FT                   NHFLGANTYPNTEPDDENCFCATDLAIIARHLLLEFPEVLKLSSKSSTIFDGQTIYSYN
FT                   YMLKGMPCYREGVDGLFVGYSKKAGASFVATSVENQMRVITVVLNADQSHEDDLAIFKT
FT                   TNQLLQYLLINFQKVQLIENNKPVKTLSVLDSPEKTVKLVAQNSLFFIKPIHTKTKNTV
FT                   HITKKSSTMIAPLSKGQVLGRATLQDKHLIGQGYLDTPPSINLILQKNISKSFFLKVWW
FT                   NRFVRYVNTSL"
FT   misc_feature    complement(249325..250158)
FT                   /locus_tag="SpyM50226"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   0.0008"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   misc_feature    complement(249376..250137)
FT                   /locus_tag="SpyM50226"
FT                   /note="HMMPfam hit to PF00768, D-alanyl-D-alanine
FT                   carboxypeptidase, score 2.3e-141"
FT                   /inference="protein motif:HMMPfam:PF00768"
FT   sig_peptide     complement(250120..250185)
FT                   /locus_tag="SpyM50226"
FT                   /note="Signal peptide predicted for SpyM50226 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.847 between residues 22 and 23"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             250507..252486
FT                   /transl_table=11
FT                   /locus_tag="SpyM50227"
FT                   /product="putative extracellular oligopeptide-binding
FT                   protein"
FT                   /db_xref="GOA:A2RCJ8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ8"
FT                   /protein_id="CAM29570.1"
FT                   /translation="MTFMKKSKWLAAVSVAILSVSALAACGNKNASGGSEATKTYKYVF
FT                   VNDPKSLDYILTNGGGTTDVITQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLR
FT                   DGVSWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEV
FT                   GVKALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAY
FT                   FLSAFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYP
FT                   NDPTYKSAKKNYADNITYGMLSGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDF
FT                   RQAIQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGESDFGSEVEKEMAKLGDEW
FT                   KDVNLADAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFK
FT                   QSVEASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDI
FT                   MSPVGGGSVIQKLGIKAGQNKDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAY
FT                   LTDNAVDIPVVALGGTPRVTKAVPFSGGFSWAGSKGPLAYKGMKLQDKPVTAKQYEKAK
FT                   EKWMKAKAKSNAKYAEKLADHVEK"
FT   sig_peptide     250507..250608
FT                   /locus_tag="SpyM50227"
FT                   /note="Signal peptide predicted for SpyM50227 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.516 between residues 34 and 35"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    250552..250584
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    250747..252084
FT                   /locus_tag="SpyM50227"
FT                   /note="HMMPfam hit to PF00496, Bacterial extracellular
FT                   solute-binding prot, score 1.2e-45"
FT                   /inference="protein motif:HMMPfam:PF00496"
FT   misc_feature    250765..250833
FT                   /note="PS01040 Bacterial extracellular solute-binding
FT                   proteins, family 5 signature"
FT                   /inference="protein motif:Prosite:PS01040"
FT   CDS             252551..254053
FT                   /transl_table=11
FT                   /locus_tag="SpyM50228"
FT                   /product="putative oligopeptide transporter permease
FT                   protein"
FT                   /db_xref="GOA:A2RCJ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCJ9"
FT                   /protein_id="CAM29571.1"
FT                   /translation="MKKYILNRIMRSLVSVVLVTALTYTIVYTLVPTSLIFKQDPNYNK
FT                   MTTTPDKKVAYENLTFQRMGYVNYFSSKELKDNASKVDSSVTTEATSANKAIYEKYIDS
FT                   LGNGWQLKRFPTSKQFYAIRNIPIYERVWNFFSNLVVIDHPWKIQDKDNPKLARYIRLE
FT                   KDKSVGWSLVGSGTKHKYLLYTNGKFPYLHQNFVTLNLGTSYPTYSNIPVLQVISQGQG
FT                   RTALQDVTFPSGVTKKSSVDIYSRSYKNPKSLDDITKVNYGKGDSYTKTINNYVDPSMI
FT                   HNSFVIGFFGVMFSYIVGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYVVRFL
FT                   GGMVGLPDSFPMLGASDPKSYILPALILGILNIPTTVIWFRRYLVDLQASDWVRFARSK
FT                   GLSESEIYRGHLFKNAMVPIVSGVPASIILAIGGATLTETVFAFPGMGKMLIDSIKSAN
FT                   NSMIVGLTFIFTVLSIVSLLLGDIVMTLVDPRIKLSTKKGGK"
FT   sig_peptide     252551..252664
FT                   /locus_tag="SpyM50228"
FT                   /note="Signal peptide predicted for SpyM50228 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.990) with cleavage
FT                   site probability 0.633 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(252587..252655,253403..253471,253520..253588,
FT                   253631..253690,253805..253873,253931..253999)
FT                   /locus_tag="SpyM50228"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50228 by TMHMM2.0 at aa 13-35,285-307,324-346,361-380,
FT                   419-441 and 461-483"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    253391..254029
FT                   /locus_tag="SpyM50228"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1.4e-48"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS             254053..254979
FT                   /transl_table=11
FT                   /locus_tag="SpyM50229"
FT                   /product="putative oligopeptide transporter permease
FT                   protein"
FT                   /db_xref="GOA:A2RCK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK0"
FT                   /protein_id="CAM29572.1"
FT                   /translation="MESIDKSKFRFVERDSEASEVIDTPAYSYWKSVFRQFFSKKSTVF
FT                   MLVILVTVLMMSFIYPMFANYDFNDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINITIGVVLGAIWGVSKAFDKVMIEIYNIISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAVKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   misc_feature    order(254176..254244,254380..254448,254485..254553,
FT                   254563..254631,254692..254751,254779..254847,
FT                   254866..254934)
FT                   /locus_tag="SpyM50229"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50229 by TMHMM2.0 at aa 42-64,110-132,145-167,171-193,
FT                   214-233, 243-265 and 272-294"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    254371..254976
FT                   /locus_tag="SpyM50229"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 1e-36"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS             254988..256058
FT                   /transl_table=11
FT                   /locus_tag="SpyM50230"
FT                   /product="putative oligopeptide transporter ATP-binding
FT                   protein"
FT                   /db_xref="GOA:A2RCK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010066"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK1"
FT                   /protein_id="CAM29573.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELVEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTDLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHAKAKEMALDYMNKVGIPNAKKRFEDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIVELLKSLQREYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLADESGELYAIPGTPP
FT                   SLYSPIIGDAFALRSEYAMVLDFEKAPPAINVSETHWAKTWLLHPEAPKVQKPEVIQDL
FT                   HQKILRKMSQQEEGNV"
FT   misc_feature    255099..255695
FT                   /locus_tag="SpyM50230"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.5e-62"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    255120..255143
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    255465..255509
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             256051..256974
FT                   /transl_table=11
FT                   /locus_tag="SpyM50231"
FT                   /product="putative oligopeptide transporter ATP-binding
FT                   protein"
FT                   /db_xref="GOA:A2RCK2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK2"
FT                   /protein_id="CAM29574.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGQILYDGKVINGRKSKSEANELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTQSLLSAVPIPDPILERQKELVVYHPDQHDYTLDK
FT                   PSMVEIKPNHFVWANQAEIEKYQKEL"
FT   misc_feature    256153..256731
FT                   /locus_tag="SpyM50231"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   4.9e-54"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    256174..256197
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    256501..256545
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             complement(join(257122..257388,257396..257548))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50231A"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae (serotype V) IS861
FT                   transposase OrfA UniProt:Q8CM63 (EMBL:AE014240) (178 aa)
FT                   fasta scores: E()=7.3e-12, 46.565% id in 131 aa"
FT   misc_feature    complement(order(257377..257388,257396..257470))
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             complement(join(257536..257988,257992..258285))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50232"
FT                   /note="Similar to Lactococcus lactis (subsp. lactis)
FT                   (Streptococcus lactis) transposase for insertion sequence
FT                   element IS904 UniProt:T904_LACLA (EMBL:AE006251) (253 aa)
FT                   fasta scores: E()=4.8e-53, 64.593% id in 209 aa. CDS
FT                   contains a nonsense mutation (opal) after codon 98"
FT                   /db_xref="PSEUDO:CAM29576.1"
FT   misc_feature    complement(257602..257961)
FT                   /locus_tag="SpyM50232"
FT                   /note="HMMPfam hit to PF00665, Integrase core domain,score
FT                   1.7e-22"
FT                   /inference="protein motif:HMMPfam:PF00665"
FT   CDS             complement(258318..258611)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50235"
FT                   /product="putative transposase"
FT                   /note="Similar to Shigella dysenteriae transposase InsN for
FT                   insertion sequence element IS911 UniProt:INSN_SHIDY
FT                   (EMBL:SDIS911) (112 aa) fasta scores: E()=0.19, 21.053% id
FT                   in 95 aa"
FT                   /db_xref="GOA:A2RCK4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK4"
FT                   /protein_id="CAM29577.1"
FT                   /translation="MPRKTFDKAFKLSAVKFILEEEQPVKMVSSTLKIHPNSLYRWIQE
FT                   YEKYGESAFPGHGSALRHAQFEIKKLEKEHKLLQEELALLKKFQVFLKPDRK"
FT   misc_feature    complement(258357..258605)
FT                   /locus_tag="SpyM50235"
FT                   /note="HMMPfam hit to PF01527, Transposase, score 3.6e-19"
FT                   /inference="protein motif:HMMPfam:PF01527"
FT   misc_feature    complement(258480..258545)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1008.000, SD 2.62 at aa 23-44, sequence
FT                   QPVKMVSSTLKIHPNSLYRWIQ"
FT   rRNA            259014..260520
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            260607..260679
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:260640..260642,aa:Ala)"
FT   rRNA            260978..263878
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            263966..264081
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            264087..264160
FT                   /gene="tRNA-Asn (GTT)"
FT                   /product="transfer RNA-Asn (GTT)"
FT                   /anticodon="(pos:264121..264123,aa:Asn)"
FT   tRNA            264240..264313
FT                   /gene="tRNA-Arg (ACG)"
FT                   /product="transfer RNA-Arg (ACG)"
FT                   /anticodon="(pos:264274..264276,aa:Arg)"
FT   CDS             264309..264890
FT                   /transl_table=11
FT                   /gene="comX1"
FT                   /locus_tag="SpyM50236"
FT                   /product="putative competence-specific global transcription
FT                   modulator"
FT                   /note="Possible alternate translational start sites.
FT                   Identical to SpyM51595, 100.000% identity (100.000%
FT                   ungapped) in 193 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK5"
FT                   /protein_id="CAM29578.1"
FT                   /translation="MHNEKSNRTLVSCCFFVVLFILGIVKKKRRLKMSIETRAAFEKVK
FT                   PIILKLKRHYYIQLWDRDDWLQEGHIILLQLLERYPELIEEEERLYRYFKTKFSSYLKD
FT                   LLRRQESQKRQFHKLAYEEIGEVAHAIPSRGLWLDDYVAYQEVIASLENQLNSQERMQF
FT                   QALIRGERFKGRRALLRKISPYFKEFAQQL"
FT   CDS             265077..265826
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SpyM50237"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="GOA:A2RCK6"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /protein_id="CAM29579.1"
FT                   /translation="MVRYKATISYDGTLFSGFQRQRHLRTVQEEIEKTLYKLNNGTKII
FT                   IHGAGRTDAGVHAYGQVIHFDLPQEQEVEKLRFALDTQTPEDIDVVNIEKVADDFHCRY
FT                   QKHLKTYEFLVDNGRPKNPMMRHYTTHYPYTLNIKLMQEAINGLVGTHDFTGFTAAGTS
FT                   VQNKVRTITKATVSRDEKTDFLVFTFSGNGFLYKQVRNMVGTLLKIGNGQMPVEQVKVI
FT                   LSSKNRQLAGPTISGNGLYLKEICYEN"
FT   misc_feature    265092..265391
FT                   /gene="truA"
FT                   /locus_tag="SpyM50237"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 7.3e-41"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   misc_feature    265506..265820
FT                   /gene="truA"
FT                   /locus_tag="SpyM50237"
FT                   /note="HMMPfam hit to PF01416, tRNA pseudouridine synthase,
FT                   score 6.1e-33"
FT                   /inference="protein motif:HMMPfam:PF01416"
FT   CDS             265816..266580
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="SpyM50238"
FT                   /product="putative phosphomethylpyrimidine kinase"
FT                   /db_xref="GOA:A2RCK7"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK7"
FT                   /protein_id="CAM29580.1"
FT                   /translation="MKTDYIVTISGNDILSGGGLYTDLATYIRYDLQAFVAVTCLTTRS
FT                   EEGFSLFPVAKEIFRDQLNSFTNAPISAIKIGLLPNAEMCEIVLDFIKGHLGIPVVLDP
FT                   VLACKEIDDVKIVPLRQEILQLLPYVTVVTPNLVEAQLLSQKEIVSLKDMQEAAKYFYQ
FT                   LGAKQVVIKGGNRFSQKKAIDLFYDGKEIVTLECPVLEKNNIGAGCTFASSIASQLVKK
FT                   KTPLEAVKNSKELVYQAILQSDRYGVKQSYAK"
FT   CDS             266570..267040
FT                   /transl_table=11
FT                   /locus_tag="SpyM50239"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RCK8"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCK8"
FT                   /protein_id="CAM29581.1"
FT                   /translation="MQNSKIRQMSLTGILTALVVVLGRFVMLPTPTGFLTLLDAGIYAV
FT                   SFSFGSAQGAIVGGLSGFLIDLVAGYPQWMFHSLIAHSVQGYFAGWRGRKRWFGVVIGS
FT                   FIMIFWYFLGSLMLGYGLSGSLAGIWGNVMQNTLGLFVGFIIFKAILRKKKR"
FT   sig_peptide     266570..266719
FT                   /locus_tag="SpyM50239"
FT                   /note="Signal peptide predicted for SpyM50239 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.995) with cleavage
FT                   site probability 0.289 between residues 50 and 51"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(266594..266653,266696..266764,266858..266926,
FT                   266954..267022)
FT                   /locus_tag="SpyM50239"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50239 by TMHMM2.0 at aa 9-28, 43-65, 97-119 and
FT                   129-151"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    266921..267013
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00107"
FT   CDS             267054..267614
FT                   /transl_table=11
FT                   /locus_tag="SpyM50240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006340"
FT                   /protein_id="CAM29582.1"
FT                   /translation="MLNNLEKQTREIVIDVVERSAIQPGNLFVLGLSSSEILGSRIGKQ
FT                   SSLEVGQIVVEVVLDELNKRGVHLAVQGCEHVNRALVVERHVAESKQLEIVNVVPNLHA
FT                   GGSAQMAAFQLMSDPVEVEEVIAHAGLDIGDTAIGMHIKRVQIPLIPCQRELGGAHVTA
FT                   LASRPKLIGGARADYNMDIIRKS"
FT   misc_feature    267072..267587
FT                   /locus_tag="SpyM50240"
FT                   /note="HMMPfam hit to PF04260, Protein of unknown function
FT                   (DUF436), score 1.2e-127"
FT                   /inference="protein motif:HMMPfam:PF04260"
FT   CDS             complement(267679..268524)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50241"
FT                   /product="mechanosensitive ion channel protein"
FT                   /db_xref="GOA:A2RCL0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL0"
FT                   /protein_id="CAM29583.1"
FT                   /translation="MTFILHYLEQSHIENIGLTIFKKLVSLIILLLFFAILKRVTNYLF
FT                   EKTINKSFAYSRQSEARKKTLSKLTHNILNYLLYFLLIYWILSLFGIPVSSLLAGAGIA
FT                   GVAIGLGAQGFLSDVVNGFFILFENQFEVGDNVTISDIEGSVFGVGIRTTQIRGFDGTL
FT                   HFIPNRSITVVSNKSRGNMRALIEIPLYSTVNLSQVTRIIDEVNQKELPNHPQIVGKPN
FT                   ILGPQNNSNGQFTFRIAIFTENGEQFKIYHTFYRLYQEALLKEGIQLPTAISYSITSKS
FT                   "
FT   misc_feature    complement(267715..268311)
FT                   /locus_tag="SpyM50241"
FT                   /note="HMMPfam hit to PF00924, Mechanosensitive ion
FT                   channel, score 3.3e-52"
FT                   /inference="protein motif:HMMPfam:PF00924"
FT   misc_feature    complement(order(268147..268215,268243..268311,
FT                   268414..268482))
FT                   /locus_tag="SpyM50241"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50241 by TMHMM2.0 at aa 15-37, 72-94 and 104-126"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             268845..270128
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="SpyM50242"
FT                   /product="trigger factor (prolyl isomerase)"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="GOA:A2RCL1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /protein_id="CAM29584.1"
FT                   /translation="MSTSFENKATNRGVITFTISQDKIKPALDKAFNKIKKDLNAPGFR
FT                   KGHMPRPVFNQKFGEEVLYEDALNIVLPEAYEAAVTELGLDVVAQPKIDVVSMEKGKEW
FT                   TLSAEVVTKPEVKLGDYKNLVVEVDASKEVSDEDVDAKIERERQNLAELIIKDGEAAQG
FT                   DTVVIDFVGSVDGVEFDGGKGDNFSLELGSGQFIPGFEDQLVGAKAGDEVEVNVTFPES
FT                   YQAEDLAGKAAKFMTTIHEVKTKEVPELDDELAKDIDEDVDTLEDLKVKYRKELEAAQE
FT                   TAYDDAVEGAAIELAVANAEIVDLPEEMIHEEVNRSVNEFMGNMQRQGISPEMYFQLTG
FT                   TTQEDLHNQYSAEADKRVKTNLVIEAIAKAEGFEATDSEIEQEINDLATEYNMPADQVR
FT                   SLLSADMLKHDIAMKKAVEVITSTASVK"
FT   misc_feature    268845..269303
FT                   /gene="tig"
FT                   /locus_tag="SpyM50242"
FT                   /note="HMMPfam hit to PF05697, Bacterial trigger factor
FT                   protein (TF), score 3.1e-64"
FT                   /inference="protein motif:HMMPfam:PF05697"
FT   misc_feature    269310..269564
FT                   /gene="tig"
FT                   /locus_tag="SpyM50242"
FT                   /note="HMMPfam hit to PF00254, FKBP-type peptidyl-prolyl
FT                   cis-trans isomera, score 8.5e-26"
FT                   /inference="protein motif:HMMPfam:PF00254"
FT   misc_feature    269565..270095
FT                   /gene="tig"
FT                   /locus_tag="SpyM50242"
FT                   /note="HMMPfam hit to PF05698, Bacterial trigger factor
FT                   protein (TF) C-ter, score 2.7e-69"
FT                   /inference="protein motif:HMMPfam:PF05698"
FT   CDS             270345..270920
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SpyM50243"
FT                   /product="putative DNA-directed RNA polymerase, delta
FT                   subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="GOA:A2RCL2"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /protein_id="CAM29585.1"
FT                   /translation="MKLDVFAGQEKSELSMIEVARAILEERGRDNEMYFSDLVNEIQNY
FT                   LGKSDAGIRHALPFFYTDLNTDGSFIPLGENKWGLRSWYAIDEIDEEIITLEEDEDGAQ
FT                   KRKKKRVNAFMDGDEDAIDYRDDDPEDEDFTEESAEVEYDEEDPDDEKSEVESYDSELN
FT                   EIIPEDDFEEVDINEEDEEDEEDEEPVL"
FT   misc_feature    270345..270914
FT                   /gene="rpoE"
FT                   /locus_tag="SpyM50243"
FT                   /note="HMMPfam hit to PF05066, DNA-directed RNA polymerase
FT                   delta subun, score 1.8e-113"
FT                   /inference="protein motif:HMMPfam:PF05066"
FT   CDS             271177..272781
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SpyM50244"
FT                   /product="putative CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="GOA:A2RCL3"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL3"
FT                   /protein_id="CAM29586.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIK
FT                   NKLAQFCDVNSEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNAPQADMTEWSAMV
FT                   DKVMNLRKTTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAA
FT                   DLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNME
FT                   GANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPGSKAAMAYNNQEVVQR
FT                   RHRHRYEFNNKFRPEFEAAGFVFSGVSPDNRLVEIVELKEKKFFVAAQYHPELQSRPNR
FT                   PEELYTAFVTAAIKNSN"
FT   misc_feature    271180..272013
FT                   /gene="pyrG"
FT                   /locus_tag="SpyM50244"
FT                   /note="HMMPfam hit to PF06418, CTP synthase
FT                   N-terminus,score 9.9e-217"
FT                   /inference="protein motif:HMMPfam:PF06418"
FT   misc_feature    272077..272760
FT                   /gene="pyrG"
FT                   /locus_tag="SpyM50244"
FT                   /note="HMMPfam hit to PF00117, Glutamine amidotransferase
FT                   class-I, score 8.8e-71"
FT                   /inference="protein motif:HMMPfam:PF00117"
FT   CDS             272949..273875
FT                   /transl_table=11
FT                   /locus_tag="SpyM50245"
FT                   /product="putative exported protein"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL4"
FT                   /protein_id="CAM29587.1"
FT                   /translation="MKTIRIAKYLGILFLLITLISVGASFYFFHVAQIREEKSFINNKK
FT                   RSTNNPLYPAEQSFDALPYEKRQLTNRGLKQVGWYLPAAQKTKKTAIVVHGFTNDKEDM
FT                   KPYAMLFHDLGYNVLMPDNEAHGESEGNLIGYGWNDRLNVMAWTDQLIKENPESQITLF
FT                   GLSMGAATVMMASGERLPAQVTSLIEDCGYTSVWDELKFQAKAMYNLPAFPLLYEVSAL
FT                   SKIRAGFSYGEASSVKQLAKNKRPTLFIHGDKDDFVPTKMVYDNYKATKGPKEILIVKG
FT                   AKHAKSFETNPEQYQKKIAAFLKKVEK"
FT   sig_peptide     272949..273056
FT                   /locus_tag="SpyM50245"
FT                   /note="Signal peptide predicted for SpyM50245 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.964) with cleavage
FT                   site probability 0.397 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    272973..273041
FT                   /locus_tag="SpyM50245"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50245 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   tRNA            273929..274014
FT                   /gene="tRNA-Leu (AAG)"
FT                   /product="transfer RNA-Leu (AAG)"
FT                   /anticodon="(pos:273963..273965,aa:Leu)"
FT   CDS             274222..275103
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SpyM50246"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="GOA:A2RCL5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL5"
FT                   /protein_id="CAM29588.1"
FT                   /translation="MAIVSAEKFVQAARENGYAVGGFNTNNLEWTQAILRAAEAKQAPV
FT                   LIQTSMGAAKYMGGYKVCQSLITNLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKTAEVVKIAHAKGVSVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPENWEGLALDHLEKLTAAVPGFPIVLHGGSGIPDDQIKEAI
FT                   RLGVAKVNVNTESQIAFSNATREFARNYEANEAEYDGKKLFDPRKFLAPGMKAVQGAVE
FT                   ERIDVFGSANKA"
FT   misc_feature    274228..275100
FT                   /gene="fba"
FT                   /locus_tag="SpyM50246"
FT                   /note="HMMPfam hit to PF01116, Fructose-bisphosphate
FT                   aldolase class-II, score 4e-110"
FT                   /inference="protein motif:HMMPfam:PF01116"
FT   misc_feature    274441..274482
FT                   /note="PS00602 Fructose-bisphosphate aldolase class-II
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00602"
FT   misc_feature    274618..274653
FT                   /note="PS00806 Fructose-bisphosphate aldolase class-II
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00806"
FT   CDS             275485..275673
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SpyM50247"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="GOA:A2RCL6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /protein_id="CAM29589.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTILVDGKPK
FT                   KVWASARALKSGKVERI"
FT   misc_feature    275491..275667
FT                   /gene="rpmB"
FT                   /locus_tag="SpyM50247"
FT                   /note="HMMPfam hit to PF00830, Ribosomal L28 family, score
FT                   2.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00830"
FT   CDS             275825..276190
FT                   /transl_table=11
FT                   /locus_tag="SpyM50248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL7"
FT                   /protein_id="CAM29590.1"
FT                   /translation="MTVKINTKDGLIELSDDVIATVVGGSATEIFGVVGMASKSAIKDN
FT                   FQSLLRKENYAKGVVVKSTDLGISVDVYTVMSYGVKISEVSKNIQERVKFNLESQLGLT
FT                   ADMVNVYVQNIKVVGEN"
FT   misc_feature    275846..276172
FT                   /locus_tag="SpyM50248"
FT                   /note="HMMPfam hit to PF03780, Protein of unknown function
FT                   (DUF322), score 9.5e-54"
FT                   /inference="protein motif:HMMPfam:PF03780"
FT   CDS             276190..277854
FT                   /transl_table=11
FT                   /locus_tag="SpyM50249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RCL8"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL8"
FT                   /protein_id="CAM29591.1"
FT                   /translation="MSNITTSLFQEMVQAAATRLGKQAEYVNSLNVFPVPDGDTGTNMS
FT                   MTMDNGAKEVADKPASTVGEVGQMLSKGLLMGARGNSGVITSQLFRGFGQSIKGKDELT
FT                   GKDLAQAFQVGVEVAYKAVMKPVEGTILTVSRGAATAALKKADLTDDAVEVMQAALDGA
FT                   KGALAKTPDLLPVLKEVGVVDSGGQGLVFIYEGFLSALNGDYVTSADFKATPANMSEMI
FT                   NAEHHKSVVGHVATEDITYGYCTEIMVALKQGPTYVKEFNYDEFQGYLSGLGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLIKIKVDNMRNQHEAQVQKTDVEKNKAEVKDFG
FT                   LIAVVAGEGLSEIFKAQGVDYVISGGQTMNPSTEDIVKAIEAVNAKQVIILPNNKNIFM
FT                   AAQSAAEVVDIPAAVVATRTVPQGFTSLLAFDPSKSLEDNVADMSTSLSDVVSGSVTLA
FT                   VRDTTIDGLEIHENDFLGMVDGKIIVSNPDMEATLKAAFAKMIDEDSEIVTIFVGEEGD
FT                   QDLAEELAGYLGETYEDVEVEIHQGDQPVYPYLMSVE"
FT   misc_feature    276289..276786
FT                   /locus_tag="SpyM50249"
FT                   /note="HMMPfam hit to PF02734, DAK2 domain, score 7.4e-76"
FT                   /inference="protein motif:HMMPfam:PF02734"
FT   CDS             278091..278981
FT                   /transl_table=11
FT                   /locus_tag="SpyM50250"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RCL9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR028512"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCL9"
FT                   /protein_id="CAM29592.1"
FT                   /translation="MLGPFIFIAFGVIVILAIVASTLYVVRQQSVAIVERFGRYQKTAT
FT                   SGIHVRLPFGIDKIAARVQLRLLQSEIIVETKTKDNVFVTLNVATQYRVNEQNVTDAYY
FT                   KLMKPESQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQHQVAEEMSTYGYIIVKTL
FT                   ITKVEPDAEVKQSMNEINAAQRKRVAAQELANADKIKIVTAAEAEAEKDRLHGVGIAQQ
FT                   RKAIVDGLAESIQELKEANISLNEEQIMSILLTNQYLDTLNTFAAKGNQTLFLPNTPSG
FT                   VEDIRTQVLSALKTK"
FT   sig_peptide     278091..278171
FT                   /locus_tag="SpyM50250"
FT                   /note="Signal peptide predicted for SpyM50250 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.875) with cleavage
FT                   site probability 0.460 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    278100..278168
FT                   /locus_tag="SpyM50250"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50250 by TMHMM2.0 at aa 4-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    278157..278684
FT                   /locus_tag="SpyM50250"
FT                   /note="HMMPfam hit to PF01145, SPFH domain / Band, score
FT                   5.3e-46"
FT                   /inference="protein motif:HMMPfam:PF01145"
FT   CDS             279211..280065
FT                   /transl_table=11
FT                   /locus_tag="SpyM50251"
FT                   /product="putative acid phosphatase"
FT                   /db_xref="GOA:A2RCM0"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM0"
FT                   /protein_id="CAM29593.1"
FT                   /translation="MKSKKVVSVISLTLSLFLVTGCAKVDNNKSVNRKPATKQTYNSYS
FT                   DDQLRSRENTMSVLWYQRAAETQALYLQGYQLATDRLKEQLNKPTDKPYSIVLDIDETV
FT                   LDNSPYQAKNVLEGTGFTPESWDYWVQKKEAKPVAGAKDFLQFADQNGVQIYYISDRST
FT                   TQVDATMENLQKEGIPVQGRDHLLFLEKGVKSKESRRQKVKETTNVTMLFGDNLLDFAD
FT                   FSKKSQEDRTALLSDLQEEFGRRFIIFPNPMYGSWEGAIYKGEKLDVLKQLEERRKSLK
FT                   SFK"
FT   sig_peptide     279211..279285
FT                   /locus_tag="SpyM50251"
FT                   /note="Signal peptide predicted for SpyM50251 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.601 between residues 25 and 26"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    279244..279276
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    279361..279981
FT                   /locus_tag="SpyM50251"
FT                   /note="HMMPfam hit to PF03767, HAD superfamily, subfamily
FT                   IIIB (Acid, score 1.9e-87"
FT                   /inference="protein motif:HMMPfam:PF03767"
FT   CDS             280258..281454
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SpyM50252"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="GOA:A2RCM1"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /protein_id="CAM29594.1"
FT                   /translation="MAKLTVKDVDLKGKKVLVRVDFNVPLKDGVITNDNRITAALPTIK
FT                   YIIEQGGRAILFSHLGRVKEEADKEGKSLAPVAADLAAKLGQDVVFPGVTRGSKLEEAI
FT                   NALEDGQVLLVENTRFEDVDGKKESKNDEELGKYWASLGDGIFVNDAFGTAHRAHASNV
FT                   GISANVEKAVAGFLLENEIAYIQEAVETPERPFVAILGGSKVSDKIGVIENLLEKADKV
FT                   LIGGGMTYTFYKAQGIEIGNSLVEEDKLDVAKDLLEKSNGKLILPVDSKEANAFAGYTE
FT                   VRDTEGEAVSEGFLGLDIGPKSIAEFDQALTGAKTVVWNGPMGVFENPDFQAGTIDVMD
FT                   AIVKQPGVKSIIGGGDSAAAAINLGRADKFSWISTGGGASMELLEGKVLPGLAALTEK"
FT   misc_feature    280258..281451
FT                   /gene="pgk"
FT                   /locus_tag="SpyM50252"
FT                   /note="HMMPfam hit to PF00162, Phosphoglycerate
FT                   kinase,score 1.7e-190"
FT                   /inference="protein motif:HMMPfam:PF00162"
FT   misc_feature    280300..280332
FT                   /note="PS00111 Phosphoglycerate kinase signature"
FT                   /inference="protein motif:Prosite:PS00111"
FT   CDS             281717..282268
FT                   /transl_table=11
FT                   /locus_tag="SpyM50253"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM2"
FT                   /protein_id="CAM29595.1"
FT                   /translation="MKTLRKLLSNYKFDIKKFKLGMRTLKTGLSVFLVLLVFHLFGWKG
FT                   LQIGALTAVFSLREDFDKSVHFGFSRIIGNSIGGLLSLVFFAFNEIFHQAFWVTLLIVP
FT                   ICTMLCIMVNVACNNKSGIIGAVAALLIITLSIPTGQTFIYVTSRVFETFCGVFVAILV
FT                   NTDVELIKNKWFNKKHSDVR"
FT   sig_peptide     281717..281866
FT                   /locus_tag="SpyM50253"
FT                   /note="Signal peptide predicted for SpyM50253 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.732) with cleavage
FT                   site probability 0.269 between residues 50 and 51"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(281801..281869,281912..281980,281999..282067,
FT                   282080..282148)
FT                   /locus_tag="SpyM50253"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50253 by TMHMM2.0 at aa 29-51, 66-88, 95-117 and
FT                   122-144"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             282335..282706
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="SpyM50254"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="GOA:A2RCM3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM3"
FT                   /protein_id="CAM29596.1"
FT                   /translation="MKEKELRRSMAVFPIGTVMTLTDLSARQIRYYEDQGLIKPERTQG
FT                   NRRMFSLNDMDRLLEIKDFLSEGLNIAAIKREYVERQGKLMQKQKALTDADVRRILHDE
FT                   MLTQSGFSTPSQHIGNFRI"
FT   misc_feature    282374..282484
FT                   /gene="glnR"
FT                   /locus_tag="SpyM50254"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 3.9e-10"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    282380..282448
FT                   /note="PS00552 Bacterial regulatory proteins, merR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00552"
FT   CDS             282744..284090
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SpyM50255"
FT                   /product="putative glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="GOA:A2RCM4"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM4"
FT                   /protein_id="CAM29597.1"
FT                   /translation="MAITVADIRREVKEKNVTFLRLMFTDIMGVMKNVEIPATKEQLDK
FT                   VLSNKVMFDGSSIEGFVRINESDMYLYPDLDTWIIFPWGDENGAVAGLICDIYTAEGKP
FT                   FAGDPRGNLKRALKHMNEIGYKSFNLGPEPEFFLFKMDDKGNPTLEVNDNGGYFDLAPI
FT                   DLADNTRREIVNILTKMGFEVEASHHEVAVGQHEIDFKYADVLKACDNIQIFKLVVKTI
FT                   AREHGLYATFMAKPKFGIAGSGMHCNMSLFDNQGNNAFYDETDKRGMQLSEDAYYFLGG
FT                   LMKHAYNYTAITNPTVNSYKRLVPGYEAPVYVAWAGSNRSPLIRVPASRGMGTRLELRS
FT                   VDPTANPYLALAVLLEAGLDGIINKIEAPEPVEANIYTMTMEERNEAGIIDLPSTLHNA
FT                   LKALQKDDVVQKALGYHIYTNFLEAKRIEWSSYATFVSQWEIDHYIHNY"
FT   misc_feature    282789..283046
FT                   /gene="glnA"
FT                   /locus_tag="SpyM50255"
FT                   /note="HMMPfam hit to PF03951, Glutamine
FT                   synthetase,beta-Grasp domain, score 1.9e-39"
FT                   /inference="protein motif:HMMPfam:PF03951"
FT   misc_feature    282900..282956
FT                   /note="PS00180 Glutamine synthetase signature 1"
FT                   /inference="protein motif:Prosite:PS00180"
FT   misc_feature    283059..283829
FT                   /gene="glnA"
FT                   /locus_tag="SpyM50255"
FT                   /note="HMMPfam hit to PF00120, Glutamine
FT                   synthetase,catalytic domain, score 1e-142"
FT                   /inference="protein motif:HMMPfam:PF00120"
FT   CDS             complement(284318..286000)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50256"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="GOA:A2RCM5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM5"
FT                   /protein_id="CAM29598.1"
FT                   /translation="MTNISLKPNEVGVFAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFP
FT                   EDDLLGIDYVIPDYSYIVDNLDRVKALVITHGHEDHIGGIPFLLKQANIPIYAGPLALA
FT                   LIRGKLEEHGLWREATVYEINHNTELTFKNMSVTFFKTTHSIPEPVGIVIHTPQGKIIC
FT                   TGDFKFDFTPVGDPADLQRMAALGEEGVLCLLSDSTNAEIPTFTNSEKVVGQSILKIIE
FT                   GIHGRIIFASFASNIYRLQQAAEAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKGTF
FT                   IEPSELKNLHASEVLIMCTGSQGESMAALARIANGTHRQVTLQPGDTVIFSSSPIPGNT
FT                   TSVNKLINTIQEAGVDVIHGKVNNIHTSGHGGQQEQKLMLSLIKPKYFMPVHGEYRMQK
FT                   VHAGLAMDIGIPKENIFIMENGDVLALTSGSARIAGHFNAQDIYVDGNGIGDIGAAVLR
FT                   DRRDLSEDGVVLAVATVDFNTQMILAGPDILSRGFIYMRESGDLIRESQRVLFNAIRIA
FT                   LKNKDASIQSVNGAIVNALRPFLYEKTEREPIIIPMVLTPDKH"
FT   misc_feature    complement(284813..284935)
FT                   /locus_tag="SpyM50256"
FT                   /note="HMMPfam hit to PF07521, RNA-metabolising
FT                   metallo-beta-lactamase, score 1.3e-14"
FT                   /inference="protein motif:HMMPfam:PF07521"
FT   misc_feature    complement(284819..284905)
FT                   /note="PS01292 Uncharacterized protein family UPF0036
FT                   signature"
FT                   /inference="protein motif:Prosite:PS01292"
FT   misc_feature    complement(285329..285934)
FT                   /locus_tag="SpyM50256"
FT                   /note="HMMPfam hit to PF00753, Metallo-beta-lactamase
FT                   superfamily, score 1.2e-29"
FT                   /inference="protein motif:HMMPfam:PF00753"
FT   CDS             complement(286002..286232)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009907"
FT                   /protein_id="CAM29599.1"
FT                   /translation="MIYKVFYQETKDQSPRRESTKALYLNIDATDELDGRIKARRLVED
FT                   NTYYNVEFIELLSDKHLDYEKETGVFELTEF"
FT   misc_feature    complement(286005..286229)
FT                   /locus_tag="SpyM50257"
FT                   /note="HMMPfam hit to PF07288, Protein of unknown function
FT                   (DUF1447), score 1.4e-51"
FT                   /inference="protein motif:HMMPfam:PF07288"
FT   CDS             286516..287214
FT                   /transl_table=11
FT                   /locus_tag="SpyM50258"
FT                   /product="glycoprotease family protein"
FT                   /db_xref="GOA:A2RCM7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM7"
FT                   /protein_id="CAM29600.1"
FT                   /translation="MKTLAFDTSNKTLSLAILDDEILLADMTLNIQKNHSVSLMPAIDF
FT                   LMTCTDLKPQGLERIVVAKGPGSYTGLRVAVATAKTLAYSLNIALVGISSLYALAASTC
FT                   KQYPNTLVVPLIDARRQNAYVGYYRQGKSVMPQAHAPLEVIIEQLVEEGQLIFVGETAP
FT                   FAEQIQKKLPQAILLPTLPSAYECGLLGQSLAPENVDAFVPQYLKRVEAEENWLKDNEI
FT                   KDDSHYVKRI"
FT   misc_feature    286588..286839
FT                   /locus_tag="SpyM50258"
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family, score
FT                   7.2e-21"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   misc_feature    286891..286914
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             287216..287641
FT                   /transl_table=11
FT                   /locus_tag="SpyM50259"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="GOA:A2RCM8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCM8"
FT                   /protein_id="CAM29601.1"
FT                   /translation="MKTVEEQAKKIYQLLEMVYGTSPWTLEQVLIDIRRDQTDYFLLYD
FT                   YDKLLGFLAIQDLAGEVEMTQIAILPSHQGLGLASQLMTHLGSIESDIFLEVRESNHRA
FT                   QGLYQKFGFKFIGKRPDYYRNPIETALLMKREGKHDR"
FT   misc_feature    287336..287557
FT                   /locus_tag="SpyM50259"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 9.3e-15"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS             287631..288659
FT                   /transl_table=11
FT                   /locus_tag="SpyM50260"
FT                   /product="putative glycoprotease"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="GOA:A2RCM9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /protein_id="CAM29602.1"
FT                   /translation="MTDRYILAVESSCDETSVAILKNESTLLSNVIASQVESHKRFGGV
FT                   VPEVASRHHVEVITTCFEDALQEAGISASDLSAVAVTYGPGLVGALLVGLAAAKAFAWA
FT                   NHLPLIPVNHMAGHLMAAREQKPLVYPLIALLVSGGHTELVYVPEPGDYHIIGETRDDA
FT                   VGEAYDKVGRVMGLTYPAGREIDQLAHKGQDTYHFPRAMITEDHLEFSFSGLKSAFINL
FT                   HHNAKQKGDELILEDLCASFQAAVLDILLAKTKKALSRYPAKMLVVAGGVAANQGLRDR
FT                   LAQEITHIEVVIPKLRLCGDNAGMIALAAAIEYDKQHFANMSLNAKPSLAFDQFPDSFV
FT                   IN"
FT   misc_feature    287757..288023
FT                   /locus_tag="SpyM50260"
FT                   /note="HMMPfam hit to PF00814, Glycoprotease family, score
FT                   2.8e-20"
FT                   /inference="protein motif:HMMPfam:PF00814"
FT   CDS             complement(288830..289099)
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SpyM50261"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="GOA:A2RCN0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /protein_id="CAM29603.1"
FT                   /translation="MAKKSKIAKYQKQLQLIEQYADLRRDLKAKGDYESLRKLPRDSNP
FT                   NRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW"
FT   misc_feature    complement(288836..289000)
FT                   /gene="rpsN"
FT                   /locus_tag="SpyM50261"
FT                   /note="HMMPfam hit to PF00253, Ribosomal protein S14p/S29e,
FT                   score 1.7e-15"
FT                   /inference="protein motif:HMMPfam:PF00253"
FT   CDS             complement(289320..290078)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50262"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="GOA:A2RCN1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN1"
FT                   /protein_id="CAM29604.1"
FT                   /translation="MSTNDLTKKLKKLKHVQVYNTIFQLIQDGTYSPGMQLPSEPELAR
FT                   QLNVSRMTLRKSLALLQEDHLIKNIRGKGNFILKTPETKYHQGFEYLQHPIYASLSSDI
FT                   TKVELEYRIEVPTVAITASLKQETPVVIIVDRWYHSQNKAIAYSLSFIPIEVISKYAIN
FT                   LNQEEPLLTFLEEKIYDSGKASHSCNQIGYTKTGNYTATKYTLSENSAFILIQETLYNG
FT                   KDILVSTKHYVPADLFDLKVQSQSCQSDTH"
FT   misc_feature    complement(289848..290039)
FT                   /locus_tag="SpyM50262"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR family, score 8.9e-17"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    complement(289896..289970)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    complement(289902..289967)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1454.000, SD 4.14 at aa 38-59, sequence
FT                   PSEPELARQLNVSRMTLRKSLA"
FT   CDS             290318..291097
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="SpyM50263"
FT                   /product="putative uridine phosphorylase"
FT                   /EC_number="2.4.2.3"
FT                   /db_xref="GOA:A2RCN2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN2"
FT                   /protein_id="CAM29605.1"
FT                   /translation="MQNYSGEVGLQYHLQIRPGDVGRYVIMPGDPKRCAKIAEHFDNAV
FT                   LVADSREYVTYTGTLNGEKVSVTSTGIGGPSASIAMEELKLCGADTFIRVGTCGGIDLD
FT                   VKGGDIVIATGAIRMEGTSKEYAPIEFPAVADLEVTNALVNAAKKLGYTSHAGVVQCKD
FT                   AFYGQHEPERMPVSYELLNKWEAWKRLGTKASEMESAALFVAASHLGVRCGSDFLVVGN
FT                   QERNALGMDNPMAHDTEAAIQVAVEALRTLIENDKSQ"
FT   misc_feature    290384..291064
FT                   /gene="udp"
FT                   /locus_tag="SpyM50263"
FT                   /note="HMMPfam hit to PF01048, Phosphorylase family, score
FT                   1.1e-44"
FT                   /inference="protein motif:HMMPfam:PF01048"
FT   misc_feature    290522..290569
FT                   /note="PS01232 Purine and other phosphorylases family 1
FT                   signature"
FT                   /inference="protein motif:Prosite:PS01232"
FT   CDS             291118..292320
FT                   /transl_table=11
FT                   /locus_tag="SpyM50264"
FT                   /product="putative Na+ dependent nucleoside transporter"
FT                   /db_xref="GOA:A2RCN3"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN3"
FT                   /protein_id="CAM29606.1"
FT                   /translation="MQFIYSIIGILLVLGIVYAISFNRKSVSLSLIGKALIVQFIIALI
FT                   LVRIPLGQQIVSVVSTGVTSVINCGQAGLNFVFGSLADSGAKTGFIFAIQTLGNIVFLS
FT                   ALVSLLYYVGILGFVVKWIGKGVGKIMKSSEVESFVAVANMFLGQTDSPILVSKYLGRM
FT                   TDSEIMVVLVSGMGSMSVSILGGYIALGIPMEYLLIASTMVPIGSILIAKILLPQTEPV
FT                   QKIDDIKMDNKGNNANVIDAIAEGASTGAQMAFSIGASLIAFVGLVSLINMMLSGLGIR
FT                   LEQIFSYVFAPFGFLMGFDHKNILLEGNLLGSKLILNEFVSFQQLGHLIKSLDYRTALV
FT                   ATISLCGFANLSSLGICVSGIAVLCPEKRSTLARLVFRAMIGGIAVSMLSAFIVGIVTL
FT                   F"
FT   misc_feature    291118..291363
FT                   /locus_tag="SpyM50264"
FT                   /note="HMMPfam hit to PF01773, Na+ dependent nucleoside
FT                   transporter N, score 1.5e-30"
FT                   /inference="protein motif:HMMPfam:PF01773"
FT   misc_feature    order(291124..291183,291196..291264,291283..291351,
FT                   291409..291477,291619..291687,291697..291765,
FT                   291889..291957,292135..292203,292240..292308)
FT                   /locus_tag="SpyM50264"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SpyM50264 by TMHMM2.0 at aa 7-26,
FT                   31-53,60-82,102-124,172-194, 198-220, 262-284, 344-366 and
FT                   379-401"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    291394..291702
FT                   /locus_tag="SpyM50264"
FT                   /note="HMMPfam hit to PF07670, Nucleoside recognition,score
FT                   3.8e-12"
FT                   /inference="protein motif:HMMPfam:PF07670"
FT   misc_feature    291706..292311
FT                   /locus_tag="SpyM50264"
FT                   /note="HMMPfam hit to PF07662, Na+ dependent nucleoside
FT                   transporter C, score 1.2e-102"
FT                   /inference="protein motif:HMMPfam:PF07662"
FT   CDS             292350..293021
FT                   /transl_table=11
FT                   /gene="deoC"
FT                   /locus_tag="SpyM50265"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="GOA:A2RCN4"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /protein_id="CAM29607.1"
FT                   /translation="MEVKDILKTVDHTLLATTATWPEIQTILDDAMAYETASACIPASY
FT                   VKKAAEYVSGKLAICTVIGFPNGYSTTAAKVFECQDAIQNGADEIDMVINLTDVKNGDF
FT                   DTVEEEIRQIKAKCQDHILKVIVETCQLTKEELIELCGVVTRSGADFIKTSTGFSTAGA
FT                   TFEDVEVMAKYVGEGVKIKAAGGISSLEDAKTFIALGASRLGTSRIIKIVKNEATKPDS
FT                   Y"
FT   misc_feature    292359..292991
FT                   /gene="deoC"
FT                   /locus_tag="SpyM50265"
FT                   /note="HMMPfam hit to PF01791, Deoxyribose-phosphate
FT                   aldolase, score 3.6e-70"
FT                   /inference="protein motif:HMMPfam:PF01791"
FT   CDS             complement(293116..294285)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50266"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RCN5"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN5"
FT                   /protein_id="CAM29608.1"
FT                   /translation="MTQYDTIIIGGGPAGMMAAISSSYYGYKTLLIEKNRRLGKKLAGT
FT                   GGGRCNVTNSGNLDVLMAGIPGNGRFLYSVFSQFDNHDIIAFFEENGVKLKEEDHGRMF
FT                   PTTDKSRTIIDALEKKIKALGGQVLTSTEVVSVKKQDDLFYLKSADQTFTCQKLIVTTG
FT                   GKSYPSTGSTGFGHDIARHFKLTVTDLEAAESPLLTDFPHKVLQGISLDDVTLSYDKHV
FT                   ITHDLLFTHFGLSGPAALRLSSFVKGGEIAELDFLPHLSTDDLTAYLSDQRDKNIKNAL
FT                   KGLLPERVADFLSEDYPEKVKQLSPKQEKELLDKLKHLQIPITGKMSLAKSFVTKGGVD
FT                   LKEINPKTLESKKVPGLYFAGEVLDINAHTGGFNITSALCSGWIAGKSS"
FT   misc_feature    complement(293137..294144)
FT                   /locus_tag="SpyM50266"
FT                   /note="HMMPfam hit to PF03486, HI0933-like protein, score
FT                   1.4e-196"
FT                   /inference="protein motif:HMMPfam:PF03486"
FT   misc_feature    complement(294208..294267)
FT                   /locus_tag="SpyM50266"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50266 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             294467..295018
FT                   /transl_table=11
FT                   /locus_tag="SpyM50267"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RCN6"
FT                   /db_xref="InterPro:IPR007489"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN6"
FT                   /protein_id="CAM29609.1"
FT                   /translation="MINKEENMAIEKTVSELADILGVSRQAVNNRVKSLPEEDLDKNEK
FT                   GVTVVKRSGLVKLEEIYKKTIFDDEPISEETKQRELLEILVDEKNTEITRLYEQLKAKD
FT                   AQLASKDEQMRVKDVQIAEKDKQLDQQQQLTAKAMADKETLKLELEEAKAEANQARLQV
FT                   EEVQAEVGPKKGFLTRLFAK"
FT   misc_feature    294500..294565
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1868.000, SD 5.55 at aa 12-33, sequence
FT                   KTVSELADILGVSRQAVNNRVK"
FT   misc_feature    294785..294928
FT                   /locus_tag="SpyM50267"
FT                   /note="HMMPfam hit to PF04394, Protein of unknown function,
FT                   DUF536, score 7.3e-15"
FT                   /inference="protein motif:HMMPfam:PF04394"
FT   CDS             295028..295654
FT                   /transl_table=11
FT                   /locus_tag="SpyM50268"
FT                   /product="putative exonuclease"
FT                   /db_xref="GOA:A2RCN7"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN7"
FT                   /protein_id="CAM29610.1"
FT                   /translation="MTKALSGSFLEENMKHLDTYIAFDLEFNTVNDVSHIIQVSAVKYD
FT                   HHKEVDSFDTYVYTDVPLQSFINGLTGITSDKIAAAPKVEEVMAAFKNFVGELPLIGYN
FT                   AQKSDLPILAENGLDLRDQYQIDLFDEAYDRRSADLNGIANLRLQTVATFLGIKGRGHN
FT                   SLEDARMTAAIYKSFLETDTNKAYLSQQEEVTTDNPFAALGDFFD"
FT   misc_feature    295085..295552
FT                   /locus_tag="SpyM50268"
FT                   /note="HMMPfam hit to PF00929, Exonuclease, score 2.8e-14"
FT                   /inference="protein motif:HMMPfam:PF00929"
FT   CDS             295806..296543
FT                   /transl_table=11
FT                   /locus_tag="SpyM50269"
FT                   /product="MerR family regulatory protein"
FT                   /db_xref="GOA:A2RCN8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCN8"
FT                   /protein_id="CAM29611.1"
FT                   /translation="MSQFYSTGELANLAGVSIRTVQYYDQRGILIPTALTAGGRRLYTD
FT                   SDLEQLRMICFLRDLGFSIEQIRKVLAEENAAQVLELLLVDHIATAKEDLAAKEQQVDI
FT                   AVKILDRLRKQDPQSLDFLMDISLSMKNQKAWKKLQWKMGISIFLAIVSYVGLILLSNY
FT                   LQKFWLVYVAMGLFLPGFSWLVIYFRKQFIYLCPHCHQKFEPSFNEFALAGHTPRTRKL
FT                   TCSHCHQKSYCLELAKEDTVSRG"
FT   misc_feature    295818..295883
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1396.000, SD 3.94 at aa 7-28, sequence
FT                   YSTGELANLAGVSIRTVQYYDQ"
FT   misc_feature    295821..295934
FT                   /locus_tag="SpyM50269"
FT                   /note="HMMPfam hit to PF00376, MerR family regulatory
FT                   protein, score 2.6e-11"
FT                   /inference="protein motif:HMMPfam:PF00376"
FT   misc_feature    order(296226..296294,296304..296363)
FT                   /locus_tag="SpyM50269"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50269 by TMHMM2.0 at aa 143-165 and 169-188"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    296475..296492
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   CDS             complement(296600..296899)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RCN9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /protein_id="CAM29612.1"
FT                   /translation="MMNMQNMMRQAQKLQKQMEQKQADLAAMQFTGKSAQDLVTATFTG
FT                   DKKLVGIDFKEAVVDPEDVETLQDMTTQAINDALTQIDEATKKTLGAFAGKLPF"
FT   misc_feature    complement(296603..296878)
FT                   /locus_tag="SpyM50270"
FT                   /note="HMMPfam hit to PF02575, Uncharacterised BCR, YbaB
FT                   family COG0718, score 3.3e-39"
FT                   /inference="protein motif:HMMPfam:PF02575"
FT   misc_feature    complement(296798..296821)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(297092..297466)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50271"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RCP0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP0"
FT                   /protein_id="CAM29613.1"
FT                   /translation="MSAKKTFFASNLKYLRLKKNMEQLELANLLGRKSSSSISEWEKGK
FT                   YTPKSGLLSDIAAIFDVSLTALMEEDLTLENKGVSYQLPQRELAMISEQLSENNYTKWV
FT                   DFAQILLEQQAKEDRELDNH"
FT   misc_feature    complement(297266..297433)
FT                   /locus_tag="SpyM50271"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5.6e-12"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   CDS             297636..297857
FT                   /transl_table=11
FT                   /locus_tag="SpyM50272"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RCP1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP1"
FT                   /protein_id="CAM29614.1"
FT                   /translation="MTKSTLKELRTTKKMTQQELSHLTGISVRTIARYEKDTKKLRRAK
FT                   YEKLKGIAQALAVSVDDIFLGIDSEFMN"
FT   misc_feature    297651..297824
FT                   /locus_tag="SpyM50272"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   5e-12"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    297678..297743
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2153.000, SD 6.52 at aa 15-36, sequence
FT                   MTQQELSHLTGISVRTIARYEK"
FT   CDS             complement(297937..300219)
FT                   /transl_table=11
FT                   /gene="pepXP"
FT                   /locus_tag="SpyM50273"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="GOA:A2RCP2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR008252"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR015251"
FT                   /db_xref="InterPro:IPR029058"
FT                   /protein_id="CAM29615.1"
FT                   /translation="MRYNQFSYIPTSLERAAEELKELGFDLDLQKTAKVNLESFLRKLF
FT                   FHYPDSDYPLSHLITKNDMDALSFFQSEQELSKEVFDLLALQVLGFIPGVDFTEADAFL
FT                   DKLAFPIHFDETEIIKHIHHILATRCKSGMTLIDDLVSQGMLTMDNDYHFFNGKSLATF
FT                   DTSQLIREVVYVEAPLDTDQDGQLDLIKVNIIRPQSQKPLPTLMTPSPYHQGINEVAND
FT                   KKLYRMEKELVVKKRRQITVEDRDFIPLETQPCKLPIGQNLEIFSYINSYSLNDYFLAR
FT                   GFANIYVSGVGTAGSTGFMTSGDYAQIESFKAVIDWLNGRATAYTSHSKTHQVRADWAN
FT                   GLVCTTGKSYLGTMSTGLATTGVDGLAMIIAESAISSWYNYYRENGLVCSPGGYPGEDL
FT                   DVLTELTYSRNLLAGDYLRHNDRYQELLNQQSQALDRQSGDYNQFWHDRNYLKNAHQIK
FT                   CDVVYTHGLQDWNVKPRQVYEIVNALPSTINKHLFLHQGEHVYMHNWQSIDFRESMNVL
FT                   LCQKLLGLANDFSLPEMIWQDNTCPQNWQERKVFGTSTIKELDLGQELLLIDNHYGEDE
FT                   FKAYGKDFRAFKAALFKGKANQALVDILLEEDLPINGEIVLQLKVKSSENKGLLSAQIL
FT                   DYGKKKRLGDLPIALTQSSIDNGQNFSREPLKELPFREDSYRVISKGFMNLQNRNNLSS
FT                   IETIPNNKWMTVRLPLQPTIYHLEKGDTLRVILYTTDFEHTVRDNSNYALTIDLSQSQL
FT                   IVPIASN"
FT   misc_feature    complement(297958..299670)
FT                   /gene="pepXP"
FT                   /locus_tag="SpyM50273"
FT                   /note="HMMPfam hit to PF02129, X-Pro dipeptidyl-peptidase
FT                   (S15 family), score 7.5e-102"
FT                   /inference="protein motif:HMMPfam:PF02129"
FT   CDS             complement(300241..300960)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50274"
FT                   /product="Crp family regulatory protein"
FT                   /db_xref="GOA:A2RCP3"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP3"
FT                   /protein_id="CAM29616.1"
FT                   /translation="MLISLEDTNYTLVKEYLEKSVNHHILQRYIDNHNFPIIEKSYHKY
FT                   LTFESLEEDFTYILKDGIVKQSVLSKYGMEFNLRYVTGLEITSVLNTGYSKDMGEPYNV
FT                   RIESEKASFYKVRRSAFLKDINEDIELQGYVKDFYHNRLQKSMKKMQCMLTNGRIGAIS
FT                   TQIYDLMTLFGEELPNGQILINFVITNEELGKFCGISTASSVSRILKQLKEKNIIRIDK
FT                   QHIIITNLDKLKDNIVF"
FT   misc_feature    complement(300307..300405)
FT                   /locus_tag="SpyM50274"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp family, score 7.6e-05"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   CDS             301066..302262
FT                   /transl_table=11
FT                   /locus_tag="SpyM50275"
FT                   /product="Major Facilitator Superfamily transporter"
FT                   /db_xref="GOA:A2RCP4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP4"
FT                   /protein_id="CAM29617.1"
FT                   /translation="MEEKLFNKHFVAITVINFIVYMVYYLFTVIIAFVATRELGAQTSQ
FT                   AGLATGIYILGTLLARLIFGKQLEVFGRRLVLRGGAIFYLLTTLAYFYMPTISMMYLVR
FT                   FLNGFGYGVVSTATNTIVTAYIPACKRGEGINFYGLSTSLAAAIGPFVGTFMLDNLHID
FT                   FRMIIVLCSVLIGCVVVGAFAFPVKNMSLNAEQLAKTKSWTVDSFIEKKALFITAIAFL
FT                   MGIAYASVLGFQKLYTSEIHLTAVGAYFFVVYALIITITRPAMGRLMDAKGDKWVLYPS
FT                   YLFLAMGLFLLGSVSSGGSYLLSGALIGFGYGTFMSCGQAASIQGVDEHRFNTAMSTYM
FT                   IGLDLGLGAGPYLLGLIKDLALGSGVASFRHLFWLAAVIPLICTLLYLLKTKTRQVVS"
FT   misc_feature    order(301102..301170,301198..301257,301291..301350,
FT                   301378..301446,301465..301533,301561..301620,
FT                   301705..301758,301786..301854,301891..301950,
FT                   301963..302031,302068..302136,302179..302232)
FT                   /locus_tag="SpyM50275"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SpyM50275 by TMHMM2.0 at aa 13-35,
FT                   45-64,76-95,105-127,134-156, 166-185, 214-231,
FT                   241-263,276-295,300-322,335-357 and 372-389"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    301102..302142
FT                   /locus_tag="SpyM50275"
FT                   /note="HMMPfam hit to PF07690, Major Facilitator
FT                   Superfamily, score 1.1e-45"
FT                   /inference="protein motif:HMMPfam:PF07690"
FT   CDS             302448..302564
FT                   /transl_table=11
FT                   /locus_tag="SpyM50276"
FT                   /product="hypothetical protein"
FT                   /note="No significant database matches"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP5"
FT                   /protein_id="CAM29618.1"
FT                   /translation="MALFLVGAIGLTSEYRLCHVKIDLLIVRANKKCYNTMK"
FT   CDS             302734..303582
FT                   /transl_table=11
FT                   /gene="gla"
FT                   /locus_tag="SpyM50277"
FT                   /product="glycerol facilitator-aquaporin"
FT                   /db_xref="GOA:A2RCP6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP6"
FT                   /protein_id="CAM29619.1"
FT                   /translation="MEMTWTVKYITEFIATAFLIILGNGAVANVDLKGTKGHNSGWLVI
FT                   AFGYGLGVMMPALMFGNVSGNHINPAFTVGLAVSGLFPWAHVLQYVVAQLLGAIFGQLV
FT                   VVMVYKPYFMKTENPNHVLGSFSTISSLDNGQKDSHKVSYINGFLNEFVGSFVLFFGAL
FT                   ALTKNYFGVELVGKLIEAGYDQTTAATQISPYVTGSLAVAHIGIGFLVMVLVTSLGGPT
FT                   GPALNPARDFGPRLLHHFLPKSVLGQAKGDSKWWYAWVPVVAPILAAIVAVAAFKYLYI
FT                   R"
FT   misc_feature    302734..303561
FT                   /gene="gla"
FT                   /locus_tag="SpyM50277"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic
FT                   protein,score 7.3e-89"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    order(302746..302814,302857..302925,302983..303051,
FT                   303187..303246,303307..303375,303508..303576)
FT                   /gene="gla"
FT                   /locus_tag="SpyM50277"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50277 by TMHMM2.0 at aa 5-27,
FT                   42-64,84-106,152-171,192-214 and 259-281"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    302932..302958
FT                   /note="PS00221 MIP family signature"
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS             complement(303918..304814)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50278"
FT                   /product="putative membrane protein"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCP7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP7"
FT                   /protein_id="CAM29620.1"
FT                   /translation="MNEMLILRLIQALLVSAMLFIFFMLVKHLKKNKINPFKRFWTGFW
FT                   IGLLTDALDTLGIGSFATTTTCFKLTKLVTDDRQLPGTMTVAHVLPVLIQSLCFIFVVK
FT                   VEVLTLLAMAAAAFIGAYFGTHITKNWHAPTVQRILGSLLIIAAIIMIIRIIYHPGEHL
FT                   SDTIHGLHGIWLFVGIGFNFIVGVLMTMGLGNYAPELIFFSLMGLSPTVAMPVMMLDAA
FT                   MIMTASSSQFIKANRVSWDGFAGIVSGGIIGVLLAVFFLTNLDINSLKLLVIAIVFFTG
FT                   GMLIRSSFTSHKQQTNR"
FT   misc_feature    complement(order(303945..304004,304023..304091,
FT                   304149..304217,304230..304298,304341..304400,
FT                   304437..304496,304506..304565,304626..304694,
FT                   304737..304802))
FT                   /locus_tag="SpyM50278"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SpyM50278 by TMHMM2.0 at aa 5-26,
FT                   41-63,84-103,107-126,139-158, 173-195, 200-222, 242-264 and
FT                   271-290"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             305112..305864
FT                   /transl_table=11
FT                   /locus_tag="SpyM50279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP8"
FT                   /protein_id="CAM29621.1"
FT                   /translation="MTLMENITFKTPVLRVNDRDLNIAFYQNNLGLRLVSEENAVAIFS
FT                   SWGEGQECFVIEESPSVRTRAVEGPKKVNTIVIKTNQPKEIEQLLAHGAHYDTLFKGQN
FT                   GYAFETISPEGDRFLLHAEQDIKHLQGTDLPSLEKDATFKGLTQFKFDIIVLNVISEER
FT                   SKAFYRDLFSDQLPITMDFIQEEGPDLAIDPHIAWDLEILEFQVSKDYDMKVLKATLEE
FT                   DGHKVYIDKKHKVLVLSDPSQIEVWFTK"
FT   CDS             305849..306799
FT                   /transl_table=11
FT                   /locus_tag="SpyM50280"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCP9"
FT                   /protein_id="CAM29622.1"
FT                   /translation="MVYEMTLAVIKCIENHLHKKVYKGASLALFQSGRWQEYHIGTIDG
FT                   RRPVDANLVYDLASVSKVVGVATICNILLNNGTLALDDPLKVYYPSIADTTVTIRQLLT
FT                   HTSGLDPYIPNRDVLNAQQLRKALNHLTQKENKNFYYTDVNFLLLGFMLEELFSESLDQ
FT                   IFDKTIFTPFGMYHTSFGPRPEAVPTLKGVSDGEVHDPKAKILKKHSGSAGLFSTLADL
FT                   ESFSNHYLNDPFSDCLWRNYSQQTIERSLGWNLDGDWISHTGYTGPFLMLNKKEQTAAI
FT                   FLTNRTYDEDDKSKWLKERQLLYNALKHDLTTPVS"
FT   misc_feature    305873..306760
FT                   /locus_tag="SpyM50280"
FT                   /note="HMMPfam hit to PF00144, Beta-lactamase, score
FT                   7.2e-55"
FT                   /inference="protein motif:HMMPfam:PF00144"
FT   misc_feature    306011..306058
FT                   /note="PS00146 Beta-lactamase class-A active site"
FT                   /inference="protein motif:Prosite:PS00146"
FT   CDS             complement(306979..309306)
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SpyM50281"
FT                   /product="formate acetyltransferase"
FT                   /EC_number="2.3.1.54"
FT                   /db_xref="GOA:A2RCQ0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ0"
FT                   /protein_id="CAM29623.1"
FT                   /translation="MATVKTNTDVFEKAWEGFKGTDWKEKASVSRFVQANYTPYDGDES
FT                   FLAGATERSLHIKKVIEETKAHYEATRFPYDTRPTSIADIPAGFIDKENELIYGIQNDE
FT                   LFKLNFMPKGGIRMAETTLKENGYEPDPAVHEIFTKYVTTVNDGIFRAYTSNIRRARHA
FT                   HTVTGLPDAYSRGRIIGVYARLALYGADYLMQEKVNDWNAITEIDEESIRLREEVNLQY
FT                   QALGEVVKLGDLYGVDVRRPAQNVKEAIQWVNIAFMAVCRVINGAATSLGRVPIVLDIF
FT                   AERDLARGTFTESEIQEFVDDFVLKLRTVKFGRTKAYDALYSGDPTFITTSMAGMGNDG
FT                   RHRVTKMDYRFLNTLDNIGNSPEPNLTVLWTDQLPETFRRYCMKMSHKHSSIQYEGVTT
FT                   MAKEGYGEMSCISCCVSPLDPENEEQRHNIQYFGARVNVLKALLTGLNGGYDDVHRDYK
FT                   VFNVVEPITSEVLEYDEVMANFEKSLDWLTDTYVDALNIIHYMTDKYNYEAVQMAFLPT
FT                   HQRANMGFGICGFANTVDTLSAIKYATVKTIRDENGYIYDYEVTGDFPRYGEDDDRVDD
FT                   IAKWLMEAYHTRLASHKLYKNAEASVSLLTITSNVAYSKQTGNSPVHRGVFLNEDGTVN
FT                   TSQVEFFSPGANPSNKAKGGWLQNLNSLAKLEFSHANDGISLTTQVSPRALGKTFDEQV
FT                   DNLVTVLDGYFENGGQHVNLNVMDLNDVYDKIMNGEDVIVRISGYCVNTKYLTPEQKTE
FT                   LTQRVFHEVLSMDDAAEAISSK"
FT   misc_feature    complement(307075..307383)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SpyM50281"
FT                   /note="HMMPfam hit to PF01228, Glycine radical, score
FT                   7.8e-42"
FT                   /inference="protein motif:HMMPfam:PF01228"
FT   misc_feature    complement(307084..307110)
FT                   /note="PS00850 Glycine radical signature"
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(307465..309267)
FT                   /gene="pfl"
FT                   /gene_synonym="pflB"
FT                   /locus_tag="SpyM50281"
FT                   /note="HMMPfam hit to PF02901, Pyruvate formate lyase,score
FT                   0"
FT                   /inference="protein motif:HMMPfam:PF02901"
FT   CDS             309515..310609
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="SpyM50282"
FT                   /product="DNA polymerase IV"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="GOA:A2RCQ1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /protein_id="CAM29624.1"
FT                   /translation="MLIFPLINDTSRKIIHIDMDAFFAAVEERDNPALKGKPVVIGKDP
FT                   RETGGRGVVSTCNYEARKYGIHSAMSSKEAYERCPKAIFISGNYEKYRTVGDQIRRIFK
FT                   RYTDLVEPMSIDEAYLDVTDNKLGIKSAVKIAKLIQHDIWKEVGLTCSAGVSYNKFLAK
FT                   LASDFEKPHGLTLVLKEDALCFLAKLPIEKFHGVGKKSVEKLHDMGIYTGQDLLAVPEM
FT                   TLIDHFGRFGFDLYRKARGISNSPVKSDRIRKSIGSERTYAKLLYQETDIKAEISKNAK
FT                   RVAALLQDHKKLGKTIVLKVRYADFTTLTKRVTLPELTRNAAQIEQVAGDIFDSLSENP
FT                   AGIRLLGVTMTNLEDKVADISLNL"
FT   misc_feature    309563..310579
FT                   /gene="dinB"
FT                   /locus_tag="SpyM50282"
FT                   /note="HMMPfam hit to PF00817, impB/mucB/samB family,score
FT                   1.1e-105"
FT                   /inference="protein motif:HMMPfam:PF00817"
FT   CDS             complement(310702..311184)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50283"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ2"
FT                   /protein_id="CAM29625.1"
FT                   /translation="MISYEKVRQALKTSTIAIIILNGLGVVLSLMGFAGFFYLQSQLKN
FT                   EAFRAQLTTEQLAQLQSSMTPFMIFLSVLNVLAIIAIIIFCTQNLSKLKQGLTVSYIPY
FT                   ILGLILSVIGLVNQFTTTLSMVGTILILIQAALYGFAFYKAKTLNEKGDDTDQAML"
FT   misc_feature    complement(order(310756..310824,310837..310896,
FT                   310930..310998,311068..311136))
FT                   /locus_tag="SpyM50283"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50283 by TMHMM2.0 at aa 17-39, 63-85, 97-116 and
FT                   121-143"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(311038..311184)
FT                   /locus_tag="SpyM50283"
FT                   /note="Signal peptide predicted for SpyM50283 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.855) with cleavage
FT                   site probability 0.821 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             complement(311275..313728)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50284"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2RCQ3"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ3"
FT                   /protein_id="CAM29626.1"
FT                   /translation="MEYVFTGTVDRIIFENQANFFKILLLAIEDTDSDIDDFEIIITGT
FT                   MADIIEGDDYTFWGELTQHPKYGQQLKLSRYQKIKPSSSGLVNYLSSDHFKGIGKKTAE
FT                   KIIALYGHNTIDHILEDPSKLETISGLSKANRQAFVAKLKLNYGTEQLIAGLVELGLSN
FT                   RFAFQAFEKYKEEALDLVKENPYQLVEDLQGFGFKMADALAENLGIESDSPKRFRAALL
FT                   HCLLEESINRGDTYVQARQLLDFAITLLEDARQVECDPTAVAEQLSELIIEGKIKNSDT
FT                   KLFDASLYFAEEGIANNISRLLDTPLSQSFSHDTIQTTIQAVQEDFAITYDQVQQEAIA
FT                   KALTSKVFLLTGGPGTGKTTVIRGILQAYANLHQIDLDKKDLPILLAAPTGRAARRMNE
FT                   LTGLPSATIHRHLGLNGDNDYQAMEDYLDCDLLIVDEFSMVDTWLANQLLGAINSTTQV
FT                   IIVGDSDQLPSVGPGQVLSDLLKVNSLPQIALQKIFRQSQESTIVDLADQMRRGILAAD
FT                   FRDKKADRSYFEAQAAFIPDMIQKIVLSAIKSGIPAEEIQILAPMYKGQAGINHLNQLM
FT                   QELLNPLQGQTEFLFNDTYFRKGDKVLHLVNDAQLNVFNGDIGYITDLIPAKYTESKQD
FT                   ELILDFDGSEVTYPRNEWLKLTLAYAMSIHKSQGSEFQVVILPITRQSGRLLQRNVIYT
FT                   AITRSKSKLILLGEYTAFEYAIKHEGDKRQTYLIERFQEQSDLASSQPNQELKSKEQTS
FT                   LFSNTATLEDDSQKSSSQSTNSNPTENSQSDNDDFRLTPENYSTIDSMIGLTESDIALF
FT                   FQKKS"
FT   misc_feature    complement(312652..312675)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(313786..314379)
FT                   /transl_table=11
FT                   /gene="spi"
FT                   /gene_synonym="spsB"
FT                   /locus_tag="SpyM50285"
FT                   /product="putative signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="GOA:A2RCQ4"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="InterPro:IPR028360"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ4"
FT                   /protein_id="CAM29627.1"
FT                   /translation="MKQFIKEWGPFTLFLILFGLSRLFLWQAVKVDGHSMDPTLAHGER
FT                   LIVFNQARIDRFDIVVAQEEENGQKKEIVKRVIGLPGDTISYNDDTLYINGKKTVEPYL
FT                   AEYLKQFKNDKLQKTYAYNTLFQQLAETSDAFTTNSEGQTRFEMSVPKGEYLLLGDDRI
FT                   VSRDSREVGSFKKENLIGEVKARFWPLNKMTVFN"
FT   misc_feature    complement(314089..314292)
FT                   /gene="spi"
FT                   /gene_synonym="spsB"
FT                   /locus_tag="SpyM50285"
FT                   /note="HMMPfam hit to PF00717, Peptidase S24-like, score
FT                   1.8e-22"
FT                   /inference="protein motif:HMMPfam:PF00717"
FT   misc_feature    complement(314119..314157)
FT                   /note="PS00760 Signal peptidases I lysine active site"
FT                   /inference="protein motif:Prosite:PS00760"
FT   misc_feature    complement(314260..314283)
FT                   /note="PS00501 Signal peptidases I serine active site"
FT                   /inference="protein motif:Prosite:PS00501"
FT   misc_feature    complement(314302..314361)
FT                   /gene="spi"
FT                   /gene_synonym="spsB"
FT                   /locus_tag="SpyM50285"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50285 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(314390..315292)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50286"
FT                   /product="ribonuclease HIII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="GOA:A2RCQ5"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR024568"
FT                   /protein_id="CAM29628.1"
FT                   /translation="MNTLVLKIDTILSKHLKKQLAPYTISSQNTYVAFAAKKNGVTVLL
FT                   YKSGKLVLQGNGANALAQELNLPVAKTVFEASNNSQDIPIIGSDEVGNGSYFGGIAVVA
FT                   SFVDPKDHSFLKKLGVDDSKKLSDKTIQQIAPLLEKQIPHQSLLLSPKKYNELVGKSKP
FT                   YNAISIKVALHNQAIFLLLQKGIQPKQIVIDAFTSQSNYEKHLKKEKNHFPNPLTFQEK
FT                   AESHYLAVAVSSIIARNLFLDNLDQLGQDLGYQLPSGAGSASDKVASQLLAAYGMSSLE
FT                   YSAKLHFANTHKAQALLTK"
FT   misc_feature    complement(314420..315037)
FT                   /locus_tag="SpyM50286"
FT                   /note="HMMPfam hit to PF01351, Ribonuclease HII, score
FT                   2.7e-63"
FT                   /inference="protein motif:HMMPfam:PF01351"
FT   CDS             315449..315757
FT                   /transl_table=11
FT                   /locus_tag="SpyM50287"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ6"
FT                   /protein_id="CAM29629.1"
FT                   /translation="MKSINRYKFTFGEKTLTLTTDKDNLFMEEVERVAKEKYQALKNHL
FT                   PEADDETIAILMAINTLSTQLSREIAIEKMEAEILDLRQKTLVGLQEKANQIDVNEV"
FT   CDS             315760..316305
FT                   /transl_table=11
FT                   /locus_tag="SpyM50288"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RCQ7"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ7"
FT                   /protein_id="CAM29630.1"
FT                   /translation="MLSLLIVLVLTWNFYIGYSRGIILQSFYVLGALLSLLVANRFYIG
FT                   LAHKLTLWIPYSNPVEGTSVFFFKSVDIFVLDKVYYAGLAFFIIFLLGYALSRFLGIFV
FT                   HFLLLDYFDNQWTKCLSGGLALLVSLLFLNMLLSIFATVPMPFLQHYLHSSFLARLVIE
FT                   HLPPLTIIIQKLWIQAII"
FT   misc_feature    315760..316281
FT                   /locus_tag="SpyM50288"
FT                   /note="HMMPfam hit to PF02674, Colicin V production
FT                   protein, score 1.2e-63"
FT                   /inference="protein motif:HMMPfam:PF02674"
FT   misc_feature    order(315823..315891,315994..316062,316120..316188)
FT                   /locus_tag="SpyM50288"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50288 by TMHMM2.0 at aa 22-44, 79-101 and 121-143"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             316454..318793
FT                   /transl_table=11
FT                   /gene="mutS2"
FT                   /locus_tag="SpyM50289"
FT                   /product="putative DNA mismatch repair protein"
FT                   /db_xref="GOA:A2RCQ8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29631.1"
FT                   /translation="MNNKILEQLEFNKVKELLLPYLKTEQSQEELLELEPMTEASKIEK
FT                   SFNEISDMEQIFVEHHSFGIVSLSSISESLKRLELSADLNIQELLAIKKVLQSSSDMIH
FT                   FYSDLDNVSFQSLDRLFENLEQFPNLQGSFQAINDGGFLEHFASPELERIRRQLTNSER
FT                   RVRQILQDMLKEKAELLSENLIASRSGRSVLPVKNTYRNRISGVVHDISSSGSTVYIEP
FT                   RAVVTLNEEITQLRADERHEEGRILHAFSDLLRPHVATIRNNAWILGHLDFVRAKYLFM
FT                   SDNKATIPKISNDSTLALINVRHPLLSNPVANDLHFDHDLTAIVITGPNTGGKTIMLKT
FT                   LGLAQLMGQSGLPVLADKGSKIAVFNNIFADIGDEQSIEQSLSTFSSHMTHIVSILNEA
FT                   DHNSLVLFDELGAGTDPQEGASLAMAILEHLRLSHIKTMATTHYPELKAYGIETNFVEN
FT                   ASMEFDAETLSPTYRFMQGVPGRSNAFEIASRLGLAPFIVKQAKQMTDSDSDVNRIIEQ
FT                   LEAQTLETRRRLDHIKEVEQENLKFNRAVKKLYNEFSHERDKELEKIYQEAQEIVDMAL
FT                   NESDTILKKLNDKSQLKPHEIIDAKAQIKKLAPQVDLSKNKVLNKAKKIKAARAPRIGD
FT                   DIIVTSYGQRGTLTSQLKDGRWEAQVGIIKMTLTHDEFTLVRVQEEQKVKNKQINVVKK
FT                   ADSSGPRARLDLRGKRYEEAMQELDHFIDQALLNNMGQVDIIHGIGTGVIREGVTKYLR
FT                   RHKHVKHFAYAPQNAGGSGATIVTLG"
FT   misc_feature    317309..318016
FT                   /gene="mutS2"
FT                   /locus_tag="SpyM50289"
FT                   /note="HMMPfam hit to PF00488, MutS domain V, score
FT                   1.4e-17"
FT                   /inference="protein motif:HMMPfam:PF00488"
FT   misc_feature    317435..317458
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    318563..318790
FT                   /gene="mutS2"
FT                   /locus_tag="SpyM50289"
FT                   /note="HMMPfam hit to PF01713, Smr domain, score 7.5e-38"
FT                   /inference="protein motif:HMMPfam:PF01713"
FT   CDS             318797..319297
FT                   /transl_table=11
FT                   /locus_tag="SpyM50290"
FT                   /product="putative PAP2 superfamily protein"
FT                   /db_xref="GOA:A2RCQ9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCQ9"
FT                   /protein_id="CAM29632.1"
FT                   /translation="MESYEHFYAKLSQPFRKSPQLIILLNVLLKIITAMMYILYPSFLI
FT                   FTLWQGMTFQLWLRLLIIPAVGFIALSYIRKRLDFPRPYEKWNIKPLIDKDTKGRSMPS
FT                   RHVFSATMISMCLLRYYVYFGIVCLILSVLLAICRVIAGIHYPKDVIVGYLIGLMLGLC
FT                   LLI"
FT   misc_feature    order(318857..318916,318959..319018,319157..319225)
FT                   /locus_tag="SpyM50290"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50290 by TMHMM2.0 at aa 21-40, 55-74 and 121-143"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    318911..319291
FT                   /locus_tag="SpyM50290"
FT                   /note="HMMPfam hit to PF01569, PAP2 superfamily, score
FT                   0.0002"
FT                   /inference="protein motif:HMMPfam:PF01569"
FT   misc_feature    319283..319294
FT                   /note="PS00294 Prenyl group binding site (CAAX box)"
FT                   /inference="protein motif:Prosite:PS00294"
FT   CDS             319378..319692
FT                   /transl_table=11
FT                   /locus_tag="SpyM50291"
FT                   /product="putative thioredoxin"
FT                   /db_xref="GOA:A2RCR0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR0"
FT                   /protein_id="CAM29633.1"
FT                   /translation="MALEVTDATFVEETKEGLVLIDFWATWCGPCRMQTPILEQLSQEI
FT                   DEDELKILKMDVDENPETARQFGIMSIPTLMFKKDGEVVKQVAGVHTKDQLKAIIAELS
FT                   "
FT   misc_feature    319378..319689
FT                   /locus_tag="SpyM50291"
FT                   /note="HMMPfam hit to PF00085, Thioredoxin, score 1.7e-32"
FT                   /inference="protein motif:HMMPfam:PF00085"
FT   misc_feature    319435..319491
FT                   /note="PS00194 Thioredoxin family active site"
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS             complement(319744..320331)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50292"
FT                   /product="putative DNA-binding membrane protein"
FT                   /db_xref="GOA:A2RCR1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR1"
FT                   /protein_id="CAM29634.1"
FT                   /translation="MEIGQQMIRYRKQQALSQEELVEKVYVSRQSISNWENDKTYPDIH
FT                   SLLLLSQIFQVSLDQLIKGDIEKMKYTITQVDKKNFERDTKVMVTLMILLMISSYPLVY
FT                   FLEWLGLGIFVLLSIITMTYANRVERFKKKYDVQPYKEILAVSSGKLLDEIEKREERAK
FT                   LPYQKPLIVTVFFLITVAIFFASRFMFTWLFH"
FT   misc_feature    complement(order(319756..319824,319957..320010,
FT                   320020..320073))
FT                   /locus_tag="SpyM50292"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50292 by TMHMM2.0 at aa 87-104, 108-125 and 170-192"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(320149..320313)
FT                   /locus_tag="SpyM50292"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   4.3e-13"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    complement(320221..320286)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2111.000, SD 6.38 at aa 16-37, sequence
FT                   LSQEELVEKVYVSRQSISNWEN"
FT   CDS             complement(320508..321632)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50293"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /note="Possible alternate upstream translational start
FT                   site"
FT                   /db_xref="GOA:A2RCR2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR2"
FT                   /protein_id="CAM29635.1"
FT                   /translation="MWDNETIASFRRTLLGWYDQEKRDLPWRRTTNPYYIWVSEIMLQQ
FT                   TQVNTVIPYYKRFLEWFPQIKDLADAPEEQLLKAWEGLGYYSRVRNMQKAAQQVMVDFG
FT                   GIFPHTYDDIASLKGIGPYTAGAIASISFNLPEPAVDGNVMRVMARLFEVNYDIGDPKN
FT                   RKIFQAIMEILIDPDRPGDFNQALMDLGTDIESAKTPRPDESPIRFFNAAYLNGTYGKY
FT                   PIKNPKKKPKPMRIQAFVIHNQNGQYLLEKNTKGRLLGGFWSFPIIETSPLSQQLDLFD
FT                   DNQSNPIIWQTQNETFEREYQLKPQWTDNHFPNIKHTFSHQKWTIELIEGVVKATDLPN
FT                   APHLKWVAIEDFSLYPFATPQKKMLETYLKQKNV"
FT   misc_feature    complement(321114..321521)
FT                   /locus_tag="SpyM50293"
FT                   /note="HMMPfam hit to PF00730, HhH-GPD superfamily base
FT                   excision DNA repair, score 1.4e-15"
FT                   /inference="protein motif:HMMPfam:PF00730"
FT   misc_feature    complement(321240..321329)
FT                   /locus_tag="SpyM50293"
FT                   /note="HMMPfam hit to PF00633, Helix-hairpin-helix
FT                   motif,score 9e-08"
FT                   /inference="protein motif:HMMPfam:PF00633"
FT   CDS             321830..322123
FT                   /transl_table=11
FT                   /locus_tag="SpyM50294"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR3"
FT                   /protein_id="CAM29636.1"
FT                   /translation="MFQKLKNLIDRYSWFVFIMMILVLFLNYIYPFDPSLSGLQLEWLI
FT                   MTQVFPGLGIVCAMVAIIFKKFNLFVLALILYFALWLKLFLAFSFFTYFLGV"
FT   misc_feature    order(321866..321925,321953..322021,322034..322102)
FT                   /locus_tag="SpyM50294"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50294 by TMHMM2.0 at aa 13-32, 42-64 and 69-91"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             322296..322586
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="SpyM50295"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="GOA:A2RCR4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /protein_id="CAM29637.1"
FT                   /translation="MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEK
FT                   RRLAYEINDFREGLYHIVNLEATDAAALNEFDRLSKINGDILRHMIVKLDA"
FT   misc_feature    322299..322577
FT                   /gene="rpsF"
FT                   /locus_tag="SpyM50295"
FT                   /note="HMMPfam hit to PF01250, Ribosomal protein S6, score
FT                   3.7e-29"
FT                   /inference="protein motif:HMMPfam:PF01250"
FT   CDS             322608..323099
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SpyM50296"
FT                   /product="single strand binding protein (SSB)"
FT                   /note="Similar to SpyM50487, 72.393% identity (83.688%
FT                   ungapped) in 163 aa overlap"
FT                   /db_xref="GOA:A2RCR5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR5"
FT                   /protein_id="CAM29638.1"
FT                   /translation="MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGERE
FT                   ADFINCVIWRQPAENLANWAKKGALIGITGRIQTRNYENQQGQRVYVTEVVADNFQMLE
FT                   SRATREGGSTGSFNGGFNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDDLPF
FT                   "
FT   misc_feature    322611..322919
FT                   /gene="ssb"
FT                   /locus_tag="SpyM50296"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 9e-36"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS             323264..323503
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="SpyM50297"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="GOA:A2RCR6"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /protein_id="CAM29639.1"
FT                   /translation="MAQQRRGGFKRRKKVDFIAANKIEYVDYKDTELLSRFVSERGKIL
FT                   PRRVTGTSAKNQRKVTTAIKRARVMALMPYVNED"
FT   misc_feature    323321..323482
FT                   /gene="rpsR"
FT                   /locus_tag="SpyM50297"
FT                   /note="HMMPfam hit to PF01084, Ribosomal protein S18,score
FT                   5.7e-34"
FT                   /inference="protein motif:HMMPfam:PF01084"
FT   misc_feature    323339..323410
FT                   /note="PS00057 Ribosomal protein S18 signature"
FT                   /inference="protein motif:Prosite:PS00057"
FT   CDS             complement(323634..324290)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50298"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR7"
FT                   /protein_id="CAM29640.1"
FT                   /translation="MELQELTKKNQEFIHTATNKLIQDGKSDEDIKLILEEAIPAILEN
FT                   QKKGVTARNLLGTPTAWAASFSQDPSQRAAETDKNTNPWLMWLDTSLLFIGIVALLNGI
FT                   MTFFNTNATVTGLISLLALGFGGGASMYATYYFIYRHLGKDKSLRPSWFKIIAALSLAM
FT                   LIWIALYSATAFLPTSLNPQLPPLALLIIGGVSLALRYYLQRKYNIQNTMSPVNK"
FT   misc_feature    complement(323655..324290)
FT                   /locus_tag="SpyM50298"
FT                   /note="HMMPfam hit to PF06570, Protein of unknown function
FT                   (DUF1129), score 2.3e-154"
FT                   /inference="protein motif:HMMPfam:PF06570"
FT   misc_feature    complement(order(323682..323741,323769..323837,
FT                   323874..323942,323970..324038))
FT                   /locus_tag="SpyM50298"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50298 by TMHMM2.0 at aa 85-107, 117-139, 152-174 and
FT                   184-203"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(324423..325367)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50299"
FT                   /product="CorA-like Mg2+ transporter protein"
FT                   /db_xref="GOA:A2RCR8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR8"
FT                   /protein_id="CAM29641.1"
FT                   /translation="MKQMFLSSAIEFKEIETFEPGAWIKLVNPSQEESLEIADQFNIDI
FT                   SDLRAPLDVEETSRIAVEDDYTLIIVDVPIYEERNNKSYYITMPLGIIVTENAVITTCL
FT                   HDMTLFDHFHNRRVKNFYTFMKTRFVFQILYRNAELFLTALRTIDRQSERLEAQLEAAT
FT                   RNEELIDMMELEKSIVYLKASLKFNERIVKKLSSSTSSLKKYIEDEDLLEDTLIETQQA
FT                   IEMAGIYENVLNAMTETTASIINNNQNTIMKTLALMTMALDIPTVIFSAYGMNFQNNWL
FT                   PLNGLEHAFWYITLIAMLLSSFVVIYFIRKKWF"
FT   misc_feature    complement(324426..325307)
FT                   /locus_tag="SpyM50299"
FT                   /note="HMMPfam hit to PF01544, CorA-like Mg2+ transporter
FT                   protein, score 3.2e-07"
FT                   /inference="protein motif:HMMPfam:PF01544"
FT   misc_feature    complement(order(324444..324503,324546..324605))
FT                   /locus_tag="SpyM50299"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50299 by TMHMM2.0 at aa 255-274 and 289-308"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             325570..328398
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SpyM50300"
FT                   /product="UvrABC system protein A (UvrA protein)"
FT                   /db_xref="GOA:A2RCR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCR9"
FT                   /protein_id="CAM29642.1"
FT                   /translation="MQNKIIIHGARAHNLKNIDVEIPRDKLVVVTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSAYARQFLGNMEKPDVDSIDGLSPAISIDQKTTSKNPRSTVGTVTE
FT                   INDYLRLLYARVGTPYCINGHGAITASSAEQIVEQVLALPERTRMQILAPIVRRKKGQH
FT                   KTIFEKIQKDGYVRVRVDGDIFDVTEVPELSKSKMHNIEVVIDRLVNKDGIRSRLFDSV
FT                   EAALRLGDGYLMIDTMDGNELLFSEHYSCPVCGFTVPELEPRLFSFNAPFGSCPTCDGL
FT                   GIKLEVDLDLVVPDPSKSLKEGALAPWNPISSNYYPTMLEQAMASFGVDMDTPFEALTE
FT                   EERDLVLYGSGDREFHFHYVNDFGGERNIDIPFEGVVTNVNRRYHETNSDYTRNVMRGY
FT                   MNELTCATCHGYRLNDQALCVHVGGEEGPHIGQISELSIADHLQLLEELELTENESTIA
FT                   KPIVKEIHDRLTFLNNVGLNYLTLSRAAGTLSGGESQRIRLATQIGSNLSGVLYILDEP
FT                   SIGLHQRDNDRLIESLKKMRDLGNTLIVVEHDEDTMMQADWLIDVGPGAGEFGGEIIAS
FT                   GTPKQVAKNKKSITGQYLSGKKFIPVPLERRSGNGRFIEIKGAAQNNLQSLDVRFPLGK
FT                   FIAVTGVSGSGKSTLVNSILKKAVAQKLNRNADKPGKYHSISGIEHIERLIDIDQSPIG
FT                   RTPRSNPATYTGVFDDIRDLFAQTNEAKIRGYKKGRFSFNVKGGRCEACSGDGIIKIEM
FT                   HFLPDVYVPCEVCHGRRYNSETLEVHYKEKNIAEVLDMTVDDALVFFSAIPKIARKIQT
FT                   IKDVGLGYVTLGQPATTLSGGEAQRMKLASELHKRSTGKSLYILDEPTTGLHTDDIARL
FT                   LKVLERFVDDGNTVLVIEHNLDVIKSADHIIDLGPEGGVGGGQIVATGTPEEVAQVKES
FT                   YTGHYLKVKLQQ"
FT   misc_feature    325663..325686
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    326782..326799
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    327034..327078
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    327469..328284
FT                   /gene="uvrA"
FT                   /locus_tag="SpyM50300"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.3e-31"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    327490..327513
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    327856..327873
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    328057..328101
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             328514..329587
FT                   /transl_table=11
FT                   /locus_tag="SpyM50301"
FT                   /product="putative metallopeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /db_xref="GOA:A2RCS0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS0"
FT                   /protein_id="CAM29643.1"
FT                   /translation="MSGFLEQRLGHCLRQMAEKGLEALLVTHLTNSYYLTGFSGTAATV
FT                   LITAKRRVLITDSRYTLLAKASVEGFDIIESRTPLKVVAELLGADQIDCLGFEDQVSFS
FT                   FYQGMQAELSGITLLAQSGFVEHLRLIKDVSEIETIAKACSISDKAFEDALDFIKPGTT
FT                   TERDLANFLDFRMRQYGASGTSFDIIVASGYRSAMPHGRASDKVIQNKESLTMDFGCYY
FT                   NHYVSDMTRTIHIGQVTDEEREIYALVLAANKALIAKASAGMTYSDFDGIPRQLITEAG
FT                   YGSHFTHGIGHGIGLDIHENPFLGKSEQLLQAGMVVTDEPGIYLDNKYGVRIEDDLVIT
FT                   KTGCQVLTLAPKELIVL"
FT   misc_feature    328925..329560
FT                   /locus_tag="SpyM50301"
FT                   /note="HMMPfam hit to PF00557, metallopeptidase family M24,
FT                   score 9.2e-61"
FT                   /inference="protein motif:HMMPfam:PF00557"
FT   misc_feature    329375..329413
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00491"
FT   CDS             329622..330083
FT                   /transl_table=11
FT                   /locus_tag="SpyM50302"
FT                   /product="putative cytidine and deoxycytidylate deaminase"
FT                   /db_xref="GOA:A2RCS1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS1"
FT                   /protein_id="CAM29644.1"
FT                   /translation="MTNRLSWQDYFMANAELISKRSTCDRAFVGAVLVKDNRIIATGYN
FT                   GGVSATDNCNEAGHYMEDGHCIRTVHAEMNALIQCAKEGISTDGTEIYVTHFPCINCTK
FT                   ALLQAGITKITYKAHYRPHPFAIELMEKKGVAYVQHDVPQIVLGGDKEQ"
FT   misc_feature    329637..329975
FT                   /locus_tag="SpyM50302"
FT                   /note="HMMPfam hit to PF00383, Cytidine and deoxycytidylate
FT                   deaminase, score 3.9e-33"
FT                   /inference="protein motif:HMMPfam:PF00383"
FT   misc_feature    329832..329939
FT                   /note="PS00903 Cytidine and deoxycytidylate deaminases
FT                   zinc-binding region signature"
FT                   /inference="protein motif:Prosite:PS00903"
FT   CDS             330179..330736
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="SpyM50303"
FT                   /product="elongation factor P (EF-P)"
FT                   /db_xref="GOA:A2RCS2"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /protein_id="CAM29645.1"
FT                   /translation="MIEASKLKAGMTFEAEGKLIRVLEASHHKPGKGNTIMRMKLRDVR
FT                   TGSTFDTTYRPDEKFEQAIIETVPAQYLYKMDDTAYFMNTDTYDQYEIPVANVEQELLY
FT                   ILENSDVKIQFYGSEVIGVTVPTTVELTVAETQPSIKGATVTGSGKPATLETGLVVNVP
FT                   DFIEAGQKLIINTAEGTYVSRA"
FT   misc_feature    330179..330733
FT                   /gene="efp"
FT                   /locus_tag="SpyM50303"
FT                   /note="HMMPfam hit to PF01132, Elongation factor P
FT                   (EF-P),score 2.5e-76"
FT                   /inference="protein motif:HMMPfam:PF01132"
FT   misc_feature    330626..330685
FT                   /note="PS01275 Elongation factor P signature"
FT                   /inference="protein motif:Prosite:PS01275"
FT   CDS             330782..331171
FT                   /transl_table=11
FT                   /locus_tag="SpyM50304"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS3"
FT                   /protein_id="CAM29646.1"
FT                   /translation="MTTEHIGEIVISPRVLEVITGIATTQVEGVHSLHNKKMADSFNKA
FT                   SLGKGVYLQTQEDGSVTADIYVYLQYGVKVPTVSMAIQKAVKSAVYDMAEVTISAVNIH
FT                   VEGIVAEKTPKPDLKSLFDEDFLDD"
FT   misc_feature    330794..331108
FT                   /locus_tag="SpyM50304"
FT                   /note="HMMPfam hit to PF03780, Protein of unknown function
FT                   (DUF322), score 4.5e-45"
FT                   /inference="protein motif:HMMPfam:PF03780"
FT   CDS             331164..331616
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SpyM50305"
FT                   /product="N utilization substance protein B homolog (NusB
FT                   protein)"
FT                   /db_xref="GOA:A2RCS4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /protein_id="CAM29647.1"
FT                   /translation="MTNSFQNSRRDLRERAFQALFNIEMGAELLAASQFAYGYDKVTGE
FT                   DAQVLELPIFLLSLVTGVNNHKEELDNLISTHLKKGWSLERLTLTDKTLLRLGLFEIKY
FT                   FDETPDRVALNEIIEVAKKYSDETSAKFINGLLSQYVSEAPSANKS"
FT   misc_feature    331191..331595
FT                   /gene="nusB"
FT                   /locus_tag="SpyM50305"
FT                   /note="HMMPfam hit to PF01029, NusB family, score 9.2e-31"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   CDS             complement(331757..332722)
FT                   /transl_table=11
FT                   /gene="scrR"
FT                   /locus_tag="SpyM50306"
FT                   /product="putative sucrose operon repressor"
FT                   /db_xref="GOA:A2RCS5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS5"
FT                   /protein_id="CAM29648.1"
FT                   /translation="MVAKLTDVAALAGVSPTTVSRVINKKGYLSQKTVNKVNKAMRELG
FT                   YKPNNLARSLQGKSTQLIGLIFPNISNIFYAELIEHLEIELFKQGYKTIICNSEHNPVK
FT                   EREYLEMLAANQVDGIISSSHNLGIEDYERVEAPIVAFDRNLAPNIPVISSDNFEGGKL
FT                   AAQTLQKHGCQNIVMITGNDNSDSPTGLRQLGFNYQLKRSAEIIKLPNNLSPVRREMEI
FT                   KSILATRKPDGLFVSDDLTAILIMKVAKQLHITIPEDMKVIGYDGTTFIQQYVPQLATI
FT                   RQPIDEIAKLSVEILIKKIKKEKTSKDYILPITLLPGASI"
FT   misc_feature    complement(331766..332545)
FT                   /gene="scrR"
FT                   /locus_tag="SpyM50306"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 1.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   misc_feature    complement(332546..332569)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(332639..332716)
FT                   /gene="scrR"
FT                   /locus_tag="SpyM50306"
FT                   /note="HMMPfam hit to PF00356, Bacterial regulatory
FT                   proteins, lacI fami, score 1.1e-10"
FT                   /inference="protein motif:HMMPfam:PF00356"
FT   misc_feature    complement(332651..332716)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1960.000, SD 5.86 at aa 3-24, sequence
FT                   AKLTDVAALAGVSPTTVSRVIN"
FT   misc_feature    complement(332654..332710)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS             complement(332727..334166)
FT                   /transl_table=11
FT                   /gene="scrB"
FT                   /locus_tag="SpyM50307"
FT                   /product="putative sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="GOA:A2RCS6"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS6"
FT                   /protein_id="CAM29649.1"
FT                   /translation="MDLPQAIRYRPYKEWSSKDYQAITEKMAQSPWHSQFHVEPKTGLL
FT                   NDPNGFSYFNGRYHLFYQNWPYGAAHGLKQWVHMTSTDLVHFTETRSRLLPDHAHDSHG
FT                   AYSGSAYAIDDKLFLFYTGNVRDANWVRTPLQVGAWMDKQGNISKIPQVLIEQPDDVTE
FT                   HFRDPQLFSYQGQFYAIIGAQGLDGKGKIKLYKAVDNHVDNWRFIADLDFDDSGTEYMI
FT                   ECPNLVFVDDKPVLIFSPQGLAKADLDYQNIYPNTYKIFESFNPETGQLLGGGGLQNLD
FT                   FGFEAYATQAFSSPDGRVLAVSWIGLPDIDYPTDRYDYQGALSLVKELRIKDGILYQTP
FT                   VSALQNLRGPAELFHNKIDSSNCYELELTIPGQKKLDLLLFADQKGNGLRFKVDTTKGQ
FT                   LSIDRSRAGVQYAQDYGTVRSCQIPQGHVTLNVYVDNSILEIFINQGQKVLTSRVFPTQ
FT                   GQTGIQVVEGQAFGHYYEMRY"
FT   misc_feature    complement(332829..334058)
FT                   /gene="scrB"
FT                   /locus_tag="SpyM50307"
FT                   /note="HMMPfam hit to PF00251, Glycosyl hydrolases
FT                   family,score 9.1e-153"
FT                   /inference="protein motif:HMMPfam:PF00251"
FT   misc_feature    complement(334017..334058)
FT                   /note="PS00609 Glycosyl hydrolases family 32 active site"
FT                   /inference="protein motif:Prosite:PS00609"
FT   CDS             334408..336291
FT                   /transl_table=11
FT                   /gene="scrA"
FT                   /locus_tag="SpyM50308"
FT                   /product="putative sucrose-specific phosphotransferase
FT                   system (PTS), IIABC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCS7"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS7"
FT                   /protein_id="CAM29650.1"
FT                   /translation="MDNRQIATEVIEALGGRENVRSVAHCATRLRVMVHDEGKIDKEKA
FT                   EAIDKVKGAFFNSGQYQMIFGTGTVNNIYGEVVALGLPTSSTSEQKAEAGKQGNIFQRA
FT                   IRTFGDVFVPIIPAIVATGLFMGVRGLVTQPAIMDLFGVHEYGENFLMYTRILTDTAFV
FT                   YLPALVAWSAFRVFGGNPIIGIVLGLMLVSNELPNAWVVASGGDVKPLTFFGFVPVVGY
FT                   QGTVLPAFFVGLVGAKLEKWLHKKVPEALDLLVTPFLTFAIMSILGLFVIGPVFHSLEN
FT                   LVLAGTQAVLHLPFGIAGLIVGGIQQLIVVTGIHHIFNFLEAQLIANTGKDPFNAYLTA
FT                   ATVAQAGATLAVAVKTKSPKLKGLAFPSTLSALLGITEPAIFGVNLRYPKVFVSGLIGG
FT                   ALGGWVAGLFGIAGTGFGITVLPGTLLYLNGQLLQYLVTMLVGLGVAFAIAYTWGYQDR
FT                   ETLPLPAVEVDQTADQPALAEETLYSPLNGTVVDLAAVSDPVFSSGAMGQGLAIKPEDN
FT                   TLYSPVDGKVEIVFETGHAYAITSSQGAEVLLHIGIDTVSMAGDGFESLVAVGQAVKKG
FT                   DLLGHFDPSKIAEAGLDDTTMMIVTNSADYQSVDILAQGHILIGDQVALIK"
FT   misc_feature    334426..334530
FT                   /gene="scrA"
FT                   /locus_tag="SpyM50308"
FT                   /note="HMMPfam hit to PF00367, phosphotransferase
FT                   system,EIIB, score 8e-19"
FT                   /inference="protein motif:HMMPfam:PF00367"
FT   misc_feature    334462..334515
FT                   /note="PS01035 PTS EIIB domains cysteine phosphorylation
FT                   site signature"
FT                   /inference="protein motif:Prosite:PS01035"
FT   misc_feature    334732..335604
FT                   /gene="scrA"
FT                   /locus_tag="SpyM50308"
FT                   /note="HMMPfam hit to PF02378, Phosphotransferase
FT                   system,EIIC, score 1e-45"
FT                   /inference="protein motif:HMMPfam:PF02378"
FT   misc_feature    order(334738..334803,334861..334929,334948..335016,
FT                   335044..335112,335167..335235,335278..335346,
FT                   335407..335469,335497..335565,335578..335646,
FT                   335704..335772)
FT                   /gene="scrA"
FT                   /locus_tag="SpyM50308"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SpyM50308 by TMHMM2.0 at aa
FT                   111-132,152-174,181-203,213-235, 254-276, 291-313,
FT                   334-354,364-386,391-413 and 433-455"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    335302..335394
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    335899..336213
FT                   /gene="scrA"
FT                   /locus_tag="SpyM50308"
FT                   /note="HMMPfam hit to PF00358,phosphoenolpyruvate-dependent
FT                   sugar phosph, score 6.1e-59"
FT                   /inference="protein motif:HMMPfam:PF00358"
FT   misc_feature    336037..336075
FT                   /note="PS00371 PTS EIIA domains phosphorylation site
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00371"
FT   CDS             336522..339494
FT                   /transl_table=11
FT                   /locus_tag="SpyM50309"
FT                   /product="endoglycosidase (EndoS)"
FT                   /EC_number="3.2.1.96"
FT                   /db_xref="GOA:A2RCS8"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS8"
FT                   /protein_id="CAM29651.1"
FT                   /translation="MDKHLLVKRTLGCVCAATLMGAALATHHDSLNTVKAEEKTVQVQK
FT                   ELSSIDSLHYLSENSKKEFKEELSKAGQESQKVKEILAKAQQADKQAQELAKMKIPEKI
FT                   PMKPLHGPLYGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKE
FT                   LATKHVPKLNKQGTRVIRTIPWRFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYV
FT                   YKYNLDGLDVDVEHDSIPKVNGEASDENLKRSIDVFEEIGKLIGPKGVDKSRLFIMDST
FT                   YMADKNPLIERGAPYIDLLLVQVYGARGEQGEFQNDTKLVTETPEERWQGYSKYIRPEQ
FT                   YMIGFSFYEERAGSGNLWYDINSRKDEDTANGINTDITGTRAERYARWQPKTGGIKGGI
FT                   FSYAIDRDGVAHQPKQIAEKDKQNVKNNQPQIPEITDNIFHSDYSVSKALKTVMLKDKS
FT                   YDLIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAIQSLEGLNKFKKLAQLD
FT                   LIGLSRITKLDQSVLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKE
FT                   LDLSGFDRETLAGLDAATLTSLEKVDISGNKLDLAPGTENRQIFDTMLSTINNHVGSNE
FT                   QTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDLQSQLLFGTVTNQGTLINSEADYKAY
FT                   QNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTTDKTLATDKEETYKVDFFSP
FT                   ADKTKAVHTAKVIVGDEKTMMVNLAEGATVIKSENDENAKKVFNGIMEYNPISTQNRAS
FT                   IIFEMKDPSLAKYWRLFNNSSKGEDDYIKEAKLEVFTGQLNAEADVKTSLEKSDDWQTV
FT                   STYSGQEQVFSHALDNISAKYWRITVDNKKNQYGYVSLPELQILGYPLPNADTIMKTVT
FT                   TAKGLSQQKDKFSQKMLDELKIKEMALETSLNSKIFDVTAINANAGVLKDCIEKRQLLK
FT                   K"
FT   sig_peptide     336522..336629
FT                   /locus_tag="SpyM50309"
FT                   /note="Signal peptide predicted for SpyM50309 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.989 between residues 36 and 37"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    337200..337226
FT                   /note="PS01095 Chitinases family 18 active site"
FT                   /inference="protein motif:Prosite:PS01095"
FT   CDS             339758..340642
FT                   /transl_table=11
FT                   /gene="scrK"
FT                   /locus_tag="SpyM50310"
FT                   /product="fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="GOA:A2RCS9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCS9"
FT                   /protein_id="CAM29652.1"
FT                   /translation="MGKLYGSIEAGGTKFVCAVGDEEFTVVDKTQFPTTTPEETIARTI
FT                   AYFKAFEADLAGMAIGSFGPIDIDPSSETYGYITTTPKSGWANVDLLGQLSAAFKIPFD
FT                   VTTDVNSSAYGEVLARPGVESLVYYTIGTGIGAGAIQHGHFIGGLGHTEAGHTYVMLHP
FT                   DDMAKGFLGVCPFHKGCLEGMAAGPSIEARTGVRGERLDQEADVWDIQAFYIAQAALQA
FT                   TMLYRPQVIVFGGGVMAQEHMVLRVHDKFTTLLSGYLPVPDLTDYIVTPAVADNGSATL
FT                   GNFALAKLAAQGK"
FT   misc_feature    339776..340327
FT                   /gene="scrK"
FT                   /locus_tag="SpyM50310"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 4.9e-71"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   misc_feature    340148..340225
FT                   /note="PS01125 ROK family signature"
FT                   /inference="protein motif:Prosite:PS01125"
FT   CDS             340737..341690
FT                   /transl_table=11
FT                   /gene="pmi"
FT                   /gene_synonym="manA"
FT                   /locus_tag="SpyM50311"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="GOA:A2RCT0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT0"
FT                   /protein_id="CAM29653.1"
FT                   /translation="MSEPLFLKSTMHDRIWGGTKLRDVFAYNIPSDTTGEYWAISAHPN
FT                   GVSTVTNGRYQGQPLNTLYAQEPALFGNPKEEVFPLLTKILDANDWLSVQVHPDDAYGR
FT                   EHEGELGKTECWYIISAEEGSEIVYGHQAKSKEDLRAMIEAGAWDDLLTRVPVKAGDFF
FT                   YVPSGTMHAIGKGILILETQQSSDTTYRVYDFDRKDVNGNLRDLHIEKSIDVLTIGKPE
FT                   NSVPATMVLDNMVATTLVSTPFFTVYKWVTSQMVDMKQAAPYLLVSVLKGQGKLYVDQK
FT                   AYELEKGMHFILPNDVKSWSFDGQLEMIVSHPNQLV"
FT   misc_feature    340749..341675
FT                   /gene="pmi"
FT                   /gene_synonym="manA"
FT                   /locus_tag="SpyM50311"
FT                   /note="HMMPfam hit to PF01238, Phosphomannose isomerase
FT                   type I, score 5e-98"
FT                   /inference="protein motif:HMMPfam:PF01238"
FT   CDS             341824..344343
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /product="putative preprotein SecA subunit"
FT                   /db_xref="GOA:A2RCT1"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29654.1"
FT                   /translation="MANILRKVIENDKGELRKLEKIAKKVESYADQMASLSDRDLQGKT
FT                   LEFKERYQKGETLEQLLPEAFAVVREAAKRVLGLFPYRVQIMGGIVLHNGDVPEMRTGE
FT                   GKTLTATMPVYLNAIAGEGVHVITVNEYLSTRDATEMGEVYSWLGLSVGINLAAKSPAE
FT                   KREAYNCDITYSTNSEVGFDYLRDNMVVRQEDMVQRPLNFALVDEVDSVLIDEARTPLI
FT                   VSGAVSSETNQLYIRADMFVKTLTSVDYVIDVPTKTIGLSDSGIDKAESYFNLSNLYDI
FT                   ENVALTHFIDNALRANYIMLLDIDYVVSEDGEILIVDQFTGRTMEGRRFSDGLHQAIEA
FT                   KEGVRIQEESKTSASITYQNMFRMYKKLAGMTGTAKTEEEEFREVYNMRIIPIPTNRPI
FT                   ARIDHTDLLYPTLESKFRAVVEDVKTRHAKGQPILVGTVAVETSDLISRKLVEAGIPHE
FT                   VLNAKNHFKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGEGVRELGGLCVIGTERHESR
FT                   RIDNQLRGRSGRQGDPGESQFYLSLEDDLMRRFGSDRIKAFLDRMKLDEEDTVIKSGML
FT                   GRQVESAQKRVEGNNYDTRKQVLQYDDVMREQREIIYANRRDVITANRDLGPEIKAMIK
FT                   RTIDRAVDAHARSNRKDAVDAIVTFARTSLVPEESISAKELRGLKDEQIKEKLYQRALA
FT                   IYDQQLSKLRDQEAIIEFQKVLILMIVDNKWTEHIDALDQLRNAVGLRGYAQNNPVVEY
FT                   QAEGFKMFQDMIGAIEFDVTRTMMKAQIHEQERERASQRATTAAPQNIQSQQSANTDDL
FT                   PKVERNEACPCGSGKKFKNCHGRKSFS"
FT   misc_feature    341824..342972
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /note="HMMPfam hit to PF07517, SecA DEAD-like domain,score
FT                   6.5e-151"
FT                   /inference="protein motif:HMMPfam:PF07517"
FT   misc_feature    342499..342840
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /note="HMMPfam hit to PF01043, SecA preprotein
FT                   cross-linking domain, score 9.3e-63"
FT                   /inference="protein motif:HMMPfam:PF01043"
FT   misc_feature    343168..343416
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 0.0063"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   misc_feature    343264..343311
FT                   /note="PS01312 Protein secA signatures"
FT                   /inference="protein motif:Prosite:PS01312"
FT   misc_feature    343531..344166
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /note="HMMPfam hit to PF07516, SecA Wing and Scaffold
FT                   domain, score 2.5e-68"
FT                   /inference="protein motif:HMMPfam:PF07516"
FT   misc_feature    344272..344334
FT                   /gene="secA"
FT                   /locus_tag="SpyM50312"
FT                   /note="HMMPfam hit to PF02810, SEC-C motif, score 6.4e-09"
FT                   /inference="protein motif:HMMPfam:PF02810"
FT   CDS             344459..344815
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="SpyM50313"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="GOA:A2RCT2"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /protein_id="CAM29655.1"
FT                   /translation="MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKR
FT                   RLSYLAGRWSGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHS
FT                   GNYVQASVILEDKK"
FT   misc_feature    344474..344677
FT                   /gene="acpS"
FT                   /locus_tag="SpyM50313"
FT                   /note="HMMPfam hit to PF01648, 4'-phosphopantetheinyl
FT                   transferase superfami, score 1.3e-16"
FT                   /inference="protein motif:HMMPfam:PF01648"
FT   CDS             344812..345912
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="SpyM50314"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="GOA:A2RCT3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /protein_id="CAM29656.1"
FT                   /translation="MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVKADAYG
FT                   HGAVQVSKALLPQVDGYCVSNLDEALQLRQAGIDKEILILGVLLPNELELAVANAITVT
FT                   IASLDWIALARLEKKECQGLKVHVKVDSGMGRIGLRSSKEVNLLIDSLKELGADVEGIF
FT                   THFATADEADDTKFNQQLQFFKKLIAGLEDKPRLVHASNSATSIWHSDTIFNAVRLGIV
FT                   SYGLNPSGSDLSLPFPLQEALSLESSLVHVKMISAGDTVGYGATYTAKKSEYVGTVPIG
FT                   YADGWTRNMQGFSVLVDGQFCEIIGRVSMDQLTIRLSKAYPLGTKVTLIGSNQQKNIST
FT                   TDIANYRNTINYEVLCLLSDRIPRIY"
FT   misc_feature    344833..345498
FT                   /gene="alr"
FT                   /locus_tag="SpyM50314"
FT                   /note="HMMPfam hit to PF01168, Alanine racemase,N-terminal
FT                   domain, score 1.2e-93"
FT                   /inference="protein motif:HMMPfam:PF01168"
FT   misc_feature    344920..344952
FT                   /note="PS00395 Alanine racemase pyridoxal-phosphate
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00395"
FT   misc_feature    345535..345909
FT                   /gene="alr"
FT                   /locus_tag="SpyM50314"
FT                   /note="HMMPfam hit to PF00842, Alanine racemase,C-terminal
FT                   domain, score 6e-64"
FT                   /inference="protein motif:HMMPfam:PF00842"
FT   CDS             345999..347528
FT                   /transl_table=11
FT                   /locus_tag="SpyM50315"
FT                   /product="putative amidase"
FT                   /note="Similar to the C-terminal region of
FT                   SpyM51686,52.521% identity (56.180% ungapped) in 476 aa
FT                   overlap"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT4"
FT                   /protein_id="CAM29657.1"
FT                   /translation="MNKNKLLRVAMLLSLLAPTAESMTVLAQDVMLETHKATTNETSDS
FT                   SSKEENNKNAAPTTSDKTDQGPLDASAETNSNSLVNADDKKRSDSSQSAVGSSDNKAEA
FT                   ENQVDDKSTDHSKPTDHSKPTDQPKPTDQPKPSPSKVDTAPASSLSRQLPEVRTPIQSL
FT                   SPYVSDLDLSEIDIPSVNTYAAYVEHWSGKNAYTHHLLSRRYGIKADQIDSYLKSTGIA
FT                   YDSTRINGEKLLQWEKKSGLDVRAIVAIAMSESSLGTQGIATLLGANMFGYAAFDLDPT
FT                   QASKFNDDSAIVKMTQDTIIKNKNSNFALQDLKAAKFSRGQLNFASDGGVYFTDTTGSG
FT                   KRRAQIMEDLDKWIDDHGGTPAIPAELKVQSSASFASVPAGYKLSKSYDVLGYQASSYA
FT                   WGQCTWYVYNRAKELGYQFDPFMGNGGDWKYKVGYALSKTPKVGYAISFAPGQAGADGT
FT                   YGHVSIVEDVRKDGSILISESNCIGLGKISYRTFTAQQAEQLTYVIGKSKN"
FT   misc_feature    345999..346082
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1"
FT                   /inference="protein motif:Prosite:PS00430"
FT   sig_peptide     345999..346079
FT                   /locus_tag="SpyM50315"
FT                   /note="Signal peptide predicted for SpyM50315 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.769 between residues 27 and 28"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    347145..347510
FT                   /locus_tag="SpyM50315"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 2.3e-48"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS             348019..351846
FT                   /transl_table=11
FT                   /locus_tag="SpyM50316"
FT                   /product="putative iron transport-associated protein"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR006635"
FT                   /db_xref="InterPro:IPR011432"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT5"
FT                   /protein_id="CAM29658.1"
FT                   /translation="MKKISKCAFVAISALVLIQATQTVKSQEPLVQSQLVTTVALTQDN
FT                   RLLVEEIGPYASQSAGKEYYKHIEKVIVDNDVYEKSLEGERTFDINYQGIKINANLIKD
FT                   GKHELTIVNKKDGDILITFIKKGDKVTFISAQKLGTTDHQDSLKKDVLSDKPVPQNQGT
FT                   QKVVKSGKNTANLSLITKLSQEDGAILFPEIDRYSDNKQIKALTQQITKVTVNGTVYKD
FT                   LISDSVKDTNGWVSNMTGLHLGTKAFKDGENTIVISSKGFEDITITVTKKDGQIHFVSA
FT                   KQKQHVTAEDRQSTKLDVTTLEKAIKEADAIIAKESNKDAVKDLAEKLQVIKDSYKEIK
FT                   DSKLLADTHRLLKDTIESYQAGEVSINNLTEGTYTLNFKANKENSEESSMLQGAFDKRA
FT                   KLVVKADGTMEISMLNTALGQFLIDFSIESKGTYPAAVRKQVGQKDINGSYIRSEFTMP
FT                   IDDLDKLHKGAVLVSAMGGQESDLNHYDKYTKLDMTFSKTVTKGWSGYQVETDDKEKGV
FT                   GTERLEKVLVKLGKDLDGDGKLSKTELEQIRGELRLDHYELTDISLLKHAKNITELHLD
FT                   GNQITEIPKELFSQMKQLRFLNLRSNHLTYLDKDTFKSNAQLRELYLSSNFIHSLEGGL
FT                   FQSLHHLEQLDLSKNRIGRLCDNPFEGLSRLTSLGFAENSLEEIPEKALEPLTSLNFID
FT                   LSQNNLALLPKTIEKLRALSTIVASRNHITRIDNISFKNLPKLSVLDLSTNEISNLPNG
FT                   IFKQNNQLTKLDFFNNLLTQVEESVFPDVETLNLDMKFNQIKSVSPKVRALIGQHKLTP
FT                   QKHIAKLEASLDGEKIKYHQAFSLLDLYYWEQKTNSAIDKELVSIEEYQQLLQEKGSDT
FT                   VSLLNDMQVDWSIVIQLQKKASNGQYVTVDEKLLSNDPKDDLTGEFSLKDPGTYRIRKA
FT                   LITKKFATQKEHIYLTSNDILVAKGPHSHQKDLVENGLRALNQKQLRDGIYYLNASMLK
FT                   TDLASESMSNKAINHRVTLVVKKGVSYLEVEFRGIKVGKMLGYLGELSYFVDGYQRDLA
FT                   GKPVGRTKKAEVVSYFTDATGLPLADRYGKNYPKVLRMKLIEQAKKDGLVPLQVFVPIM
FT                   DAISKGSGLQTVFMRLDWASLTTEKAKVVKETNNPQENSHLTSTDQLKGPQNRQQEKTP
FT                   TSPPSAATGIANLTDLLAKKATGQSTQETSKTDDTDKAEKLKQLVRDHQTSIEGKTAKD
FT                   TKTKKSDKKHRSNQQSNGEESSSRYHLIAGLSSFMIVALGFIIGRKTLFK"
FT   sig_peptide     348019..348096
FT                   /locus_tag="SpyM50316"
FT                   /note="Signal peptide predicted for SpyM50316 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.930 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    348196..348387
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF07550, Protein of unknown function
FT                   (DUF1533), score 1.7e-21"
FT                   /inference="protein motif:HMMPfam:PF07550"
FT   misc_feature    348622..348825
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF07550, Protein of unknown function
FT                   (DUF1533), score 1.7e-24"
FT                   /inference="protein motif:HMMPfam:PF07550"
FT   misc_feature    349111..349539
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF05031, Iron Transport-associated
FT                   domain, score 4.5e-53"
FT                   /inference="protein motif:HMMPfam:PF05031"
FT   misc_feature    349612..349650
FT                   /note="PS00018 EF-hand calcium-binding domain"
FT                   /inference="protein motif:Prosite:PS00018"
FT   misc_feature    349723..349794
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.018"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    349795..349866
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1.7"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    349867..349938
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.5"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    349939..350010
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   0.14"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350011..350082
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   4.5"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350083..350151
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   2.8"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350152..350223
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   6.6"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350224..350295
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   1.1"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350296..350367
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF00560, Leucine Rich Repeat, score
FT                   8.9"
FT                   /inference="protein motif:HMMPfam:PF00560"
FT   misc_feature    350932..351423
FT                   /locus_tag="SpyM50316"
FT                   /note="HMMPfam hit to PF05031, Iron Transport-associated
FT                   domain, score 1.7e-47"
FT                   /inference="protein motif:HMMPfam:PF05031"
FT   misc_feature    351766..351825
FT                   /locus_tag="SpyM50316"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50316 by TMHMM2.0 at aa 1250-1269"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             352043..352918
FT                   /transl_table=11
FT                   /locus_tag="SpyM50317"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RCT6"
FT                   /db_xref="InterPro:IPR020985"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT6"
FT                   /protein_id="CAM29659.1"
FT                   /translation="MTKVVIKQLLQVIVVFMISLSTMTGVVYADKGQIYGCIIQRNYRH
FT                   PISGQIEDSGGEHSFDIGQGMVEGTVYSDAMLEVSDAGKIVLTFRMSLADYSGNYQFWI
FT                   QPGGTGSFQAVDYNITQKGTDTNGTTLDIAISLPTVNSIIRGSMFVEPMGREVVFYLSA
FT                   SELIQKYSGNMLAQLVTETDNSQNQEVKDSQKPVDTKLGESQDESHTGAMITQNKPKAN
FT                   SSNNKSLSDKKILPSKMGLTTSLELKKEDKFRSKKDLSIMIYYFPTFFLMLGGFAVWVW
FT                   KKRKKNDKTM"
FT   sig_peptide     352043..352129
FT                   /locus_tag="SpyM50317"
FT                   /note="Signal peptide predicted for SpyM50317 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.992) with cleavage
FT                   site probability 0.948 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(352076..352129,352817..352885)
FT                   /locus_tag="SpyM50317"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50317 by TMHMM2.0 at aa 12-29 and 259-281"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             352902..353786
FT                   /transl_table=11
FT                   /locus_tag="SpyM50318"
FT                   /product="putative transport system extracellular binding
FT                   lipoprotein"
FT                   /db_xref="GOA:A2RCT7"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR019957"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT7"
FT                   /protein_id="CAM29660.1"
FT                   /translation="MIKRCKGIGLALMAFFLVACVNQHPKTAKETEQQRIVATSVAVVD
FT                   ICDRLNLDLVGVCDSKLYTLPKRYDAVKRVGLPMNPDIELIASLKPTWILSPNSLQEDL
FT                   EPKYQKLDTEYGFLNLRSVEGMYQSIDDLGNLFQRQQEAKELRQQYQDYYRAFQAKRKG
FT                   KKKPKVLILMGLPGSYLVATNQSYVGNLLDLAGGENVYQSDEKEFLSANPEDMLAKEPD
FT                   LILRTAHAIPDKVKVMFDKEFAENDIWKHFTAVKEGKVYDLDNTLFGMSAKLNYPEALD
FT                   TLTQLFDRVGDHP"
FT   sig_peptide     352902..352991
FT                   /locus_tag="SpyM50318"
FT                   /note="Signal peptide predicted for SpyM50318 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.659 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    352929..352961
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    352992..353702
FT                   /locus_tag="SpyM50318"
FT                   /note="HMMPfam hit to PF01497, Periplasmic binding protein,
FT                   score 1.1e-32"
FT                   /inference="protein motif:HMMPfam:PF01497"
FT   CDS             353788..354810
FT                   /transl_table=11
FT                   /locus_tag="SpyM50319"
FT                   /product="putative iron/heme permease"
FT                   /db_xref="GOA:A2RCT8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT8"
FT                   /protein_id="CAM29661.1"
FT                   /translation="MTASDLQRDQSLLAKKRFRSGLYLVLLILSLLFLAVIALSLGGLA
FT                   VSYGAIVKGLFVAYDPQVALIYDLRFPRIVIALLAGAGIAVSGVLFQAVLKNPISDPAI
FT                   IGICSGASFMVLVSSLLLPQLLLYGPIVSFLGGGVSFLLIYGLAWKKGLNPIRLILTGI
FT                   AINALFMGLSTALTSFFTSASPMVNALLAGHISQKTWADVGVLFPYTFIGLLLALLLSK
FT                   TCNLLLLDDQVIRHLGIDATALRLGISLVAVLLASVATSIVGVVSFLGLIVPHMSRLLV
FT                   GSKHQILIPFSALLGAFVFLLADTLGRSLAYPLEISPAIIMSIVGGPYFIYLLRRSDII
FT                   "
FT   sig_peptide     353788..353934
FT                   /locus_tag="SpyM50319"
FT                   /note="Signal peptide predicted for SpyM50319 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.998) with cleavage
FT                   site probability 0.557 between residues 49 and 50"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(353848..353916,353992..354060,354094..354153,
FT                   354166..354234,354259..354327,354406..354474,
FT                   354535..354603,354646..354696,354715..354783)
FT                   /locus_tag="SpyM50319"
FT                   /note="9 probable transmembrane helices predicted for
FT                   SpyM50319 by TMHMM2.0 at aa 21-43,
FT                   69-91,103-122,127-149,158-180, 207-229, 250-272, 287-303
FT                   and 310-332"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    353911..354795
FT                   /locus_tag="SpyM50319"
FT                   /note="HMMPfam hit to PF01032, FecCD transport family,score
FT                   7.9e-90"
FT                   /inference="protein motif:HMMPfam:PF01032"
FT   CDS             354807..355643
FT                   /transl_table=11
FT                   /locus_tag="SpyM50320"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RCT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCT9"
FT                   /protein_id="CAM29662.1"
FT                   /translation="MSKNSSHIQVQNLSFAYEEKLVLDDLTFSIPKGKITTIMGANGSG
FT                   KSTLLQLLTKNLPLKQGQVWLEQEELATISLKAFAKKVAVVHQYHQVVEGLLVGELVAM
FT                   ARLARRSFFKTTTKEDEERLAWALEVTALSDYVYRDIQHLSGGEQQRVWIAMALAQDTD
FT                   IIFLDEPTTYLDIKYQLDILKLITKINQELGLTIVLVLHDINQALSLSDHLIGLKDGQL
FT                   YAQGQPRDLLDQQFIRDVFGVELPFVERNGQQFVLTSLVNETNGIRTQRRDRNKNR"
FT   misc_feature    354903..355466
FT                   /locus_tag="SpyM50320"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.6e-49"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    354924..354947
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    355236..355280
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             355640..357403
FT                   /transl_table=11
FT                   /locus_tag="SpyM50321"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCU0"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU0"
FT                   /protein_id="CAM29663.1"
FT                   /translation="MMETEDTISRGKRKRLLKRLRERIAPKRYLLYVSAFLSWLQFVMR
FT                   MISFYLIAKTFSTFILGHAIALGRLAGLLLLLNVVGFVLAILGKQLQGIASQFARDSLK
FT                   QSFFEAFIDLDGQFDAHASDADILTLASQGIDSLDTYYGYYLSLSMRTKWNCTTIMILV
FT                   FLIYPLAGLVFLGVLPLIPLSIVAMQKRSKQIMSHYWSSYMDVGNLFMDDLKGLNTLYS
FT                   YQATERYEQEFSGKAEQFRKATMSLLGFQLQAVGYMDAVMYLGIGLSGFLAVQALATGQ
FT                   LSFFNFLFFLLIATEFFTPIREQGYGMHLVMMNTKMADRIFSFLDSVPARKDNKSKTAI
FT                   NFNQIDIQNISLAYEKKTVLSGVTMTLTKGQLTAIAGVSGQGKTSLAQLLLKRQSATTG
FT                   HILFDGLDSDNLSQETINQQVLYVSDQSTLLNRSIYDNLRLAANLSKKEILDWIDQHGL
FT                   LSFINWLPDGLDTIVGENGNLLSPGQKQQVICARALLSKRSLYIFDEATSSLDAENERI
FT                   IDNLITRLAKTAIVIVITHKMSRLKGANQVLFLNTGQPACLGKPCDLYRDQPTYRHLVD
FT                   TQARLEASIYG"
FT   misc_feature    order(355724..355792,355835..355903,356114..356182,
FT                   356402..356470,356483..356542)
FT                   /locus_tag="SpyM50321"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50321 by TMHMM2.0 at aa 29-51, 66-88, 159-181, 255-277
FT                   and 282-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    355730..356542
FT                   /locus_tag="SpyM50321"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 0.00023"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    356747..357298
FT                   /locus_tag="SpyM50321"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   3.6e-37"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    356768..356791
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             357396..359066
FT                   /transl_table=11
FT                   /locus_tag="SpyM50322"
FT                   /product="ABC transporter ATP-binding membrane protein"
FT                   /db_xref="GOA:A2RCU1"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU1"
FT                   /protein_id="CAM29664.1"
FT                   /translation="MAKPNRSTLSLVWRLLTLMKTLLPWIILAVGFAVMGFVITVSIPT
FT                   GIAYLGLLAIRQEVIPILALYLLIALAFLRGFVRYGEHYFGHFVAFHSLAAFRNLIFKK
FT                   LRALSPACLDSQDSGYLLKMIGEDIEALEVFFAHTIAPICTAILSAGLMFWYFCQSSWQ
FT                   LALLALATYACLAIVIPIYFANILQVLLKSQNEGRKDYLSYFLESLRSVKDLLQFQVLD
FT                   EQFERLIKKSNHVNALDRNVAQAQFLQMALTFFWLGLMILAFSYMVFDGICHDSLSFDK
FT                   GLLTFIAFTASFSPFLELGRLPLGFKRAMNAARNIFDLLDENVIVDEGTKQIDRLRSVS
FT                   FEDLSFAYPKRQELVFKDLTVTFQEKGIIGIKGESGSGKSTLVKLIMKWYNWKTGDIFL
FT                   NDRNSCLLNAAKLQDTIAYVPQTAQLFQQSIRENLTFGRQDISDESIWNLAEACGMKDR
FT                   LLACKEGLDTIIKSPSDFSAGEGQRLELMRALLKDASCYIFDEPTSNLDSLNEAILLDL
FT                   IKTHCQGLVFLISHRASTLACVDHLFCVKNGSLKEVNKK"
FT   sig_peptide     357396..357509
FT                   /locus_tag="SpyM50322"
FT                   /note="Signal peptide predicted for SpyM50322 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.732) with cleavage
FT                   site probability 0.221 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(357456..357524,357567..357626,357645..357701,
FT                   357798..357866,357885..357953,358134..358202,
FT                   358239..358307)
FT                   /locus_tag="SpyM50322"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50322 by TMHMM2.0 at aa 21-43,
FT                   58-77,84-102,135-157,164-186, 247-269 and 282-304"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    357459..358283
FT                   /locus_tag="SpyM50322"
FT                   /note="HMMPfam hit to PF00664, ABC transporter
FT                   transmembrane region, score 7.2e-05"
FT                   /inference="protein motif:HMMPfam:PF00664"
FT   misc_feature    358491..359039
FT                   /locus_tag="SpyM50322"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   8e-38"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    358512..358535
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             359063..359656
FT                   /transl_table=11
FT                   /locus_tag="SpyM50323"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU2"
FT                   /protein_id="CAM29665.1"
FT                   /translation="MKQLTIKDIMITGAFAALYFICVGLGTFINIFFDRSGNMLYAPAF
FT                   AALLGGTIYFLLIAKLQTFGPITLLGLMMGGFFFLSGHFFAAMFPSIIFGLIADIIASL
FT                   GKYKSRFFNDLSYMVFAFVNSGPILLMWLLKDAYVESLLARGKSMTYVNRIMYDFSLGH
FT                   VIWFVGIVLAGALLGSVFAHYLLKKHFIKSGLLS"
FT   sig_peptide     359063..359200
FT                   /locus_tag="SpyM50323"
FT                   /note="Signal peptide predicted for SpyM50323 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.666) with cleavage
FT                   site probability 0.629 between residues 46 and 47"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(359090..359158,359177..359245,359288..359356,
FT                   359393..359461,359552..359620)
FT                   /locus_tag="SpyM50323"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50323 by TMHMM2.0 at aa 10-32, 39-61, 76-98, 111-133
FT                   and 164-186"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             359653..360333
FT                   /transl_table=11
FT                   /locus_tag="SpyM50324"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU3"
FT                   /protein_id="CAM29666.1"
FT                   /translation="MRLDVRTKLLLLVLANACFFFRVDGFLEFIIVIFLLLLLSALNKK
FT                   KLAFKLAVVYLLMIGLSVIPLSIFPSYLDHLLSFVSIAGRLVFPSLLAGLITIKTTTIY
FT                   ELVHGLRKWHFPEVWLLTLAVMCRFIPMIRQECCVIHRSLTIRGIILTKWSILIRPKQY
FT                   LEYLMVPLLLSLIRSSQELTIASLTKGLAVNKGTSECFSSHLTWKDWGVQIWITVIIII
FT                   TILQ"
FT   misc_feature    order(359710..359778,359791..359859,359887..359946)
FT                   /locus_tag="SpyM50324"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50324 by TMHMM2.0 at aa 20-42, 47-69 and 79-98"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             360330..361724
FT                   /transl_table=11
FT                   /locus_tag="SpyM50325"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RCU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU4"
FT                   /protein_id="CAM29667.1"
FT                   /translation="MISAEQLVFTYHDQKNPACQVSTCQIVSGQFIVLCGPSGSGKSTF
FT                   LKLLNGIIPDYYAGKYEGRLDVADCQAGRDSVETFSRSVASVFQNPASQFFYREVQHEL
FT                   VFPCENQGLDAKVIMKRLWTLAEDFAFAELLNKDMFGLSGGQKQRVAIATAIMQGTNIM
FT                   LFDEPTANLDSAGIAAVKAYLTQLKAAGKTIIVAEHRLHYLMDLADNFFYFKNGRLTDK
FT                   LTTQDLLALTDEQRQDMGLRRLDLSDLKPVLAGKIESQHYRPDDSLCIEHLTVRAGSKI
FT                   LRCIEQLSFAAGSISGITGSNGLGKSQLVYYIAGILDDKKATIKFQGIPLSAKQRLSKT
FT                   SIVLQEVSLQLFAESVSKEVNLGHERHPRTTEVIERLSLTTLLERHPASLSGGEQQRVM
FT                   IAASLLADKDILIFDEPSSGLDLLQMKALANLLMQLKTQHKVVILISHDEELLSSVCDT
FT                   IYQMLP"
FT   misc_feature    360414..360980
FT                   /locus_tag="SpyM50325"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.7e-37"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    360435..360458
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    360753..360797
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    361206..361715
FT                   /locus_tag="SpyM50325"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.8e-27"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    361227..361250
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    361497..361541
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             complement(361762..361902)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50325A"
FT                   /product="hypothetical protein"
FT                   /note="Similar to Streptococcus pyogenes MGAS10394
FT                   hypothetical protein UniProt:Q5XAB5 (EMBL:CP000003) (46 aa)
FT                   fasta scores: E()=1.4e-15, 93.478% id in 46 aa"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU5"
FT                   /protein_id="CAM29668.1"
FT                   /translation="MAHFVCKNRKPNVKSAELFMLFEHKTGVVYVLTLVSIIQEFLFIF
FT                   R"
FT   CDS             362099..364114
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SpyM50326"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="GOA:A2RCU6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU6"
FT                   /protein_id="CAM29669.1"
FT                   /translation="MILTAPMSNLKGFGPKSAEKFQKLDIYTVEDLLLYYPFRYEDFKS
FT                   KSVFDLVDGEKAVITGLVVTPANVQYYGFKRNRLSFKLRQGEAVLNVSFFNQPYLADKI
FT                   ELGQEVAVFGKWDATKSAITGMKVLAQVEDDMQPVYRVAQGISQSTLIKAIKSAFEIDA
FT                   HLELKENLPATLLEKYRLMGRSQACLAMHFPKDITEYKQALRRIKFEELFYFQMNLQVL
FT                   KAENKSETNGLPILYSKHAMETKISSLPFILTNAQKRSLDDILSDMSSGAHMNRLLQGD
FT                   VGSGKTVIASLSMYAAYTAGFQSALMVPTEILAEQHYISLQELFPDLSIAILTSGMKAA
FT                   VKRTVLAAIANGSVDMIVGTHALIQDSVQYHKLGLVITDEQHRFGVKQRRIFREKGENP
FT                   DVLMMTATPIPRTLAITAFGEMDVSVIDELPAGRKPIMTRWVKHEQLGTVLEWVKGELQ
FT                   KDAQVYVISPLIEESEALDLKNAVALHAELSTYFEGIAKVALVHGRMKNDEKDAIMQDF
FT                   KDKKSHILVSTTVIEVGVNVPNATIMIIMDADRFGLSQLHQLRGRVGRGHKQSYAVLVA
FT                   NPKTDSGKKRMTIMTETTDGFVLAESDLKMRGSGEIFGTRQSGIPEFQVADIVEDYPIL
FT                   EEARKVSAAIVSDPNWIYEKQWQLVAKNIRKKEVYD"
FT   misc_feature    362267..362485
FT                   /gene="recG"
FT                   /locus_tag="SpyM50326"
FT                   /note="HMMPfam hit to PF01336, OB-fold nucleic acid binding
FT                   domain, score 0.099"
FT                   /inference="protein motif:HMMPfam:PF01336"
FT   misc_feature    362849..363331
FT                   /gene="recG"
FT                   /locus_tag="SpyM50326"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 2.3e-05"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    362855..363346
FT                   /gene="recG"
FT                   /locus_tag="SpyM50326"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   7.8e-31"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    362936..362959
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    363569..363799
FT                   /gene="recG"
FT                   /locus_tag="SpyM50326"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 2.8e-23"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS             364407..365309
FT                   /transl_table=11
FT                   /locus_tag="SpyM50327"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RCU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU7"
FT                   /protein_id="CAM29670.1"
FT                   /translation="MTQQSMLLSIEQVNKSYGKNQVLSDISFDIYKGEICGLVGQNGAG
FT                   KTTLMRILSGLIGKDSGQIKQLQPYRMGSIIESPTLYPNMTAHDNLYYAALQLRLADAK
FT                   ERIHEVLELIGLEKVSKKKKVKDYSLGMRQRLAIGLSILDFPEFLILDEPINGLDPAGI
FT                   KEMRQIILNLRDCYGITILISSHILSELDLVVDRYVIMHKGKVIKSMDKAELKAQVKVQ
FT                   IALHTSDDQLVKNRLLELGLRVETDGQMLLIKPTLSVMELIKIVLDLPVEIFDIYHHQV
FT                   SFEHYYLDLLGKDAASPLI"
FT   misc_feature    364503..365018
FT                   /locus_tag="SpyM50327"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   5.9e-43"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    364524..364547
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    364788..364832
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             365322..366026
FT                   /transl_table=11
FT                   /locus_tag="SpyM50328"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU8"
FT                   /protein_id="CAM29671.1"
FT                   /translation="MISYLKADLFRIRQERLALFSCMLLVVIAVGVAYSFRKTPNQVIM
FT                   IQIINIITDFVTLFFLTPARIFFSDDYNYRTINNVVVKQQNRTLIIIYKLLVSFGLSLL
FT                   FISLTYLLSALAFHLFTGQAYYGIVIDRMIKQLPFYIAIIALCQFLFNILRKTYQSITA
FT                   YILYVLLFDKVSATLANHFFKLDISPVLMFKHLSLSLGDKHLSSTSILVAFGLTLCYLL
FT                   GNVFLFSKRELK"
FT   sig_peptide     365322..365432
FT                   /locus_tag="SpyM50328"
FT                   /note="Signal peptide predicted for SpyM50328 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.997) with cleavage
FT                   site probability 0.842 between residues 37 and 38"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(365370..365429,365457..365525,365604..365672,
FT                   365730..365783,365802..365870,365937..366005)
FT                   /locus_tag="SpyM50328"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50328 by TMHMM2.0 at aa 17-36,
FT                   46-68,95-117,137-154,161-183 and 206-228"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(366375..367340)
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SpyM50329"
FT                   /product="putative L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="GOA:A2RCU9"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCU9"
FT                   /protein_id="CAM29672.1"
FT                   /translation="MKKILVLHTGGTISMQADNSGRVVPNQDNPMTKIHAAAQDIQLTV
FT                   SDFLNLPSPHITPHHMLSIYHHIQERTDVFDGIVITHGTDTLEETAYFLDTMALPTNIP
FT                   VVLTGAMRSSNEVGSDGIYNYLTALRVASSDKAKEKGVLVVMNDEIHAAKYVTKTHTTN
FT                   ISTFQTPTHGPLGIIMKNDLLFFKTAEPRIRFDLRCISGTIPIIKAYAGMGDGSILSLL
FT                   TPGSIQGLVIEALGAGNVPPLAVGEIEHLITLGIPVVLVSRCFNGMAEPVYAYEGGGAM
FT                   LQEAGVMFVKELNAPKARLKLLIALNAGLTGQELKDYIEG"
FT   misc_feature    complement(366390..367319)
FT                   /gene="asnB"
FT                   /locus_tag="SpyM50329"
FT                   /note="HMMPfam hit to PF00710, Asparaginase, score 9.1e-65"
FT                   /inference="protein motif:HMMPfam:PF00710"
FT   misc_feature    complement(367080..367112)
FT                   /note="PS00917 Asparaginase / glutaminase active site
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00917"
FT   misc_feature    complement(367299..367325)
FT                   /note="PS00144 Asparaginase / glutaminase active site
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00144"
FT   CDS             367412..368800
FT                   /transl_table=11
FT                   /locus_tag="SpyM50330"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="GOA:A2RCV0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR017223"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCV0"
FT                   /protein_id="CAM29673.1"
FT                   /translation="MTVKAVFFDIDGTLLNDRKNIQKTTQKAIQQLKKQGIMVGLATGR
FT                   GPGFVQPFLENFGLDFAVTYNGQYILTRDKVLYQNQLPKSMIYKVIRYANEKKREISLG
FT                   TASGLAGSRIIDMGTSPFGQVISSFVPKSWARTVEGSFKHLIRRIKPQSFRNLVTIMRE
FT                   PIYQVVLVASQAETKKIQEKFPHIKITRSSPYSLDLISVDQSKIKGIERLGEMFGFDLS
FT                   EVMAFGDSDNDLEMLSGVGIGIAMGNAETVVKDGAHFTTDSNNNDGISKALAHYGLIHF
FT                   DIEKSFKSRDENFNKVKDFHRLMDSDTIETPRSYTISEAGYRSGFKVEEIVEFLYAASK
FT                   GDEQQFTQAIFDLHGAVDQAANKVQAKKHVETPLIGQVDALADLLYFTYGSFVLMGVDP
FT                   QPIFEAVHEANMAKIFPDGKAHFDPVTHKIQKPDYWQERHAPEVAIKKELDKQLQKSLQ
FT                   RFDK"
FT   misc_feature    367418..368161
FT                   /locus_tag="SpyM50330"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    367424..367459
FT                   /note="PS01228 Hypothetical cof family signature 1"
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    368090..368158
FT                   /note="PS01229 Hypothetical cof family signature 2"
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS             complement(368923..369429)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50331"
FT                   /product="putative universal stress protein"
FT                   /db_xref="GOA:A2RCV1"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCV1"
FT                   /protein_id="CAM29674.1"
FT                   /translation="MKKRIKAILVKLLKEDSSMSLKYKRILVAIDGSYESELAFNKGVN
FT                   VALRNDATLLLVHVIDTRALQSVATFDTYIYEKLEQEAKDVLDDFEKQAQIAGITNIKQ
FT                   IIEFGNPKNLLAHDIPDRENADLIMVGATGLNTFERLLIGSSSEYIMRHAKIDLLVVRD
FT                   STKTL"
FT   misc_feature    complement(368944..369366)
FT                   /locus_tag="SpyM50331"
FT                   /note="HMMPfam hit to PF00582, Universal stress protein
FT                   family, score 1.2e-17"
FT                   /inference="protein motif:HMMPfam:PF00582"
FT   CDS             369606..370820
FT                   /transl_table=11
FT                   /locus_tag="SpyM50332"
FT                   /product="putative aminotransferase"
FT                   /db_xref="GOA:A2RCV2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCV2"
FT                   /protein_id="CAM29675.1"
FT                   /translation="MKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAA
FT                   FGFEAPDEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGV
FT                   SELISMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKS
FT                   KITSRTKAIVVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIA
FT                   IASLAPDVFCVSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVL
FT                   AQQVVQTSLGGHQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDR
FT                   QMYRIDDDEEFVLQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVL
FT                   YQYRR"
FT   misc_feature    369756..369785
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00215"
FT   misc_feature    369867..370802
FT                   /locus_tag="SpyM50332"
FT                   /note="HMMPfam hit to PF00155, Aminotransferase class I and
FT                   II, score 5.5e-38"
FT                   /inference="protein motif:HMMPfam:PF00155"
FT   CDS             371038..371820
FT                   /transl_table=11
FT                   /gene="codY"
FT                   /locus_tag="SpyM50333"
FT                   /product="GTP-sensing transcriptional pleiotropic
FT                   repressor"
FT                   /db_xref="GOA:A2RCV3"
FT                   /db_xref="InterPro:IPR010312"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013198"
FT                   /db_xref="InterPro:IPR014154"
FT                   /protein_id="CAM29676.1"
FT                   /translation="MPNLLEKTRKITSILQRSVDSLETELPYNTMASRLADIIDCNACI
FT                   INGGGTLLGYAMKYKTNTDRVEEFFEAKQFPDTYVKAASRVYDTEANLSVENELTIFPV
FT                   ESKDTYPGGLTTIAPIYGGGMRLGSLIIWRNDNEFSDDDLILVEISSTVVGIQLLNLQT
FT                   ENLEDTIRKQTAVNMAINTLSYSEMKAVAAILGELDGNEGRLTASVIADRIGITRSVIV
FT                   NALRKLESAGIIESRSLGMKGTYLKVINEGIFAKLKEF"
FT   misc_feature    371044..371817
FT                   /gene="codY"
FT                   /locus_tag="SpyM50333"
FT                   /note="HMMPfam hit to PF06018, GTP-sensing transcriptional
FT                   pleiotropic repr, score 2.7e-200"
FT                   /inference="protein motif:HMMPfam:PF06018"
FT   misc_feature    371650..371715
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1428.000, SD 4.05 at aa 205-226, sequence
FT                   LTASVIADRIGITRSVIVNALR"
FT   CDS             371967..372521
FT                   /transl_table=11
FT                   /locus_tag="SpyM50334"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="GOA:A2RCV4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCV4"
FT                   /protein_id="CAM29677.1"
FT                   /translation="MRALISIDYTNDFVADDGKLSAGKSAQAIATKIAEVTKTAFDQGD
FT                   YIFFAIDCHDQNDPWHPESKLFAAHNIKGTTGRHLYGPLAEVYSYMKQHPRVFWIDKRY
FT                   YSAFSGTDLDIRLRERGITQLVLTGVLSDICVLHTAIDAYHLGYQLEIVKSAVASLTKE
FT                   SYEWSLAHFEQVLGAKLINDY"
FT   misc_feature    371967..372512
FT                   /locus_tag="SpyM50334"
FT                   /note="HMMPfam hit to PF00857, Isochorismatase family,score
FT                   2.3e-11"
FT                   /inference="protein motif:HMMPfam:PF00857"
FT   misc_feature    372018..372041
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             join(372965..373021,373020..373283)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50335"
FT                   /note="Possible gene remnant. Similar to Streptococcus
FT                   pyogenes (serotype M3) hypothetical protein SPS0324
FT                   UniProt:Q879J6 (EMBL:BA000034) (111 aa) fasta scores:
FT                   E()=9.2e-30, 76.786% id in 112 aa, and to the C-tterminal
FT                   region of Flaveria pringlei phosphate dikinase,chloroplast
FT                   precursor PPDK UniProt:PODK_FLAPR (EMBL:FPPDK) (956 aa)
FT                   fasta scores: E()=1.5e-11, 48.387% id in 93 aa. CDS
FT                   contains a frameshift mutation after codon 18"
FT                   /db_xref="PSEUDO:CAM29678.1"
FT   misc_feature    373026..373088
FT                   /note="PS00079 Multicopper oxidases signature 1"
FT                   /inference="protein motif:Prosite:PS00079"
FT   CDS             373515..373817
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="SpyM50337"
FT                   /product="glutamyl-tRNA amidotransferase subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="GOA:A2RCV6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /protein_id="CAM29679.1"
FT                   /translation="MKISEEEVRHVAKLSKLSFSESETTTFATTLSKIVDMVELLNEVD
FT                   TEGVAITTTMADKKNVMRQDVAEEGTDRALLFKNVPEKENHFIKVPAILDDGGDA"
FT   misc_feature    373569..373784
FT                   /gene="gatC"
FT                   /locus_tag="SpyM50337"
FT                   /note="HMMPfam hit to PF02686, Glu-tRNAGln amidotransferase
FT                   C subunit, score 5.4e-14"
FT                   /inference="protein motif:HMMPfam:PF02686"
FT   CDS             373817..375283
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="SpyM50338"
FT                   /product="glutamyl-tRNA amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="GOA:A2RCV7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /protein_id="CAM29680.1"
FT                   /translation="MSFNHKTIEELHDLLVAKEISATELTQKTLEDIKSREEAVGSFIT
FT                   VSEEAALKQAAAIDAKGIDADNLMSGIPLAVKDNISTKGILTTAASKMLHNYEPIFDAT
FT                   SVANAYAKDMIVIGKTNMDEFAMGGSTETSYFKKTKNAWDHTKVPGGSSGGSATAVASG
FT                   QVRLSLGSDTGGSIRQPAAFNGVVGLKPTYGTVSRYGLIAFGSSLDQIGPFAPTVKENA
FT                   QLLNVIASSDVKDATSAPVRIADYTSKIGRDIKGMKIALPKEYLGEGIDPEIKETVLAA
FT                   AKQFEALGATVEEVSLPHSKYGVAVYYIIASSEASSNLQRFDGIRYGFRADDAKNLDEI
FT                   YVNTRSQGFGDEVKRRIMLGTFSLSSGYYDAYFKKAGQVRTLIIQDFDKVFADYDLILG
FT                   PTTPTVAFGLDTLNHDPVAMYLADLLTIPVNLAGLPGISIPAGFVDGLPVGLQLIGPKY
FT                   AEETIYQAAAAFEAVTDYHKQQPIIFGGDK"
FT   misc_feature    373886..375208
FT                   /gene="gatA"
FT                   /locus_tag="SpyM50338"
FT                   /note="HMMPfam hit to PF01425, Amidase, score 2.8e-180"
FT                   /inference="protein motif:HMMPfam:PF01425"
FT   CDS             375283..376722
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="SpyM50339"
FT                   /product="glutamyl-tRNA amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="GOA:A2RCV8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /protein_id="CAM29681.1"
FT                   /translation="MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFP
FT                   GVLPVMNKGVIDAGIKAALALNMDIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGW
FT                   IEIKLEDGSTKKIRIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPE
FT                   EAYTYLTALKEIIQYTGISDVKMEEGSMRVDANISLRPYGQEQFGTKTELKNLNSFSNV
FT                   RKGLEFEVERQAKLLRSGGVIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYE
FT                   IDDAWIDEMRAQLPQFPAQRRAKYEEELGLSAYDASQLTATKALSDFFETAVSLGGDAK
FT                   QVSNWLQGEVAQFLNAEGKTIEEIRLTPDNLVEMIAIIADGTISSKMAKKVFVHLAKNG
FT                   GSARAYVEKAGLVQISDPAVLVPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATK
FT                   GQANPQVAQQLLAQELQKLRD"
FT   misc_feature    375283..376002
FT                   /gene="gatB"
FT                   /locus_tag="SpyM50339"
FT                   /note="HMMPfam hit to PF02934, PET112 family, N terminal
FT                   region, score 1.4e-146"
FT                   /inference="protein motif:HMMPfam:PF02934"
FT   misc_feature    376051..376257
FT                   /gene="gatB"
FT                   /locus_tag="SpyM50339"
FT                   /note="HMMPfam hit to PF01162, PET112 family, C terminal
FT                   region, score 3e-32"
FT                   /inference="protein motif:HMMPfam:PF01162"
FT   misc_feature    376261..376704
FT                   /gene="gatB"
FT                   /locus_tag="SpyM50339"
FT                   /note="HMMPfam hit to PF02637, GatB/Yqey domain, score
FT                   3.3e-45"
FT                   /inference="protein motif:HMMPfam:PF02637"
FT   CDS             376719..376934
FT                   /transl_table=11
FT                   /locus_tag="SpyM50340"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCV9"
FT                   /protein_id="CAM29682.1"
FT                   /translation="MIVADSNKLKYFVSEKKAVGLSQAAFLYVMLVTVYKKTIIYAKIR
FT                   LTGIALEPSGVSDGYLMNHHVCLHYY"
FT   misc_feature    376770..376823
FT                   /locus_tag="SpyM50340"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50340 by TMHMM2.0 at aa 18-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             377143..377391
FT                   /transl_table=11
FT                   /locus_tag="SpyM50341"
FT                   /product="transglycosylase associated protein"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RCW0"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW0"
FT                   /protein_id="CAM29683.1"
FT                   /translation="MLTMIWSLIVGAFIGMIAGKMTEKSQSMGCFTNIIAGLIGSAVGQ
FT                   RLFGDWGIQLAGMAIFPSILGAAIVIVLVSAIFGKRY"
FT   misc_feature    order(377152..377199,377308..377376)
FT                   /locus_tag="SpyM50341"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50341 by TMHMM2.0 at aa 2-19 and 56-78"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    377242..377379
FT                   /locus_tag="SpyM50341"
FT                   /note="HMMPfam hit to PF04226, Transglycosylase associated
FT                   protein, score 6.4e-15"
FT                   /inference="protein motif:HMMPfam:PF04226"
FT   CDS             377783..378490
FT                   /transl_table=11
FT                   /locus_tag="SpyM50342"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW1"
FT                   /protein_id="CAM29684.1"
FT                   /translation="MTKTRLYIARHGKTMFNTIGRAQGWSDTPLTKKGEEGIRELGLGL
FT                   KDATIPFKAAFSSDSGRTMQTIEIILRESENEFLPYTKDNRIREWCFGSLEGTYDSELF
FT                   LGVLPRTKAFENRDNLRDVPYSELAESIVEVDTANWAEPWEVLRKRIWEGFEAIALSIQ
FT                   NAGGGNALVVSHGMTIGTFMWLIDPDREKQYIDNGSVTVVEFEDGQFTIKTIGDMSYRY
FT                   RGREIIEAMSDEA"
FT   misc_feature    377792..378427
FT                   /locus_tag="SpyM50342"
FT                   /note="HMMPfam hit to PF00300, Phosphoglycerate mutase
FT                   family, score 7.2e-11"
FT                   /inference="protein motif:HMMPfam:PF00300"
FT   CDS             378480..379223
FT                   /transl_table=11
FT                   /locus_tag="SpyM50343"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /db_xref="GOA:A2RCW2"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW2"
FT                   /protein_id="CAM29685.1"
FT                   /translation="MKHNHFKLLLQTLVVLLFVGGIYLFIKPEKQATKTPSSQQASSQK
FT                   VVKNSKESTGLPKVSPKDWELVLVNRDHITKEMSPELVDINGISVDKRIEQATSDFLAA
FT                   AQAIDPQEHLISGYRSVAYQAELYQFYIKKEMANDPTLTQEAAEALVQTYLQPPGASEH
FT                   HTGLAIDMSTVDTLNASDPSVSKAVQKIAPDYGFVLRFPEGKKTSTGVDYEDWHYRYVG
FT                   KASARYMAQHNLTLEEYIAALKEKR"
FT   sig_peptide     378480..378572
FT                   /locus_tag="SpyM50343"
FT                   /note="Signal peptide predicted for SpyM50343 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.951) with cleavage
FT                   site probability 0.783 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    378498..378557
FT                   /locus_tag="SpyM50343"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50343 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    378738..379196
FT                   /locus_tag="SpyM50343"
FT                   /note="HMMPfam hit to PF02557, D-alanyl-D-alanine
FT                   carboxypeptidase, score 3.1e-55"
FT                   /inference="protein motif:HMMPfam:PF02557"
FT   CDS             379220..379789
FT                   /transl_table=11
FT                   /locus_tag="SpyM50344"
FT                   /product="putative N-acetyl-muramidase"
FT                   /db_xref="GOA:A2RCW3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW3"
FT                   /protein_id="CAM29686.1"
FT                   /translation="MRKRLKFPYFLTLLACFLLLIVCPLLSSQRIASADKEVRVNYSQK
FT                   QFITKMGKEVKPLAKYYGIRPSILIAQILLETHDGKTLLASKYHNLFSKKATPGQAAIT
FT                   LKSPKQTNQNVRYAIYKDDASAIRDYLRMLRQGKEVDKRLYRNLATEKGYKAPAKSLQK
FT                   YLHYTDKTYARRLIQVIESNDLTNYD"
FT   sig_peptide     379220..379318
FT                   /locus_tag="SpyM50344"
FT                   /note="Signal peptide predicted for SpyM50344 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.429 between residues 33 and 34"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    379238..379306
FT                   /locus_tag="SpyM50344"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50344 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    379370..379774
FT                   /locus_tag="SpyM50344"
FT                   /note="HMMPfam hit to PF01832, Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglu, score 0.00023"
FT                   /inference="protein motif:HMMPfam:PF01832"
FT   CDS             379924..380958
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SpyM50345"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="GOA:A2RCW4"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR029016"
FT                   /protein_id="CAM29687.1"
FT                   /translation="MITQRQNDILNLIVELFTQTHEPVGSKALQRTIDSSSATIRNDMA
FT                   KLEKLGLLEKAHTSSGRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKTFDFEAFKLEDM
FT                   LQKASHILAEMTGYTSVILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAI
FT                   PRNFLTRDLIAFKAIVEERLLDSSVIDIHYKLRTEIPQIVQKYFVTTDNVLQLFDYVFS
FT                   ELFLETVFVAGKVNSLTYSDLSTYQFLDNEQQVAISLRQSLKEGEMASVQVADSQEAAL
FT                   ADVSVLTHKFLIPYRGFGLLSLIGPIDMDYRRSVSLVNIIGKVLAAKLGDYYRYLNSNH
FT                   YEVH"
FT   misc_feature    380224..380868
FT                   /gene="hrcA"
FT                   /locus_tag="SpyM50345"
FT                   /note="HMMPfam hit to PF01628, HrcA protein C terminal
FT                   domain, score 8.3e-58"
FT                   /inference="protein motif:HMMPfam:PF01628"
FT   CDS             380961..381533
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SpyM50346"
FT                   /product="GrpE protein (HSP-70 cofactor)"
FT                   /db_xref="GOA:A2RCW5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW5"
FT                   /protein_id="CAM29688.1"
FT                   /translation="MAVFNKLFKRRHSVSEEIKKDDLQEEVEATETEETVEEVIEETPE
FT                   KSELELANERADEFENKYLRAHAEMQNIQRRSSEERQQLQRYRSQDLAKAILPSLDNLE
FT                   RALAVEGLTDDVKKGLEMTRDSLIQALKEEGVEEVEVDSFDHNFHMAVQTLPADDEHPA
FT                   DSIAEVFQKGYKLHERLLRPAMVVVYN"
FT   misc_feature    381030..381530
FT                   /gene="grpE"
FT                   /locus_tag="SpyM50346"
FT                   /note="HMMPfam hit to PF01025, GrpE, score 5.1e-59"
FT                   /inference="protein motif:HMMPfam:PF01025"
FT   misc_feature    381390..381524
FT                   /note="PS01071 grpE protein signature"
FT                   /inference="protein motif:Prosite:PS01071"
FT   CDS             381714..383540
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="SpyM50347"
FT                   /product="chaperone protein DnaK (heat shock protein 70)"
FT                   /db_xref="GOA:A2RCW6"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /protein_id="CAM29689.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGTESKIIANPEGNRTTPSVVSFKNG
FT                   EIIVGDAAKRQAVTNPETVISIKSKMGTSEKVSANGKEYTPQEISAMILQYLKGYAEDY
FT                   LGEKVEKAVITVPAYFNDAQRQATKDAGKIAGLEVERIVNEPTAAALAYGMDKTDKDEK
FT                   ILVFDLGGGTFDVSILELGDGVFDVLATAGDNKLGGDDFDQKIIDFLVAEFKKENGIDL
FT                   SQDKMALQRLKDAAEKAKKDLSGVTQTQISLPFITAGSAGPLHLEMSLSRAKFDDLTRD
FT                   LVERTKTPVRQALSDAGLSLSEIDEVILVGGSTRIPAVVEAVKAETGKEPNKSVNPDEV
FT                   VAMGAAIQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFSTA
FT                   ADNQPAVDIHVLQGERPMAADNKTLGRFQLTDIPAAPRGIPQIEVTFDIDKNGIVSVKA
FT                   KDLGTQKEQHIVIKSNDGLSEEEIDRMMKDAEANAEADAKRKEEVDLKNEVDQAIFATE
FT                   KTIKETEGKGFDTERDAAQSALDELKAAQESGNLDDMKAKLEALNEKAQALAVKMYEQA
FT                   AAAQQAAQGAEGAQANDSANNDDVVDGEFTEK"
FT   misc_feature    381723..383435
FT                   /gene="dnaK"
FT                   /locus_tag="SpyM50347"
FT                   /note="HMMPfam hit to PF00012, Hsp70 protein, score 0"
FT                   /inference="protein motif:HMMPfam:PF00012"
FT   misc_feature    381732..381755
FT                   /note="PS00297 Heat shock hsp70 proteins family signature
FT                   1"
FT                   /inference="protein motif:Prosite:PS00297"
FT   misc_feature    382209..382250
FT                   /note="PS00329 Heat shock hsp70 proteins family signature
FT                   2"
FT                   /inference="protein motif:Prosite:PS00329"
FT   misc_feature    382632..382676
FT                   /note="PS01036 Heat shock hsp70 proteins family signature
FT                   3"
FT                   /inference="protein motif:Prosite:PS01036"
FT   CDS             383821..384957
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SpyM50348"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="GOA:A2RCW7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW7"
FT                   /protein_id="CAM29690.1"
FT                   /translation="MNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINKEAGAEQK
FT                   YKDVQEAYETLSDSQKRAAYDQYGAAGAQGGFGGGAGGFGGFDGGDFGGFEDIFSSFFG
FT                   GGGSRNPNAPRQGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCLGSGAKPGTAPVT
FT                   CRKCHGSGVMTIDTQTPLGMMRRQVTCDICHGSGKEIKEPCQTCHGTGHEKQAHKVSVK
FT                   IPAGVDTGQQIRLQGQGEAGFNGGPYGDLFVILNVLPSKQFERNGSTIYYSLDISFTQA
FT                   ALGDTVEIPTVHGDVEMAIPAGTQTGKTFRLKGKGAPKLRGGGQGDQHVTVNIVTPTKL
FT                   NDAQREALQAFAEASGDKMLHPKKKGFFDKVKDALEDI"
FT   misc_feature    383833..384027
FT                   /gene="dnaJ"
FT                   /locus_tag="SpyM50348"
FT                   /note="HMMPfam hit to PF00226, DnaJ domain, score 4.5e-35"
FT                   /inference="protein motif:HMMPfam:PF00226"
FT   misc_feature    383956..384015
FT                   /note="PS00636 Nt-dnaJ domain signature"
FT                   /inference="protein motif:Prosite:PS00636"
FT   misc_feature    384070..384117
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    384220..384474
FT                   /gene="dnaJ"
FT                   /locus_tag="SpyM50348"
FT                   /note="HMMPfam hit to PF00684, DnaJ central domain (4
FT                   repeats), score 1.4e-31"
FT                   /inference="protein motif:HMMPfam:PF00684"
FT   misc_feature    384259..384333
FT                   /note="PS00637 CXXCXGXG dnaJ domain signature"
FT                   /inference="protein motif:Prosite:PS00637"
FT   misc_feature    384310..384327
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    384388..384405
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    384430..384447
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    384511..384876
FT                   /gene="dnaJ"
FT                   /locus_tag="SpyM50348"
FT                   /note="HMMPfam hit to PF01556, DnaJ C terminal region,score
FT                   3.4e-70"
FT                   /inference="protein motif:HMMPfam:PF01556"
FT   misc_feature    384724..384747
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             385178..385969
FT                   /transl_table=11
FT                   /locus_tag="SpyM50349"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="GOA:A2RCW8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW8"
FT                   /protein_id="CAM29691.1"
FT                   /translation="MQFKHIIFDVVDDLAILTLNRPEVSNGFNIPICQEILVALAEVKR
FT                   DTSVRFLLIKAVGKVFSVGGDLVEMQEAVAKDNVQSLVKIAELVQEISFAIKHLPKPVI
FT                   LCADGAVAGAAFNIALAVDFCIASTQTKFIQAFVNVGLAPDAGGLFLLTRAVGLNRATH
FT                   LVMTGEGITADKGVDYGFVYRTAESDKLDKVCLQLLKRLRRGSSNSYAGMKSLVWQSFF
FT                   TGWEDYAKAELAIQEELAFKEDFKEGVIAFGERRRPNFQGK"
FT   misc_feature    385220..385738
FT                   /locus_tag="SpyM50349"
FT                   /note="HMMPfam hit to PF00378, Enoyl-CoA
FT                   hydratase/isomerase family, score 1.9e-20"
FT                   /inference="protein motif:HMMPfam:PF00378"
FT   CDS             386043..386477
FT                   /transl_table=11
FT                   /locus_tag="SpyM50350"
FT                   /product="MarR family regulatory protein"
FT                   /db_xref="GOA:A2RCW9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCW9"
FT                   /protein_id="CAM29692.1"
FT                   /translation="MEYDKINHYLVDIFNRILVIEEMSLKTSQFNDVSLKEMHTIEIIG
FT                   KYDQVTPSDIARELMVTLGTVTTSLNKLEAKGYIARTRSRSDRRVVYLSLTKRGRLLDR
FT                   LHAKFHKNMVGHVIADMSDEEMQALVRGLGNLHQFLEDLV"
FT   misc_feature    386139..386450
FT                   /locus_tag="SpyM50350"
FT                   /note="HMMPfam hit to PF01047, MarR family, score 1.1e-25"
FT                   /inference="protein motif:HMMPfam:PF01047"
FT   misc_feature    386190..386255
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1065.000, SD 2.81 at aa 50-71, sequence
FT                   VTPSDIARELMVTLGTVTTSLN"
FT   misc_feature    386196..386225
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS             386478..387452
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SpyM50351"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="GOA:A2RCX0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /protein_id="CAM29693.1"
FT                   /translation="MIFSKISQVAHYVPQQLVTNNDLASIMDTSHEWIFSRTGIAERHI
FT                   SRDEMTSDLAIQVADQLLTQSGLKADAIDFIIVATISPDATMPSTAAKVQAAIAATSAF
FT                   AFDMTAACSGFVFALAMADKLIASGAYQNGMVIGAETLSKLVNWQDRATAVLFGDGAGG
FT                   VLLEASKDKHVLAETLHTDGARCQSLISGETSLSSPYSIGKKAIATIQMDGRAIFDFAI
FT                   RDVSKSILTLMAQSDITKDDIDYCLLHQANRRILDKIARKIDVPREKFLENMMRYGNTS
FT                   AASIPILLSEAVQKGQIRLDGTQKILLSGFGGGLTWGSLIVRI"
FT   CDS             387513..387737
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="SpyM50352"
FT                   /product="acyl carrier protein (ACP)"
FT                   /db_xref="GOA:A2RCX1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX1"
FT                   /protein_id="CAM29694.1"
FT                   /translation="MAVFEKVQEIIVEELGKETEEVTLETTFDDLDADSLDVFQVISEI
FT                   EDAFDIQIETEEGLNTVGDLVAYVEEKSK"
FT   misc_feature    387525..387719
FT                   /gene="acpP"
FT                   /locus_tag="SpyM50352"
FT                   /note="HMMPfam hit to PF00550, Phosphopantetheine
FT                   attachment site, score 2e-11"
FT                   /inference="protein motif:HMMPfam:PF00550"
FT   CDS             387938..388909
FT                   /transl_table=11
FT                   /gene="fabK"
FT                   /locus_tag="SpyM50353"
FT                   /product="enoyl-ACP reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="GOA:A2RCX2"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX2"
FT                   /protein_id="CAM29695.1"
FT                   /translation="MKTRITELLNIDYPIFQGGMAWVADGDLAGAVSNAGGLGIIGGGN
FT                   APKEVVKANIDRVKAITDRPFGVNIMLLSPFADDIVDLVIEEGVKVVTTGAGNPGKYME
FT                   RLHQAGIIVVPVVPSVALAKRMEKLGVDAVIAEGMEAGGHIGKLTTMSLVRQVVEAVSI
FT                   PVIAAGGIADGHGAAAAFMLGAEAVQIGTRFVVAKESNAHQNFKDKILAAKDIDTVISA
FT                   QVVGHPVRSIKNKLTSAYTKAEKAFLIGQKTATDIEEMGAGSLRHAVIEGDVVNGSVMA
FT                   GQIAGLVRKEESCETILKDIYYGAARVIQNEAKRWQSVSIEK"
FT   misc_feature    387941..388849
FT                   /gene="fabK"
FT                   /locus_tag="SpyM50353"
FT                   /note="HMMPfam hit to PF03060, 2-nitropropane
FT                   dioxygenase,score 2e-103"
FT                   /inference="protein motif:HMMPfam:PF03060"
FT   misc_feature    388430..388492
FT                   /note="PS00912 Dihydroorotate dehydrogenase signature 2"
FT                   /inference="protein motif:Prosite:PS00912"
FT   CDS             388934..389872
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SpyM50354"
FT                   /product="putative malonyl CoA-acyl carrier protein
FT                   transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="GOA:A2RCX3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX3"
FT                   /protein_id="CAM29696.1"
FT                   /translation="MTKTAFLFAGQGAQKLGMARDFYDNFAIVRKTFDQASQVLGYDLR
FT                   RLIDSDELKLNQTSYTQPAILTSSIAIYRVLGLHHVKPDMVAGLSLGEYSALVASGALS
FT                   FEDTLSLVAKRGRLMEEAAPQGSGKMVAVMNTDVQVIEEVCQIAAKHGVVAPANYNAPS
FT                   QIVIGGQTDAVNVAVELLKERGVKRLIPLNVSGPFHTALLEPASRLLAKELERYNFSDF
FT                   KIPLVGNTEANIMEKDRIPELLARQVMEPVRFYDSVATLVESGITQFIEVGPGKVLTGF
FT                   VKKIDKNLLCTSVENMVSLRLFLDREDIHGN"
FT   misc_feature    388946..389866
FT                   /gene="fabD"
FT                   /locus_tag="SpyM50354"
FT                   /note="HMMPfam hit to PF00698, Acyl transferase
FT                   domain,score 3.6e-18"
FT                   /inference="protein motif:HMMPfam:PF00698"
FT   misc_feature    389009..389095
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             389862..390596
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SpyM50355"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="GOA:A2RCX4"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX4"
FT                   /protein_id="CAM29697.1"
FT                   /translation="MEIKGKNIFITGSTRGIGLAMAHQFASLGANIVLNGRSAISEELV
FT                   ASFTDYGVTVVTISGDVSEASEAKRMVNEAIESLGSIDVLVNNAGITNDKLMLKMTEED
FT                   FERVLKINLTGAFNMTQSVLKPMIKARQGAIINVSSVVGLTGNIGQANYAASKAGMIGF
FT                   TKSVAREVAARNICVNAIAPGFIESDMTGVLPEKMQEQILSQIPMKRIGKAQEVAHLAS
FT                   FLVEQDYITGQVIAIDGGMTMQ"
FT   misc_feature    389883..390584
FT                   /gene="fabG"
FT                   /locus_tag="SpyM50355"
FT                   /note="HMMPfam hit to PF00106, short chain
FT                   dehydrogenase,score 5.9e-81"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    390279..390365
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00061"
FT   misc_feature    390327..390374
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature"
FT                   /inference="protein motif:Prosite:PS00038"
FT   CDS             390611..391843
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="SpyM50356"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="GOA:A2RCX5"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX5"
FT                   /protein_id="CAM29698.1"
FT                   /translation="MTFKRVVVTGYGLTSPIGHDPETFWNNLKAGQIGIGPITKFDTTD
FT                   YAVKNAAEIQDFPFDKYFVKKDLNRFDRYSLYALYAAKEAINHADLNIEMVDSDRFGVI
FT                   VASGIGGIAEIEEQVIRLHEKGPKRVKPMTLPKALPNMAAGNVAMSLKAQGVCKSINTA
FT                   CASSNDAIGDAFRAIKFGTQDVMIVGGSEAAITKFAIAGFQSLTALSTTEDPSRSSIPF
FT                   DKDRNGFIMGEGSGMLVLESLEHAQERGATILAEIVGYGNTCDAYHMTSPNPEGLGARK
FT                   AIHLALQEAGIEASAINYVNAHGTSTPANEKGESQAIVAVLGKDVPVSSTKSFTGHLLG
FT                   AAGAIEAIATIEAMRHNYVPMTAGTQALSEDIEANVIFGEGKETAINYAISNTFGFGGH
FT                   NAVLAFKCWEE"
FT   misc_feature    390620..391348
FT                   /gene="fabF"
FT                   /locus_tag="SpyM50356"
FT                   /note="HMMPfam hit to PF00109, Beta-ketoacyl
FT                   synthase,N-terminal do, score 1.2e-65"
FT                   /inference="protein motif:HMMPfam:PF00109"
FT   misc_feature    391073..391123
FT                   /note="PS00606 Beta-ketoacyl synthases active site"
FT                   /inference="protein motif:Prosite:PS00606"
FT   misc_feature    391088..391144
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00098"
FT   misc_feature    391370..391837
FT                   /gene="fabF"
FT                   /locus_tag="SpyM50356"
FT                   /note="HMMPfam hit to PF02801, Beta-ketoacyl
FT                   synthase,C-terminal do, score 8.2e-54"
FT                   /inference="protein motif:HMMPfam:PF02801"
FT   CDS             391845..392345
FT                   /transl_table=11
FT                   /gene="fabE"
FT                   /locus_tag="SpyM50357"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="GOA:A2RCX6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX6"
FT                   /protein_id="CAM29699.1"
FT                   /translation="MNIQEIKDLMAQFDTSSLREFLFKTNEGELIFSKNEQHINASISN
FT                   QEHAVPVPQVQLVPNSTASEASSPASVKDVPVEEQPQAESFVAEGDIVESPLVGVAYLA
FT                   ASPDKPPFVAVGDTVKKGQTLVIIEAMKVMNEVPAPCDGVITEILVSNEDVIEFGQGLV
FT                   RIK"
FT   misc_feature    392115..392339
FT                   /gene="fabE"
FT                   /locus_tag="SpyM50357"
FT                   /note="HMMPfam hit to PF00364, Biotin-requiring
FT                   enzyme,score 9.2e-26"
FT                   /inference="protein motif:HMMPfam:PF00364"
FT   CDS             392345..392764
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="SpyM50358"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="GOA:A2RCX7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /protein_id="CAM29700.1"
FT                   /translation="MDIREIQAALPHRYPMLLVDRVLEVSDDHIVAIKNVTINEPFFNG
FT                   HFPHYPVMPGVLIMEALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVMT
FT                   ATFIKRRGTIAVVEARAEVDGKLAASGTLTFACGQ"
FT   misc_feature    392474..392734
FT                   /gene="fabZ"
FT                   /locus_tag="SpyM50358"
FT                   /note="HMMPfam hit to PF03061, Thioesterase
FT                   superfamily,score 5.2e-23"
FT                   /inference="protein motif:HMMPfam:PF03061"
FT   CDS             392796..394160
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="SpyM50359"
FT                   /product="biotin carboxylase subunit of acetyl-CoA
FT                   carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="GOA:A2RCX8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCX8"
FT                   /protein_id="CAM29701.1"
FT                   /translation="MFKKILIANRGEIAVRIIRAARELGISTVAVYSEADKEALHTILA
FT                   DEAICIGPARSKESYLNMNSVLSAAIVTGAQAIHPGFGFLSENSKFATMCEEMNIKFIG
FT                   PSASVMDKMGDKINARSEMIKAGVPVIPGSDGEVYNAQEALAIANKIGYPVMLKASAGG
FT                   GGKGIRKVETEADLEAAFNAASQEALGAFGNGAMYLEKVIYPARHIEVQILGDAYGNII
FT                   HLGERDCSLQRHNQKVLEESPSIAIGNTLRHEMGQAAVRAAKAVAYENAGTIEFLLDED
FT                   SEKFYFMEMNTRIQVEHPVTEFVTGVDIVKEQIKIAAGQPLAINQEDITITGHAIECRI
FT                   NAENTAFNFAPSPGKITDLYMPSGGVGLRVDSAVYNGYAIPPYYDSMIAKIIVHGSNRF
FT                   DALMKMQRALVELEIEGIITNTDFQLDLISDKRVIAGDYDTSFLMETFLPHYNKD"
FT   misc_feature    392796..393134
FT                   /gene="accC"
FT                   /locus_tag="SpyM50359"
FT                   /note="HMMPfam hit to PF00289, Carbamoyl-phosphate synthase
FT                   L chain,, score 2.3e-47"
FT                   /inference="protein motif:HMMPfam:PF00289"
FT   misc_feature    393138..393785
FT                   /gene="accC"
FT                   /locus_tag="SpyM50359"
FT                   /note="HMMPfam hit to PF02786, Carbamoyl-phosphate synthase
FT                   L chain,, score 5.8e-108"
FT                   /inference="protein motif:HMMPfam:PF02786"
FT   misc_feature    393252..393296
FT                   /note="PS00866 Carbamoyl-phosphate synthase subdomain
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00866"
FT   misc_feature    393567..393617
FT                   /note="PS00238 Visual pigments (opsins) retinal binding
FT                   site"
FT                   /inference="protein motif:Prosite:PS00238"
FT   misc_feature    393654..393677
FT                   /note="PS00867 Carbamoyl-phosphate synthase subdomain
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00867"
FT   misc_feature    393804..394127
FT                   /gene="accC"
FT                   /locus_tag="SpyM50359"
FT                   /note="HMMPfam hit to PF02785, Biotin carboxylase
FT                   C-terminal domain, score 6.3e-52"
FT                   /inference="protein motif:HMMPfam:PF02785"
FT   CDS             394169..395035
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="SpyM50360"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit beta"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="GOA:A2RCX9"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /protein_id="CAM29702.1"
FT                   /translation="MALFRKKDKYIRITPNNFLKGSVSHNVPEVPDELFAKCPACKHMI
FT                   YKKDLGLAKICPTCSYNFRISAQERLTLTVDEGSFQELFTSIETKDPLRFPGYQEKLQK
FT                   AKETTGLHEAVLTGKAMVKGQQIALAIMDSHFIMASMGTVVGEKITRLFELAIEENLPV
FT                   VIFTASGGARMQEGIMSLMQMAKVSAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGD
FT                   IILAEPQSLVGFAGRRVIETTVRENLPDDFQKAEFLQDHGFVDAIVKRTELRDKIAHLV
FT                   AFHGGGQ"
FT   CDS             395032..395802
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SpyM50361"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="GOA:A2RCY0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /protein_id="CAM29703.1"
FT                   /translation="MTDVSRVLKEARDQGRLTTLDYANLIFDDFMELHGDRHFSDDGAI
FT                   VGGLAYLAGQPVTVIGIQKGKNLQDNLARNFGQPNPEGYRKALRLMKQAEKFGRPVVTF
FT                   INTAGAYPGVGAEERGQGEAIAKNLMEMSDLKVPIIAIIIGEGGSGGALALAVADQVWM
FT                   LENTMYAVLSPEGFASILWKDGSRATEAAELMKITAGELYQMGIVDRIIPEHGYFSSEI
FT                   VDIIKANLIEQITSLQAKPLDQLLDERYQRFRKY"
FT   misc_feature    395032..395316
FT                   /gene="accA"
FT                   /locus_tag="SpyM50361"
FT                   /note="HMMPfam hit to PF03255, Acetyl co-enzyme A
FT                   carboxylase carboxyltrans, score 9.1e-26"
FT                   /inference="protein motif:HMMPfam:PF03255"
FT   CDS             complement(396035..397312)
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="SpyM50362"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="GOA:A2RCY1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /protein_id="CAM29704.1"
FT                   /translation="MLDLKRIRTDFDTVAAKLKNRGVSEDTLTHLKELDEKRRTLLVQS
FT                   EELKAERNIASAAIAQAKRQKEDATQQIADMQKVSADIKTIDNQLVAIDQQVADIITVL
FT                   PNTPHDSVPVGADEEDNVEIRRWGTPRDFDFEVKAHWDLGEDLDILDWERGAKVTGARF
FT                   LFYKNLGARLERALYNFMLDEHIKEGYQEIITPYMVNHDSMFGTGQYPKFKEDTFELAD
FT                   TNFVLIPTAEVPLTNYYRGEILDGKELPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFH
FT                   KVEMVKFAKSEESYQELEKMTANAENILQKLGLPYRVISLCTGDMGFSAAKTYDLEVWI
FT                   PAQNTYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENY
FT                   QNEDGSVTIPEVLRPYMGGETVISPK"
FT   misc_feature    complement(396365..396829)
FT                   /gene="serS"
FT                   /locus_tag="SpyM50362"
FT                   /note="HMMPfam hit to PF00587, tRNA synthetase class II
FT                   core domain (G,, score 9.8e-62"
FT                   /inference="protein motif:HMMPfam:PF00587"
FT   misc_feature    complement(396461..396535)
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    complement(396989..397312)
FT                   /gene="serS"
FT                   /locus_tag="SpyM50362"
FT                   /note="HMMPfam hit to PF02403, Seryl-tRNA synthetase
FT                   N-terminal domain, score 4.3e-43"
FT                   /inference="protein motif:HMMPfam:PF02403"
FT   CDS             complement(397704..398063)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010360"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY2"
FT                   /protein_id="CAM29705.1"
FT                   /translation="MAQSLNTSVEYKTKAVSYLGMGGKVGHILLGDKALEFYNDKNVND
FT                   YIQIPWTAINHIGANVSRKKVSRHFEIFTDQGKFLFASGDSGKILKITRQHIGNEKVIT
FT                   LPTLMQTFINKFFRH"
FT   misc_feature    complement(397707..398063)
FT                   /locus_tag="SpyM50363"
FT                   /note="HMMPfam hit to PF06115, Domain of unknown function
FT                   (DUF956), score 6e-83"
FT                   /inference="protein motif:HMMPfam:PF06115"
FT   CDS             complement(398177..399088)
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="SpyM50364"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IID component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCY3"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="InterPro:IPR018405"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY3"
FT                   /protein_id="CAM29706.1"
FT                   /translation="MTEQIKLTKSDRQRVWWRSQFLQGSWNYERMQNMGWAYALIPALK
FT                   KLYTSPEDRAAALERHMEFFNTHPYVAAPIIGVTLALEEERANGTPIDDKAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGALGASLASTGNIVGPLLFFFGWNLIRMAFLWYTQEFGY
FT                   KAGSEITKDMSGGILQDITKGASILGMFILAVLVQRWVSINFTIDLPGKQLSDGAYVVF
FT                   PDGAVKGAELKTILANAIGGMSLDKVQAQTLQGQLDSLIPGLAGLLLTFLCMWLLKKKV
FT                   SPIAIIIGLFAFGILAHLAGIM"
FT   misc_feature    complement(398180..399076)
FT                   /gene="manN"
FT                   /locus_tag="SpyM50364"
FT                   /note="HMMPfam hit to PF03613, PTS system
FT                   mannose/fructose/sorbose family I, score 1.1e-207"
FT                   /inference="protein motif:HMMPfam:PF03613"
FT   misc_feature    complement(order(398183..398239,398258..398311,
FT                   398480..398548,398648..398716))
FT                   /gene="manN"
FT                   /locus_tag="SpyM50364"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50364 by TMHMM2.0 at aa 125-147, 181-203, 260-277 and
FT                   284-302"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(399105..399914)
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="SpyM50365"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IIC component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCY4"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY4"
FT                   /protein_id="CAM29707.1"
FT                   /translation="MSDISIISAILVVIIAFFAGLEGILDQFQMHQPLVACTLIGLVTG
FT                   HLEAGVILGGTLQMLALGWANIGAAVAPDAALASVAAAIIMVKSGDFTQKGITFAYSTA
FT                   IPLAVAGLFLTMIVRTLSTALVHAGDKAAAEGNFAGIERFHFIALLLQGLRIAVPAALL
FT                   VAVPTSAVQSVLNAMPNWLNEGMQIGGAMVVAVGYAMVINMMATREVWPFFALGFALAA
FT                   ISQLTLIAMGVIGVAIAFIYLNLSKKGGNGGNAAGSADPIGDILEDY"
FT   misc_feature    complement(order(399186..399287,399306..399374,
FT                   399417..399485,399561..399629,399657..399725,
FT                   399744..399812,399840..399896))
FT                   /gene="manM"
FT                   /locus_tag="SpyM50365"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50365 by TMHMM2.0 at aa 7-25,
FT                   35-57,64-86,96-118,144-166, 181-203 and 210-243"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(399189..399905)
FT                   /gene="manM"
FT                   /locus_tag="SpyM50365"
FT                   /note="HMMPfam hit to PF03609, PTS system sorbose-specific
FT                   iic component, score 1.5e-136"
FT                   /inference="protein motif:HMMPfam:PF03609"
FT   CDS             complement(400003..400995)
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="SpyM50366"
FT                   /product="putative mannose-specific phosphotransferase
FT                   system (PTS), IIAB component"
FT                   /EC_number="2.7.1.69"
FT                   /db_xref="GOA:A2RCY5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY5"
FT                   /protein_id="CAM29708.1"
FT                   /translation="MGIGIIIASHGKFAEGIHQSGSMIFGEQEKVQVVTFMPNEGPDDL
FT                   YGHFNNAIQQFDADDEILVLADLWSGSPFNQASRVAGENPDRKMAIITGLNLPMLIQAY
FT                   TERLMDAGAGVEQVAANIIKESKDGIKALPEDLNPVEETAATEKVVNALQGAIPAGTVI
FT                   GDGKLKINLARIDTRLLHGQVATAWTPASKADRIIVASDEVAQDDLRKQLIKQAAPGGV
FT                   KANVVPISKLIEASKDPRFGNTHALILFQTPQDALRAVEGGVEINELNVGSMAHSTGKT
FT                   MVNNVLSMDKEDVATFEKLRDLGVTFDVRKVPNDSKKNLFELIQKANIK"
FT   misc_feature    complement(400039..400491)
FT                   /gene="manL"
FT                   /locus_tag="SpyM50366"
FT                   /note="HMMPfam hit to PF03830, PTS system sorbose subfamily
FT                   IIB componen, score 1.1e-90"
FT                   /inference="protein motif:HMMPfam:PF03830"
FT   misc_feature    complement(400627..400989)
FT                   /gene="manL"
FT                   /locus_tag="SpyM50366"
FT                   /note="HMMPfam hit to PF03610, PTS system fructose IIA
FT                   component, score 2.9e-54"
FT                   /inference="protein motif:HMMPfam:PF03610"
FT   CDS             complement(401347..402159)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50367"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="GOA:A2RCY6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY6"
FT                   /protein_id="CAM29709.1"
FT                   /translation="MTKKLIAIDLDGTLLHHDNTISTYTQKTIKAVQDKGHHVIISTGR
FT                   PYRMALDYYLQLNLKTPIITFNGVLTHMPEQKWAYEHNVTLDKGYLLRLLKYQDDFQMD
FT                   FIASEYRKNVYITMTNPESIDPQLFGVDEITQDMALEITKITRNPNALLMQTRHEDKYA
FT                   LAKNMRAFFKDEIEIDSWGGPLNILEISSKNINKAYALNYLLGIYNMDKKDLIAFGDEH
FT                   NDTEMLAFAGTGYAMKNASPVLLPYADQQLNFSNEEDGVAKKLEELFL"
FT   misc_feature    complement(401437..402153)
FT                   /locus_tag="SpyM50367"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.0014"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   CDS             402422..403882
FT                   /transl_table=11
FT                   /locus_tag="SpyM50368"
FT                   /product="putative permease"
FT                   /db_xref="GOA:A2RCY7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY7"
FT                   /protein_id="CAM29710.1"
FT                   /translation="MEKFFKLSENGTTVSTEIMAGLTTFFAMSYILFVNPSILGAAGMP
FT                   SNAVFLATIIAAAISTLIMGLFANVPYALAPGMGLNAFFTYTVVFALGFSWQEALAMVF
FT                   ICGLFNIFITVTKFRKSIIKAIPVSLQHAIGGGIGVFVAYLGFKNANIITFSISAENIV
FT                   MVNGVEPAKASAKTFADGLLFVDANGGVVPTISSFTDSSVLLAIFGLLLTTALVIRNFR
FT                   GAILIGIVATTLVGIPLGIVDVSNLNFGIGHIGEAWTELGTTFLAAFDGLSSLFSDSSR
FT                   LPLVFMTIFAFSLSDTFDTIGTFIGTGRRTGIFSQDDENALENSIGFSSKMDRALFADA
FT                   IGTSIGALVGTSNTTTYVESAAGIAEGGRTGLTAVSTAVCFLLSILLLPLVGIVPAAAT
FT                   APALIVVGVMMVSSFLDVNWSKFADALPAFFAAFFMALCYSISYGIAAAFIFYCLVKVV
FT                   EGKTKDIHPIIWGATFLFIVNFIILTIL"
FT   sig_peptide     402422..402592
FT                   /locus_tag="SpyM50368"
FT                   /note="Signal peptide predicted for SpyM50368 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.875) with cleavage
FT                   site probability 0.587 between residues 57 and 58"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    402464..403762
FT                   /locus_tag="SpyM50368"
FT                   /note="HMMPfam hit to PF00860, Permease family, score
FT                   2.3e-13"
FT                   /inference="protein motif:HMMPfam:PF00860"
FT   misc_feature    order(402482..402550,402563..402631,402635..402703,
FT                   402716..402775,402794..402862,402992..403060,
FT                   403079..403147,403271..403339,403556..403660,
FT                   403718..403786,403823..403876)
FT                   /locus_tag="SpyM50368"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50368 by TMHMM2.0 at aa 21-43,
FT                   48-70,72-94,99-118,125-147, 191-213, 220-242,
FT                   284-306,379-413,433-455 and 468-485"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             404036..404497
FT                   /transl_table=11
FT                   /locus_tag="SpyM50369"
FT                   /product="putative P-loop hydrolase"
FT                   /db_xref="GOA:A2RCY8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY8"
FT                   /protein_id="CAM29711.1"
FT                   /translation="MFYSENEYTLKAYGETLGTYLSIGDVIVLSGDLGAGKTTLAKGIA
FT                   KGMGISQMIKSPTYTIVREYEGRLPLYHLDIYRVGDDPDSIDLDDFLFGNGVTVIEWGE
FT                   LLGEGLLQDHLQITITKRDKGRQLDLLAHGERSRQLLEIMSHDSAKSRY"
FT   misc_feature    404063..404422
FT                   /locus_tag="SpyM50369"
FT                   /note="HMMPfam hit to PF02367, Uncharacterised P-loop
FT                   hydrolase UPF0079, score 3.7e-40"
FT                   /inference="protein motif:HMMPfam:PF02367"
FT   misc_feature    404126..404149
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             404472..404996
FT                   /transl_table=11
FT                   /locus_tag="SpyM50370"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="GOA:A2RCY9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCY9"
FT                   /protein_id="CAM29712.1"
FT                   /translation="MIQQSLVIEEGVSQDAKAVLSLVTAAAKETDFITGVETILEATPQ
FT                   ELSDFLSRSQTSFIDFCLLARLDEKVVGLLNLSGEVLSQGQVEADVFMLVAKTYRGYGI
FT                   GQLLLEIALDWAEENPYIESLKLDVQVRNTKAIYLYKKYGFRIESMRKNDIKSKNGDDL
FT                   DVYHMRKSVSQ"
FT   misc_feature    404658..404909
FT                   /locus_tag="SpyM50370"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 2.3e-12"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   CDS             405005..406288
FT                   /transl_table=11
FT                   /locus_tag="SpyM50371"
FT                   /product="LytR family regulatory protein"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ0"
FT                   /protein_id="CAM29713.1"
FT                   /translation="MKIGKKIVLMFTAIVLTTVLALGVYLTSAYTFSTGELSKTFKDFS
FT                   TSSKKSDAIKQTRAFSILLMGVDTGSSERASKWEGNSDSMILVTVNPKTKKTTMTSLER
FT                   DTLTTLSGPKNNEMNGVEAKLNAAYAAGGAQMAIMTVQDLLNITIDNYVQINMQGLIDL
FT                   VNAVGGITVTNEFDFPISIAENEPEYQATVAPGTHKINGEQALVYARMRYDDPEGDYGR
FT                   QKRQREVIQKVLKKILALDSISSYRKILSAVSSNMQTNIEISSRTIPSLLGYRDALRTI
FT                   KTYQLKGEDATLSDGGSYQIVTSNHLLEIQNRIRTELGLHKVSQLKTNATVYENLYGST
FT                   KSQTVNNNYDSSGQAPSYSDSHSSYANYSSGVDTGSSYQSASTDQDSTASSHTPTTPSS
FT                   SSDALAADESSSSGSGSLVPPANINPQT"
FT   sig_peptide     405005..405097
FT                   /locus_tag="SpyM50371"
FT                   /note="Signal peptide predicted for SpyM50371 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.999) with cleavage
FT                   site probability 0.636 between residues 31 and 32"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    405023..405091
FT                   /locus_tag="SpyM50371"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50371 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    405245..405721
FT                   /locus_tag="SpyM50371"
FT                   /note="HMMPfam hit to PF03816, Cell envelope-related
FT                   transcriptional a, score 1e-80"
FT                   /inference="protein motif:HMMPfam:PF03816"
FT   CDS             complement(406399..406755)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50372"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ1"
FT                   /protein_id="CAM29714.1"
FT                   /translation="MKVKTVIAVGLLSFTAYKAYQKRCTIKELLSISRQVKDAAQLDLD
FT                   NIKANLDLIHSQGKVIQNISQDLAHKWRYFNQETQAHLTEIQNRMAKYQEDSELISSES
FT                   PTCQTVILTNNHSR"
FT   CDS             complement(406752..407171)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50373"
FT                   /product="HIT-family protein"
FT                   /db_xref="GOA:A2RCZ2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ2"
FT                   /protein_id="CAM29715.1"
FT                   /translation="MENCIFCSIIQGDIPSSKVYEDEQVLAFLDISQTTKGHTLVIPKQ
FT                   HVRNLLEMTAETASHLFARIPKIARAIQSATGATAMNIINNNEALAGQTVFHAHVHLVP
FT                   RYNEEDGISIQYTTHEPDFPVLEKLARQINQEVSS"
FT   misc_feature    complement(406848..407162)
FT                   /locus_tag="SpyM50373"
FT                   /note="HMMPfam hit to PF01230, HIT domain, score 3.2e-43"
FT                   /inference="protein motif:HMMPfam:PF01230"
FT   misc_feature    complement(406983..407048)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1017.000, SD 2.65 at aa 42-63, sequence
FT                   IPKQHVRNLLEMTAETASHLFA"
FT   CDS             407243..407968
FT                   /transl_table=11
FT                   /locus_tag="SpyM50374"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RCZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ3"
FT                   /protein_id="CAM29716.1"
FT                   /translation="MLNIKNLTGGYHNIPVLNDVSFSVDNGELVGLIGLNGAGKSTTIN
FT                   EIIGFLKPYQGSISIDGLTLAENAVAYRQKIGFIPETPSLYEELTLSEHINTVAMAYDI
FT                   DLEVAQKRAQPFLEMFRLTDKLEWFPVNFSKGMKQKVMIICAFVIDPSLFILDEPFLGL
FT                   DPLAISDLIQTLEAEKAKGKSILMSTHVLDSAERMCDRFVILHHGQVRAQGTLADLQEA
FT                   FGDRSASLNDIYLALTKED"
FT   misc_feature    407321..407866
FT                   /locus_tag="SpyM50374"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   1.9e-48"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    407342..407365
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    407639..407683
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    407771..407794
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             407971..409005
FT                   /transl_table=11
FT                   /locus_tag="SpyM50375"
FT                   /product="ABC transporter protein EcsB"
FT                   /db_xref="GOA:A2RCZ4"
FT                   /db_xref="InterPro:IPR010288"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ4"
FT                   /protein_id="CAM29717.1"
FT                   /translation="MKALFLKRRQDFQKQQNKYLRYVLNDHFVLVLMFLLGFAMVQYGQ
FT                   LLNHFPTNHLPIQVCLGILIPLLLSMGSIATYLEEADQHFLLPKEEEVISYIKQAERLS
FT                   FLLWGTLQTAVLLFLYPIFRRLGLSLFIFIILVLILLALKRVVLSRKTRYFLRGNRLDW
FT                   AKAVAFESNRKQSILKFYSLFTTVKGISTKVKERTYLNPLLKLVKQTPSNLWLSLYARA
FT                   FLRSSDYLGLFLRLMLLSSLSVFFIHNLYLSVSLALIFNYLVVFQLLSLYYHYDYHYMT
FT                   SLYPENSRSKKKNVLSFLRGLSFLMLIVNMLCCSSAPKALILIVGMVFIACIYLPYKLK
FT                   KIID"
FT   misc_feature    407971..408996
FT                   /locus_tag="SpyM50375"
FT                   /note="HMMPfam hit to PF05975, Bacterial ABC transporter
FT                   protein EcsB, score 6.4e-195"
FT                   /inference="protein motif:HMMPfam:PF05975"
FT   misc_feature    order(408025..408093,408136..408204,408277..408336,
FT                   408346..408414,408655..408723,408736..408795,
FT                   408856..408915,408928..408981)
FT                   /locus_tag="SpyM50375"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50375 by TMHMM2.0 at aa 19-41,
FT                   56-78,103-122,126-148,229-251, 256-275, 296-315 and
FT                   320-337"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    408868..408891
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00030"
FT   CDS             409069..409860
FT                   /transl_table=11
FT                   /locus_tag="SpyM50376"
FT                   /product="phosphotransferase enzyme family protein"
FT                   /db_xref="GOA:A2RCZ5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ5"
FT                   /protein_id="CAM29718.1"
FT                   /translation="MTTTEQELTLTPLRGKSGKAYKGTYPNGECVFIKLNTTPILPALA
FT                   KEQIAPQLLWAKRMGNGDMMSAQEWLNGRTLTKEDMNSKQIIHILLRLHKSKKLVNQLL
FT                   QLNYKIENPYDLLVDFEQNAPLQIQQNSYLQAIVKELKRSLPEFKSEVATIVHGDIKHS
FT                   NWVITTSGMIFLVDWDSVRLTDRMYDVAYLLSHYIPRSRWSEWLSYYGYKNNDKVMQKI
FT                   IWYGQFSHLTQILKCFDKRDMEHVNQEIYALRKFREIFRKK"
FT   misc_feature    409093..409743
FT                   /locus_tag="SpyM50376"
FT                   /note="HMMPfam hit to PF01636, Phosphotransferase enzyme
FT                   family, score 8.9e-31"
FT                   /inference="protein motif:HMMPfam:PF01636"
FT   CDS             409860..410495
FT                   /transl_table=11
FT                   /locus_tag="SpyM50377"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="GOA:A2RCZ6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="CAM29719.1"
FT                   /translation="MRVRKRKGAEEHLANNPHYVILNPEDAKGRWHDVFGNDRPIHIEV
FT                   GSGKGGFITGMALKNPDINYIGIDIQLSVLSYALDKVLASEVPNVKLLRVDGSSLTNYF
FT                   EDGEVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEHGEIHFKTDNRGLFEYSL
FT                   ASFSQYGMTLRQIWLDLHASNYEGNVMTEYEEKFSNKGQVIYRVEANF"
FT   misc_feature    409926..410486
FT                   /locus_tag="SpyM50377"
FT                   /note="HMMPfam hit to PF02390, Putative
FT                   methyltransferase,score 7.5e-60"
FT                   /inference="protein motif:HMMPfam:PF02390"
FT   tRNA            410560..410646
FT                   /gene="tRNA-Ser (GGA)"
FT                   /product="transfer RNA-Ser (GGA)"
FT                   /anticodon="(pos:410594..410596,aa:Ser)"
FT   CDS             410754..411290
FT                   /transl_table=11
FT                   /locus_tag="SpyM50378"
FT                   /product="conserved hypothetical protein"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="GOA:A2RCZ7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /protein_id="CAM29720.1"
FT                   /translation="MDSQGPIILEKSIKIEEVIKIANTSIIDIVTKTVTPEIKAPYELV
FT                   DVEYDKMGSDYILSILVDKEGGITVEDTSDLTNIISPLLDTIDPDPFPNQYMLEVSSPG
FT                   LERPLKTADSLKAAVGSYINVSLYQAIDKVKVFQGDLLAFDGETLTIDYLDKTRHKIVN
FT                   IPYQVVAKVRMAVKL"
FT   misc_feature    410850..411275
FT                   /locus_tag="SpyM50378"
FT                   /note="HMMPfam hit to PF02576, Uncharacterised BCR, YhbC
FT                   family COG0779, score 1.7e-61"
FT                   /inference="protein motif:HMMPfam:PF02576"
FT   CDS             411465..412622
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="SpyM50379"
FT                   /product="putative N utilization substance protein A"
FT                   /db_xref="GOA:A2RCZ8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR028620"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ8"
FT                   /protein_id="CAM29721.1"
FT                   /translation="MSKEMLEAFRILEEEKHIDKADIIDAVTESLKSAYKRRYGQSESC
FT                   VIEFNEKTADFQVFTVREVVEEVFDSRLEISLKDALAISSAYELGDKIRFEESVNEFGR
FT                   VAAQSAKQTIMEKMRRQMREVMFNEYKEHEGEIMTGTVERFDQRFIYVNLGSLEAQLSH
FT                   QDQIPGETFKSHDRIDVYVYKVENNPKGVNVFVSRSHPEFIKRIMEQEIPEVFDGTVEI
FT                   MSVSREAGDRTKVAVRSHNPNVDAIGTIVGRGGSNIKKVISKFHPKRVDAKTGLEIPVE
FT                   ENIDVIQWVDDPAEFIYNAIAPAEVDMVLFDDEDLKRATVVVPDSKLSLAIGRRGQNVR
FT                   LAAHLTGYRIDIKSASEYDRLEAEKEAATVVEEPVVDDVMTAEEV"
FT   misc_feature    412416..412565
FT                   /gene="nusA"
FT                   /locus_tag="SpyM50379"
FT                   /note="HMMPfam hit to PF00013, KH domain, score 0.012"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   CDS             412638..412934
FT                   /transl_table=11
FT                   /locus_tag="SpyM50380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="UniProtKB/TrEMBL:A2RCZ9"
FT                   /protein_id="CAM29722.1"
FT                   /translation="MSKVKKIPLRKSLVSGEIIAKRDLLRIVKTKDGQVFIDPTGKQNG
FT                   RGAYIKLDNQEALMAKKKQVFNRSFSMDIPESFYDDLIAYVDHKIKRRELGLD"
FT   misc_feature    412656..412895
FT                   /locus_tag="SpyM50380"
FT                   /note="HMMPfam hit to PF04296, Protein of unknown function
FT                   (DUF448), score 1.5e-32"
FT                   /inference="protein motif:HMMPfam:PF04296"
FT   CDS             412927..413229
FT                   /transl_table=11
FT                   /locus_tag="SpyM50381"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45 family
FT                   protein"
FT                   /db_xref="GOA:A2RD00"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD00"
FT                   /protein_id="CAM29723.1"
FT                   /translation="MTNLERLSSLIGLAQRAGKVISGEELVVKAIQHQQVILVFLANDA
FT                   GPNVTKKVTDKSNYYNVEVSTVLNALELSAALGKPRKVAAIADAGFSKKMRTLME"
FT   misc_feature    412939..413214
FT                   /locus_tag="SpyM50381"
FT                   /note="HMMPfam hit to PF01248, Ribosomal protein
FT                   L7Ae/L30e/S12e/Gadd4, score 2.1e-18"
FT                   /inference="protein motif:HMMPfam:PF01248"
FT   CDS             413249..416110
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="GOA:A2RD01"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /protein_id="CAM29724.1"
FT                   /translation="MSKKRLHEIAKEIGKSSKEVVEHAKYLGLDVKSHASSVEEADAKK
FT                   IISSFSKASKPDVTASQAVKPKEVAQPSVTVVKETGSEHVEKTQVSKPKSRNFKAEREA
FT                   RAKEQAARKQANGSSHRSQERRGGYRQPNNHQTNEQGDKRITHRSQGDTNDKRIERKAS
FT                   NVSPRHDNHQLVGDRNRSFAKENHKNGRFTNQKKQGRQEPQSKSPKIDFKARAAALKAE
FT                   QNAEYSRQSETRFRAQQEAKRLAELARQEAKEAALKAQAEEMSHREAALKSIEEAETKL
FT                   KSSNISAKSTADNRRKKQARPEKNRELTHHSQEGQKKNKKSWNSQNQVRNQKNSNWNKN
FT                   KKTKKGKNVKNTNTAPKPVTERKFHELPKEFEYTEGMTVAEIAKRIKREPAEIVKKLFM
FT                   MGVMATQNQSLDGDTIELLMVDYGIEAKAKVEVDDADIERFFEDENYLNPENIVERAPV
FT                   VTIMGHVDHGKTTLLDTLRNSRVATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFT
FT                   SMRARGASVTDITILIVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVI
FT                   AELAEYGIISTAWGGECEFVEISAKFNKNIDELLETVLLVAEVEELKADPTVRAIGTVI
FT                   EARLDKGKGAIATLLVQQGTLHVQDPIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSIT
FT                   GLNETPMAGDHFAVYADEKAARAAGEERSKRALLKQRQNTQRVSLDNLFDTLKAGEIKT
FT                   VNVIIKADVQGSVEALAASLVKIEVEGVRVNVVHSAVGAINESDVTLAEASNAVIIGFN
FT                   VRPTPQARQQADTDDVEIRLHSIIYKVIEEVEEAMKGKLDPVYQEKVLGEAIIRETFKV
FT                   SKVGTIGGFMVINGKVTRDSSVRVIRDSVVIFDGKLASLKHYKDDVKEVGNAQEGGLMI
FT                   ENFNDLKVDDTIEAYIMEEIVRK"
FT   misc_feature    413249..413407
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /note="HMMPfam hit to PF04760, Translation initiation
FT                   factor IF-2, N-ter, score 1.9e-16"
FT                   /inference="protein motif:HMMPfam:PF04760"
FT   misc_feature    414368..414523
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /note="HMMPfam hit to PF04760, Translation initiation
FT                   factor IF-2, N-ter, score 4.1e-22"
FT                   /inference="protein motif:HMMPfam:PF04760"
FT   misc_feature    414416..414445
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00215"
FT   misc_feature    414608..415111
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /note="HMMPfam hit to PF00009, Elongation factor Tu GTP
FT                   binding domain, score 9.6e-55"
FT                   /inference="protein motif:HMMPfam:PF00009"
FT   misc_feature    414617..414946
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /note="HMMPfam hit to PF01926, GTPase of unknown
FT                   function,score 2.6e-08"
FT                   /inference="protein motif:HMMPfam:PF01926"
FT   misc_feature    414635..414658
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    415178..415369
FT                   /gene="infB"
FT                   /locus_tag="SpyM50382"
FT                   /note="HMMPfam hit to PF03144, Elongation factor Tu domain,
FT                   score 1.2e-10"
FT                   /inference="protein motif:HMMPfam:PF03144"
FT   CDS             416316..416666
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="SpyM50383"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="GOA:A2RD02"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /protein_id="CAM29725.1"
FT                   /translation="MANHRIDRVGMEIKREVNDILQKKVRDPRVQGVTITEVQMQGDLS
FT                   LAKVYYTIMSDLASDNQKAQTGLEKATGTIKRELGKQLTMYKIPDLVFEKDNSIAYGNK
FT                   IDQLLRELDNKS"
FT   misc_feature    416328..416642
FT                   /gene="rbfA"
FT                   /locus_tag="SpyM50383"
FT                   /note="HMMPfam hit to PF02033, Ribosome-binding factor
FT                   A,score 5.7e-29"
FT                   /inference="protein motif:HMMPfam:PF02033"
FT   CDS             complement(416798..417787)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50384"
FT                   /product="putative exported protein"
FT                   /db_xref="GOA:A2RD03"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD03"
FT                   /protein_id="CAM29726.1"
FT                   /translation="MKHPIRKTLVTLGLLLTLCLPTPVAASSRSWKSWFIEQYFWLKRD
FT                   KSYYSKQDDPSFQRYLDACREQSDKPYQLDTNLVNGPLVQENLYGMQVYSWNDNGKPDQ
FT                   KTIIYLAGGSYLNNPTTYHINMLKTLSTSLDAKIVLPIYPKAPRYAYNYTMPKLVNLYQ
FT                   HYYHKNQNIFLMGDSAGGGLALGLAHALHNESVPQPKQLVLLSPWLDVTMSHPEIPKYE
FT                   DADPILSSWGLKRVGELWAYSADNTNHIYVSPKNGPITYLPPITLFTGTREIFYPDIRD
FT                   YAAKLKAANHNITFITQEGMNHVYPIYPIEEAKTAQYQIIDAINKTPQ"
FT   sig_peptide     complement(417710..417787)
FT                   /locus_tag="SpyM50384"
FT                   /note="Signal peptide predicted for SpyM50384 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.846 between residues 26 and 27"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             417959..418393
FT                   /transl_table=11
FT                   /gene="copY"
FT                   /locus_tag="SpyM50385"
FT                   /product="putative negative regulator of copper transport
FT                   operon"
FT                   /db_xref="GOA:A2RD04"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014071"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD04"
FT                   /protein_id="CAM29727.1"
FT                   /translation="MQQISAAEWEVMRVVWASGDIKSSDIITILRKKYQWSDSTIKTLI
FT                   GRLVEKKALETYREGRAYIYQALLDETLLQKEALATVLDGICQRQHARLLLERLYDLPM
FT                   TLEEIEAFQELLELKKENAVLEVPCNCLPGQCHCQKKETY"
FT   misc_feature    417959..418315
FT                   /gene="copY"
FT                   /locus_tag="SpyM50385"
FT                   /note="HMMPfam hit to PF03965, Penicillinase
FT                   repressor,score 1.2e-10"
FT                   /inference="protein motif:HMMPfam:PF03965"
FT   CDS             418393..420624
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="SpyM50386"
FT                   /product="copper-transporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="GOA:A2RD05"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD05"
FT                   /protein_id="CAM29728.1"
FT                   /translation="MAKEIFLVEGMSCASCALTIEKTVNQLPEVEQAVVNLATEKLTVT
FT                   YQDDDLETAKVIQAVKAAGYGAQVFDEHAKHMQTGRRDEDLKVIWSQVLWSALFTIPIL
FT                   YLAMGHMVGLWLPPFMQPDRYPFVYSFSQLLLTIPVLVLNRHYYHNGFEALFKGHPNMD
FT                   SLVALATSFAFAYSLYGVVEISLGQAHFVHSLYFESVVVILTLIGLGKYFESRSKGRTS
FT                   QAIQKLLSLKATDVRVWRNSQWQLLPLEEVSYDDLVLVQPGEKVSIDGIIVEGHSSLDE
FT                   SFLTGESLPVEKGEKDNVFAGSLNGPGALTIKPDKLGNDTLLAQIIQLVENAQENKAPI
FT                   AAIADRVSGVFVPVVLVLALLTGVFWLVFMQESFRFSLTTAIAVLVIACPCALGLATPT
FT                   AIMVGTGRAAENGILFKGGDILEQAHQVDTVVFDKTGTVTEGKPSLQKLLIFSGDDHLI
FT                   LQEAASLEAYSQHPLGEAIVRAAQEAGYDSLPVEEFESLTGLGVTGQLEGRRLAIGNAA
FT                   LMGILGIDLSCVQSVCAKASGKGQTLVYYAKEGQLRALFSIADAVKEDSQATVEALHQL
FT                   GIHTIMLTGDHDATAKAIASQVGITDVISQVLPDQKAGVIADLRSQGRKVAMVGDGIND
FT                   APALAVADIGIAMGSGTDIAIESADVILMKPDMLDLVKAMSLSRATMRIVKENLFWAFI
FT                   YNVLMIPVAMGLLHLFGGPLLNPMLAGFAMSFSSVSVVLNALRLKGKTI"
FT   misc_feature    418405..418599
FT                   /gene="copA"
FT                   /locus_tag="SpyM50386"
FT                   /note="HMMPfam hit to PF00403, Heavy-metal-associated
FT                   domain, score 3.1e-17"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    418414..418503
FT                   /note="PS01047 Heavy-metal-associated domain"
FT                   /inference="protein motif:Prosite:PS01047"
FT   misc_feature    order(418654..418722,418765..418824,418885..418953,
FT                   418963..419031,419431..419499,419527..419595,
FT                   420454..420522,420532..420600)
FT                   /gene="copA"
FT                   /locus_tag="SpyM50386"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50386 by TMHMM2.0 at aa 88-110,125-144,165-187,191-213,
FT                   347-369, 379-401, 688-710 and 714-736"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    418996..419661
FT                   /gene="copA"
FT                   /locus_tag="SpyM50386"
FT                   /note="HMMPfam hit to PF00122, E1-E2 ATPase, score 4.6e-93"
FT                   /inference="protein motif:HMMPfam:PF00122"
FT   misc_feature    419671..420348
FT                   /gene="copA"
FT                   /locus_tag="SpyM50386"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 5.8e-41"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    419689..419709
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site"
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    420277..420345
FT                   /note="PS01229 Hypothetical cof family signature 2"
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    420595..420618
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             420638..420841
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="SpyM50387"
FT                   /product="putative copper chaperone"
FT                   /db_xref="GOA:A2RD06"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD06"
FT                   /protein_id="CAM29729.1"
FT                   /translation="MEKHYQVTGMTCDGCARTVTEKLSAVPGVQSVQVNLEKGEAKVTG
FT                   RPLTFLLKRALKDTKFELHKWS"
FT   misc_feature    420647..420832
FT                   /gene="copZ"
FT                   /locus_tag="SpyM50387"
FT                   /note="HMMPfam hit to PF00403, Heavy-metal-associated
FT                   domain, score 3.2e-13"
FT                   /inference="protein motif:HMMPfam:PF00403"
FT   misc_feature    420656..420745
FT                   /note="PS01047 Heavy-metal-associated domain"
FT                   /inference="protein motif:Prosite:PS01047"
FT   CDS             complement(421045..421815)
FT                   /transl_table=11
FT                   /gene="lacR1"
FT                   /locus_tag="SpyM50388"
FT                   /product="lactose phosphotransferase system repressor 1"
FT                   /note="Similar to SpyM51614, 54.118% identity (54.980%
FT                   ungapped) in 255 aa overlap"
FT                   /db_xref="GOA:A2RD07"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD07"
FT                   /protein_id="CAM29730.1"
FT                   /translation="MLKRERLLKITEIVNEQGIVTVNDIIQTLNVSDMTVRRDLDELEK
FT                   AGKLIRIHGGAQSITMPNKKERSNIEKQTVQTKEKWELASYATQLVNDGETIFIGPGTT
FT                   LECFAEQLKNRQIRIVTNSLPVFNILQDSETIDLILIGGEYRSITGAFVGSLASQNISS
FT                   LKFAKAFISCNGIYKNDIATYSETEGEIQKLAFNNSIEKYLLVDNQKFNAYDFFIFYHL
FT                   NNIDAVVTDSQITEDVIERYSQFTQLLVAHENKE"
FT   misc_feature    complement(421123..421800)
FT                   /gene="lacR1"
FT                   /locus_tag="SpyM50388"
FT                   /note="HMMPfam hit to PF00455, Bacterial regulatory
FT                   proteins, deoR family, score 1.1e-94"
FT                   /inference="protein motif:HMMPfam:PF00455"
FT   misc_feature    complement(421696..421800)
FT                   /note="PS00894 Bacterial regulatory proteins, deoR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00894"
FT   CDS             422052..422525
FT                   /transl_table=11
FT                   /locus_tag="SpyM50389"
FT                   /product="sugar phosphotransferase system (PTS), IIA
FT                   component"
FT                   /db_xref="GOA:A2RD08"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD08"
FT                   /protein_id="CAM29731.1"
FT                   /translation="MFPNILFTEARTQPELFDLVASHLEKVGYVTQEYHQALVEREAVF
FT                   PTGLKVDLKDGSDILYAAIPHTETKYCLVDQVVYVRNSQALTFKHMINPEEDCLVTDFF
FT                   FIINSQNEGQTTILSNLITFFITKGNLSCLASLKDDKQAISNYLIEKGVFQHD"
FT   misc_feature    422052..422492
FT                   /locus_tag="SpyM50389"
FT                   /note="HMMPfam hit to PF00359,Phosphoenolpyruvate-dependent
FT                   sugar phosph, score 0.0022"
FT                   /inference="protein motif:HMMPfam:PF00359"
FT   CDS             422518..422823
FT                   /transl_table=11
FT                   /locus_tag="SpyM50390"
FT                   /product="sugar phosphotransferase system (PTS), IIB
FT                   component"
FT                   /db_xref="GOA:A2RD09"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD09"
FT                   /protein_id="CAM29732.1"
FT                   /translation="MIKILAACGAGVNSSHQIKDAIETQMSDRGYDVHCDAVMVKDITE
FT                   ELVSRYDIFTPIAKTDLGFEMPIPTVEAGPILYRIPNMSEPVFAELERVIKENHLQ"
FT   CDS             422849..424300
FT                   /transl_table=11
FT                   /locus_tag="SpyM50391"
FT                   /product="sugar phosphotransferase system
FT                   (PTS),galactitol-specific family, IIC component"
FT                   /note="Possible alternate translational start site"
FT                   /db_xref="GOA:A2RD10"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD10"
FT                   /protein_id="CAM29733.1"
FT                   /translation="MMQPFLDIINKILGFPIQLGSGVVMLIVMTGLAMIFGVKFTKALE
FT                   GGIKLAIALTGIGAIIGILTGAFSESLQAFVKNTGISLNIIDVGWAPLATITWGSPYTL
FT                   YFLLVMLVVNIVMIVMKKTDTLDVDIFDIWHLSITGLLIMWYAARNHLPIFVSLLIATV
FT                   AVILVGVLKIINSDLMKPTFDDLLGTGPQSPMTSTHMNYMMNPIIMVLDKIFDKVFPGL
FT                   DKYDFDAAKLNKKIGFWGSKFFIGMALGFVIGIMGDPHFSVESVRNWFGLGFTAGACLE
FT                   LFSLIGSWFIAAVEPLSQGITNFANARMHGRRFNIGLDWPFIAGRAEIWACANILAPIM
FT                   LIEAVLLSKVGNGILPLAGIIAMGMTPALLVVTRGRLIRMIIFGSLLLPLFLLSGTMIA
FT                   PFATELAKKVGAFPAGASAGSLITHSTLEGPMEKIFGYVIGQATTGQIASIITLIIFVA
FT                   IYLGLFAWYANQMKARNAEYAKTMK"
FT   misc_feature    order(422891..422959,422996..423055,423134..423202,
FT                   423239..423292,423302..423370,423554..423613,
FT                   423656..423724,423812..423880,423908..423967,
FT                   423986..424054,424181..424249)
FT                   /locus_tag="SpyM50391"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50391 by TMHMM2.0 at aa 15-37,
FT                   50-69,96-118,131-148,152-174, 236-255, 270-292,
FT                   322-344,354-373,380-402 and 445-467"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    423191..424153
FT                   /locus_tag="SpyM50391"
FT                   /note="HMMPfam hit to PF03611, PTS system
FT                   Galactitol-specific IIC component, score 7.8e-203"
FT                   /inference="protein motif:HMMPfam:PF03611"
FT   CDS             424380..424499
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50391A"
FT                   /note="Possible gene remnant. Similar to an internal region
FT                   of Bacteroides fragilis putative RhsD protein.
FT                   UniProt:Q64SC9 (EMBL:AP006841) (1462 aa) fasta scores:
FT                   E()=6.1, 38.235% id in 34 aa. CDS lacks a translational
FT                   start codon"
FT   CDS             424564..424989
FT                   /transl_table=11
FT                   /gene="lacA1"
FT                   /locus_tag="SpyM50392"
FT                   /product="galactose-6-phosphate isomerase LacA subunit 1"
FT                   /EC_number="5.3.1.26"
FT                   /db_xref="GOA:A2RD11"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004783"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD11"
FT                   /protein_id="CAM29735.1"
FT                   /translation="MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTLA
FT                   VAKAVNEAEGRLGIMVDAYGAGPFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITMG
FT                   AEIVGPELAKNIAKGFVTGHYDGGRHQIRVDMLNKMA"
FT   misc_feature    424735..424977
FT                   /gene="lacA1"
FT                   /locus_tag="SpyM50392"
FT                   /note="HMMPfam hit to PF02502, Ribose/Galactose
FT                   Isomerase,score 1.6e-44"
FT                   /inference="protein motif:HMMPfam:PF02502"
FT   CDS             425004..425519
FT                   /transl_table=11
FT                   /gene="lacB1"
FT                   /locus_tag="SpyM50393"
FT                   /product="galactose-6-phosphate isomerase LacB subunit 1"
FT                   /EC_number="5.3.1.26"
FT                   /note="Similar to SpyM51612, 73.684% identity (73.684%
FT                   ungapped) in 171 aa overlap"
FT                   /db_xref="GOA:A2RD12"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004784"
FT                   /protein_id="CAM29736.1"
FT                   /translation="MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIF
FT                   GKKVGEAVVNGQADLGVCICGTGVGINNAVNKVPGIRSALVRDMTTALYAKEELNANVI
FT                   GFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAKIAHLETHHANQEDPDFFTEFLEK
FT                   WDRGEYHD"
FT   misc_feature    425184..425429
FT                   /gene="lacB1"
FT                   /locus_tag="SpyM50393"
FT                   /note="HMMPfam hit to PF02502, Ribose/Galactose
FT                   Isomerase,score 2.6e-44"
FT                   /inference="protein motif:HMMPfam:PF02502"
FT   CDS             join(425529..425678,425681..425920,425923..425985)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lacC1"
FT                   /locus_tag="SpyM50394"
FT                   /EC_number="2.7.1.144"
FT                   /note="Probable gene remnant. Similar to the N-terminal
FT                   region of Lactococcus lactis (subsp. lactis) (Streptococcus
FT                   lactis) tagatose-6-phosphate kinase LacC UniProt:LACC_LACLA
FT                   (EMBL:C39778) (EC ( 310 aa) fasta scores: E()=1.6e-24,
FT                   55.844% id in 154 aa. Similar to the N-terminal region of
FT                   SpyM51611, 50.331% identity (51.701% ungapped) in 151 aa
FT                   overlap"
FT   CDS             426029..427006
FT                   /transl_table=11
FT                   /gene="lacD1"
FT                   /locus_tag="SpyM50395"
FT                   /product="tagatose 1,6-diphosphate aldolase 1"
FT                   /EC_number="4.1.2.40"
FT                   /note="Similar to SpyM51610, 72.923% identity (72.923%
FT                   ungapped) in 325 aa overlap"
FT                   /db_xref="GOA:A2RD13"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR005927"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD13"
FT                   /protein_id="CAM29738.1"
FT                   /translation="MTITANKRHYLEKVSHQGIISALAFDQRGALKQMMAAHQEGEATV
FT                   TQIETLKVLVSEELTPYASSILLDPEYGLLATKVRANQTGLLLAYEKTGYDATTTSRLP
FT                   DCLVEWSVKRLKAAGADAIKFLLYYDVDGDEQINLQKQAYIERIGSECTAEDIPFFLEL
FT                   LSYDERISDNNSAAYAKLKPHKVNGAMSVFSDKRFGVDVLKVEVPVNMAYVEGFTEGEV
FT                   HYSQAEAIKAFQDQEAASHLPYIYLSAGVSAKLFQETLYFAAAAGAQFSGVLCGRATWA
FT                   GSVPVYITKGEDEARKWLCTEGFQNIDELNRVLEETASPWTEKI"
FT   misc_feature    426044..427000
FT                   /gene="lacD1"
FT                   /locus_tag="SpyM50395"
FT                   /note="HMMPfam hit to PF04274, Tagatose 1,6-diphosphate
FT                   aldolase, (LacD), score 2.9e-228"
FT                   /inference="protein motif:HMMPfam:PF04274"
FT   CDS             427203..427820
FT                   /transl_table=11
FT                   /locus_tag="SpyM50396"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD14"
FT                   /protein_id="CAM29739.1"
FT                   /translation="MTIDMWEILNIIGTIAFALSGAIVAMEEEFDILGIFILGFVTAFG
FT                   GGAIRNTLIGLPIEALWGQKPEFTCAFFAMVLIMLFPKLIARGWVRAAVLTDAIGLAAF
FT                   SVQGALHAVRLNQPLSAVIVAAVLTGAGGGVVRDILAGRKPSVLRSEIYAGWSILAAIV
FT                   LHFKLADSTIECYALVVLLTTLRMIGNRKKWNLPKIKWKEER"
FT   misc_feature    order(427215..427277,427296..427364,427407..427460,
FT                   427557..427625,427683..427751)
FT                   /locus_tag="SpyM50396"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50396 by TMHMM2.0 at aa 5-25, 32-54, 69-86, 119-141 and
FT                   161-183"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    427218..427475
FT                   /locus_tag="SpyM50396"
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF03458"
FT   misc_feature    427479..427736
FT                   /locus_tag="SpyM50396"
FT                   /note="HMMPfam hit to PF03458, UPF0126 domain, score
FT                   1.1e-34"
FT                   /inference="protein motif:HMMPfam:PF03458"
FT   CDS             427822..428646
FT                   /transl_table=11
FT                   /locus_tag="SpyM50397"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="GOA:A2RD15"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD15"
FT                   /protein_id="CAM29740.1"
FT                   /translation="MIQLIAIDLDGTLLNQDKQIPKENITAIQEAAQSGLKIVLCTGRP
FT                   QSGTRPYFDQLGLTQEEFLIINNGCSTYSSPDWQLRHSKMLKVSDIELLEELSQSFPDI
FT                   YLTLTEENDYLVLEEEVPDLVQEDGDLVFTIVKPVSLAELSDTPRLIFQAMYLGEKAAL
FT                   DAFERAVRNQLSQSFHVVRSQDNILEILPQGVSKASALKELVEDLGLTADQVMAIGDAP
FT                   NDIEMLTYAGLGVAMENASAAIKPLADKVTLTNDMAGVAQAIRQFALAAQKD"
FT   misc_feature    427825..428544
FT                   /locus_tag="SpyM50397"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 1.5e-07"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    427831..427866
FT                   /note="PS01228 Hypothetical cof family signature 1"
FT                   /inference="protein motif:Prosite:PS01228"
FT   misc_feature    428473..428541
FT                   /note="PS01229 Hypothetical cof family signature 2"
FT                   /inference="protein motif:Prosite:PS01229"
FT   CDS             complement(428682..429239)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50398"
FT                   /product="TetR family regulatory protein"
FT                   /db_xref="GOA:A2RD16"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD16"
FT                   /protein_id="CAM29741.1"
FT                   /translation="MTDKALSKRSLQNLTQFNKETRRIARESMEIALLNLLETKPLGDI
FT                   TISELVTKAGVSRNAFYRNYTSKEAIIEQLLVGVIRRIFRGLKQFDIKTQAYQAWLYLF
FT                   TEAKKEAQLLKMIFKHHLHHLLTRLVTKRLKAYQKLKDKKQSHYKRLFWSNAIVSVLTN
FT                   WISDDMIVPAEEMAAMGLPLLT"
FT   misc_feature    complement(429015..429155)
FT                   /locus_tag="SpyM50398"
FT                   /note="HMMPfam hit to PF00440, Bacterial regulatory
FT                   proteins, tetR family, score 0.00017"
FT                   /inference="protein motif:HMMPfam:PF00440"
FT   misc_feature    complement(429042..429107)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1142.000, SD 3.08 at aa 46-67, sequence
FT                   ITISELVTKAGVSRNAFYRNYT"
FT   CDS             429532..430374
FT                   /transl_table=11
FT                   /locus_tag="SpyM50399"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RD17"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD17"
FT                   /protein_id="CAM29742.1"
FT                   /translation="MTWKIVTDSGCDLRSLTRQSKELRFERVPLTLQIGTEIFRDDDGL
FT                   DIDNMMTTMYQSSKATTSSCPSPEAFLQAYRGADNVIVMTITGTLSGSHNSARLAKNEL
FT                   LEENPNVNIHLIDSLSAGGEMDLLVLELERLINLGLSFEEVVKQITAYQQKTRLIFVLA
FT                   KVDNLVKNGRLSKLVGKVIGLLNIRMVGKASNKGTLELLQKARGQKKAVSALIEEIQKE
FT                   GYVGGKVYIAHAQNPKICEQISEKIKSLYPDAVIQTGRTSGLCSFYAEDGGLLMGYEI"
FT   misc_feature    429736..430368
FT                   /locus_tag="SpyM50399"
FT                   /note="HMMPfam hit to PF02645, Uncharacterized protein,DegV
FT                   family COG1307, score 7.1e-65"
FT                   /inference="protein motif:HMMPfam:PF02645"
FT   CDS             complement(430503..431189)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50400"
FT                   /product="putative lipoprotein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD18"
FT                   /protein_id="CAM29743.1"
FT                   /translation="MTKSQKEALYWMLSVLTITLIGGSCLIFGSHPQTQDKVAKHSKSA
FT                   ASLLKKAVKAVNDADRLATAAAIQEAQKAVDKLAESSKKKTLQEQLNVAKAKQEQEDAA
FT                   TQAVKAAEETLNQNLKDIAQKAVNDLSNKGKKAALQSRLDAILPAKPIIDEFPRQSGEI
FT                   TDNSYWTPFPGDVSDTYDNSQSPTLDPSSESSASDVTPQPSHPDPIPPQTSSEPSDSGD
FT                   KQSSKE"
FT   sig_peptide     complement(431070..431189)
FT                   /locus_tag="SpyM50400"
FT                   /note="Signal peptide predicted for SpyM50400 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.786) with cleavage
FT                   site probability 0.341 between residues 40 and 41"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(431097..431165)
FT                   /locus_tag="SpyM50400"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50400 by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(431115..431147)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             431427..433058
FT                   /transl_table=11
FT                   /locus_tag="SpyM50401"
FT                   /product="putative Na+/Pi-cotransporter protein"
FT                   /db_xref="GOA:A2RD19"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD19"
FT                   /protein_id="CAM29744.1"
FT                   /translation="MSVNWQDIAFHFFGGLGLFLFSIKYMGDGLQQAAGDKLRYYIDKY
FT                   TSNPFFGILVGIAMSALIQSSSGVTVITVGLVSAGLLNLRQAIGIVMGANIGTTITSFL
FT                   IGFKLGDYALPMIFIGAACLFFTSNKKLNNFGRIIFGVGGIFFSLNLMGDAMDPLKSVS
FT                   AFQNYLATLGDKPFQGVFIGTALTMLIQSSAAIIGILQGLFSGGLLTLQGAIPILLGSN
FT                   IGTCITAVLAAIGSNIAAKRVAAAHVLFNLIGTIIFMIILVPFTSLMLWLQSKLSLTPE
FT                   MTIAFSHGSFNITNTILLIPFISLLAMIVTRLIPGEDEVVKYEALYLDRLLITQAPSIA
FT                   LGNAHKELVHLASYAIQAFEASYSYIMTADDKFGEKVKRYERAVDTIDEELTTYLVDIS
FT                   NEALSPSENEVLAGILDSSRDLERIGDHSESLGILIEGIISKQIGFSISARQELTEMYQ
FT                   LTHCLTLDAIRAIVDSDTDLAQTIVTRHKEIEEKERRLRKTHIKRLNCGECTAQAGINF
FT                   IDIISHYTRITDHALNLAEKVLSHQL"
FT   misc_feature    order(431427..431495,431574..431669,431688..431747,
FT                   431760..431813,431955..432023,432066..432134,
FT                   432171..432239,432297..432365)
FT                   /locus_tag="SpyM50401"
FT                   /note="8 probable transmembrane helices predicted for
FT                   SpyM50401 by TMHMM2.0 at aa 7-29,
FT                   56-87,94-113,118-135,183-205, 220-242, 255-277 and 297-319"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    431478..431951
FT                   /locus_tag="SpyM50401"
FT                   /note="HMMPfam hit to PF02690, Na+/Pi-cotransporter, score
FT                   7.6e-77"
FT                   /inference="protein motif:HMMPfam:PF02690"
FT   CDS             433176..434324
FT                   /transl_table=11
FT                   /locus_tag="SpyM50402"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /db_xref="GOA:A2RD20"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD20"
FT                   /protein_id="CAM29745.1"
FT                   /translation="MTCYLKADCFYYPTEVKPAGYLSLHDGVFGEWTEIVPADAQIIDY
FT                   TGYQIAPGLVDTHIHGYAGADVMDNSAQGIHQMSEGLLATGVTSFLPTTLTSTFEQLEK
FT                   VSGTIASVADQVKGAKIQGIYFEGPYFTEEYKGAQNPSYMKNPRLEEFDAWQKAAKGLI
FT                   KKIALAPERDGVKEFVSAVTKQGVTVALGHSNGTYQEAKEAVQAGASVWVHAYNGMRGL
FT                   THREPGMVGAVYNLPNTYAELICDGHHVSPIACDILMQQKGHDHVAMITDCMRAGGSPD
FT                   GDYLLGEFSVVVANGTARLKESGNLAGSILKLKDGLRNVVAWGIATPAEAIHMATYVPA
FT                   VSVGIDDVCGQIKAGHAADFIVLDKDLTLVATYLNGQKAFDA"
FT   misc_feature    433320..434267
FT                   /locus_tag="SpyM50402"
FT                   /note="HMMPfam hit to PF01979, Amidohydrolase family,score
FT                   1.1e-12"
FT                   /inference="protein motif:HMMPfam:PF01979"
FT   CDS             434446..435285
FT                   /transl_table=11
FT                   /locus_tag="SpyM50403"
FT                   /product="aldo/keto reductase family protein"
FT                   /db_xref="GOA:A2RD21"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD21"
FT                   /protein_id="CAM29746.1"
FT                   /translation="MVTTVKMTSGYEIPVLGFGTYQAADGEEAYQSTLAAIKAGYRHID
FT                   TAAIYKNEESVGRAIKDSGVLREDLFITTKLWNDAHSYEGAKDALAASLDHLGLDYVDL
FT                   YLIHWPNPKALRNTWKEANAQAWQYMEEAVEAGLIKSIGVSNFMVHHLEALQETAKITP
FT                   AINQIRLAPGCYQKEVVDYCKANEILLEAWSPLGQGEIFDNETMQQLANKYDKTVAQVA
FT                   LAWSLAEGFIPLPKSVHDERIKENMAIFDVSLTQEDKKTIRYLSGMSAIPNPDTTSF"
FT   misc_feature    434464..435246
FT                   /locus_tag="SpyM50403"
FT                   /note="HMMPfam hit to PF00248, Aldo/keto reductase
FT                   family,score 8.7e-114"
FT                   /inference="protein motif:HMMPfam:PF00248"
FT   misc_feature    434563..434616
FT                   /note="PS00798 Aldo/keto reductase family signature 1"
FT                   /inference="protein motif:Prosite:PS00798"
FT   misc_feature    434833..434886
FT                   /note="PS00062 Aldo/keto reductase family signature 2"
FT                   /inference="protein motif:Prosite:PS00062"
FT   misc_feature    435145..435192
FT                   /note="PS00063 Aldo/keto reductase family putative active
FT                   site signature"
FT                   /inference="protein motif:Prosite:PS00063"
FT   CDS             435420..435953
FT                   /transl_table=11
FT                   /locus_tag="SpyM50404"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   (ICMT) family protein"
FT                   /db_xref="GOA:A2RD22"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD22"
FT                   /protein_id="CAM29747.1"
FT                   /translation="MTIFLVMLAMFTIRLVFLKKSITNEKAILAQGGQEFGAQNTKFLT
FT                   LLHIMIYVFAVIEALLKQIKFDGISFLGLLLMLLSVAVLYEVTRILGDIWTVKLMLAKD
FT                   HKYVDHWLFKTIKHPNYFLNIAPELVGIALLCHAKITAMLLFPCYIVVIYLRIREENKL
FT                   LAEVIIPNGTRTKP"
FT   misc_feature    order(435549..435602,435621..435689,435810..435878)
FT                   /locus_tag="SpyM50404"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50404 by TMHMM2.0 at aa 44-61, 68-90 and 131-153"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    435630..435917
FT                   /locus_tag="SpyM50404"
FT                   /note="HMMPfam hit to PF04140, Isoprenylcysteine carboxyl
FT                   methyltransferase, score 2.5e-49"
FT                   /inference="protein motif:HMMPfam:PF04140"
FT   CDS             436325..437242
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SpyM50405"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="GOA:A2RD23"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /protein_id="CAM29748.1"
FT                   /translation="MSKKLTFQEIILTLQQYWNDQGCMLMQAYDNEKGAGTMSPYTFLR
FT                   AIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLASLEKLG
FT                   INPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATSPVTAEVTY
FT                   GLERLASYIQEVDSVYDIEWAPGVKYGEIFLQPEYEHSKYSFEISDQDMLLENFEKFEK
FT                   EASRALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVA
FT                   ERKKLGFPLLDEATRAILLAEDDE"
FT   misc_feature    436343..437194
FT                   /gene="glyQ"
FT                   /locus_tag="SpyM50405"
FT                   /note="HMMPfam hit to PF02091, Glycyl-tRNA synthetase alpha
FT                   subunit, score 1.1e-219"
FT                   /inference="protein motif:HMMPfam:PF02091"
FT   misc_feature    436808..436837
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS             437620..439659
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SpyM50406"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="GOA:A2RD24"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR015944"
FT                   /protein_id="CAM29749.1"
FT                   /translation="MSKNLLIELGLEELPAYVVTPSEKQLGERLATFLTENRLSFEDIQ
FT                   TFSTPRRLAVRVSGLAAQQTDLTEDFKGPAKKIALDADGNFSKAAQGFVRGKGLTTDAI
FT                   EFREVKGEEYVYVTKHEAGKPAKEVLLGVTEVLSAMTFPVSMHWANNSFEYIRPVHTLT
FT                   VLLDDEALDLDFLDIHSGRVSRGHRFLGKETTITSADSYEDDLRSQFVIADAKERQEMI
FT                   VEQIKTLEVEQGVQVDIDEDLLNEVLNLVEFPTAFMGSFEAKYLDVPEEVLVTSMKNHQ
FT                   RYFVVRDQEGRLMPNFVSVRNGNDQAIENVIKGNEKVLVARLEDGEFFWREDQKLQIAD
FT                   LVAKLTNVTFHEKIGSLAEHMDRTRVIAASLAKEANLSAEEEAAVDRAAQIYKFDLLTG
FT                   MVGEFDELQGIMGEKYALLSGEDAAVATAIREHYLPDAAGGALPETKVGAVLALADKLD
FT                   TLLSFFSVGLIPSGSNDPYALRRATQGIVRILDHFGWRIPMDKLVDSLYDLSFDSLTYT
FT                   NKADVMNFIRARVDKMMGKAAPKDIREAILASSTFVVPEMLAVAEALVKASHTENYKPA
FT                   VESLSRAFNLAEKADASVHVDPSLFENEQENTLFAAIQGLTLAGSAAQQLEQVFVLSPV
FT                   INDFFDNTMVMAEDQALKNNRLAILSDLVSKAKTIAAFNQLNTK"
FT   misc_feature    437632..439278
FT                   /gene="glyS"
FT                   /locus_tag="SpyM50406"
FT                   /note="HMMPfam hit to PF02092, Glycyl-tRNA synthetase beta
FT                   subunit, score 2.6e-223"
FT                   /inference="protein motif:HMMPfam:PF02092"
FT   misc_feature    439345..439608
FT                   /gene="glyS"
FT                   /locus_tag="SpyM50406"
FT                   /note="HMMPfam hit to PF05746, DALR anticodon binding
FT                   domain, score 4.5e-05"
FT                   /inference="protein motif:HMMPfam:PF05746"
FT   CDS             439813..440070
FT                   /transl_table=11
FT                   /locus_tag="SpyM50407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RD25"
FT                   /db_xref="InterPro:IPR009242"
FT                   /db_xref="InterPro:IPR023218"
FT                   /protein_id="CAM29750.1"
FT                   /translation="MDPKKIARINELAKKKKTVGLTGPEKVEQAKLREEYIEGYRRSVR
FT                   HHIEGIKLVDEEGNDVTPEKLRQVQREKGLHGRSLDDPKS"
FT   misc_feature    439819..440013
FT                   /locus_tag="SpyM50407"
FT                   /note="HMMPfam hit to PF05979, Bacterial protein of unknown
FT                   function (DUF89, score 1.1e-41"
FT                   /inference="protein motif:HMMPfam:PF05979"
FT   CDS             440245..440589
FT                   /transl_table=11
FT                   /locus_tag="SpyM50408"
FT                   /product="putative lipoprotein"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD26"
FT                   /protein_id="CAM29751.1"
FT                   /translation="MTIKKFSLLAIASLSLLSLAACDMDDKDDHMDNQPKTSQTSKKVK
FT                   LSEDKAKSIALKDASVTEADAQMLSVTQDNEDGKAVYEIEFQNKDQEYSYTIDANSGDI
FT                   VEKSSEPIND"
FT   sig_peptide     440245..440304
FT                   /locus_tag="SpyM50408"
FT                   /note="Signal peptide predicted for SpyM50408 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.886) with cleavage
FT                   site probability 0.487 between residues 20 and 21"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    440278..440310
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    440377..440568
FT                   /locus_tag="SpyM50408"
FT                   /note="HMMPfam hit to PF03413, Peptidase propeptide and
FT                   YPEB domain, score 2.5e-05"
FT                   /inference="protein motif:HMMPfam:PF03413"
FT   CDS             440949..442475
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="SpyM50409"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="GOA:A2RD27"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /protein_id="CAM29752.1"
FT                   /translation="MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGW
FT                   VEHNANQIWNSVQSVIAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVW
FT                   QSRQTAPIAEQLKQDGHTKMIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLF
FT                   GTIDTWLVWKLTDGAVHVTDYSNAARTMLYNIKDLTWDDEILELLNIPKDMLPEVKSNS
FT                   EIYGKTAAFHFYGGEVPISGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGDEMQ
FT                   LSSNNLLTTIGYGINGKVHYALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSD
FT                   DEVYVVPAFTGLGAPYWDSNARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVD
FT                   SGIDIQQLRVDGGAAMNNMLMQFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDM
FT                   DALKELNATGQLFKASMNESRKEKLYKGWKRAVKATQVFTQEEDADDDAK"
FT   misc_feature    440964..441707
FT                   /gene="glpK"
FT                   /locus_tag="SpyM50409"
FT                   /note="HMMPfam hit to PF00370, FGGY family of carbohydrate
FT                   kinases, N-termi, score 1.2e-117"
FT                   /inference="protein motif:HMMPfam:PF00370"
FT   misc_feature    441354..441392
FT                   /note="PS00933 FGGY family of carbohydrate kinases
FT                   signature 1"
FT                   /inference="protein motif:Prosite:PS00933"
FT   misc_feature    441714..442391
FT                   /gene="glpK"
FT                   /locus_tag="SpyM50409"
FT                   /note="HMMPfam hit to PF02782, FGGY family of carbohydrate
FT                   kinases, C-termi, score 5.1e-71"
FT                   /inference="protein motif:HMMPfam:PF02782"
FT   misc_feature    442035..442097
FT                   /note="PS00445 FGGY family of carbohydrate kinases
FT                   signature 2"
FT                   /inference="protein motif:Prosite:PS00445"
FT   CDS             442491..444329
FT                   /transl_table=11
FT                   /gene="glpO"
FT                   /locus_tag="SpyM50410"
FT                   /product="alpha-glycerophosphate oxidase"
FT                   /EC_number="1.1.3.21"
FT                   /db_xref="GOA:A2RD28"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD28"
FT                   /protein_id="CAM29753.1"
FT                   /translation="MEFSRETRRLALQKMQERDLDLLIIGGGITGAGVALQAAASGLDT
FT                   GLIEMQDFAQGTSSRSTKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPML
FT                   LPVYDEPGSTFSMFRLKIAMDLYDLLAGVSNTPAANKVLTKEEVLKREPDLKQEGLLGG
FT                   GVYLDFRNNDARLVIENIKRANRDGALIASHVKSEDFLLDDNGKIIGVKARDLLSDQEI
FT                   IIKAKLVINTTGPWSDEIRQFSHKGQPIHQMRPTKGVHLVVDRQKLPVSQPVYVDTGLN
FT                   DGRMVFVLPREEKTYFGTTDTDYTGDLEHPQVTQEDVDYLLGVVNNRFPNANVTIDDIE
FT                   SSWAGLRPLLSGNSASDYNGGNSGKVSDDSFDHLVDTVKAYINHEDSREAVEKAIKQVE
FT                   TSTSEKELDPSAVSRGSSFDRDENGLFTLAGGKITDYRKMAEGALTGIIQTLKEEFGKS
FT                   FKLINSKTYPVSGGEINPANVDSEIEAYAQLGTLSGLSMDDARYLANLYGSNAPKVFAL
FT                   TRQLTAAEGLSLAETLSLHYAMDYEMALKPTDYFLRRTNHLLFMRDSLDALIDPVINEM
FT                   AKHFEWSDQERVAQEDDLRRVIADNDLSALKGQQEG"
FT   misc_feature    442551..443801
FT                   /gene="glpO"
FT                   /locus_tag="SpyM50410"
FT                   /note="HMMPfam hit to PF01266, FAD dependent
FT                   oxidoreductase, score 1.9e-61"
FT                   /inference="protein motif:HMMPfam:PF01266"
FT   misc_feature    442551..442619
FT                   /gene="glpO"
FT                   /locus_tag="SpyM50410"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50410 by TMHMM2.0 at aa 21-43"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             444331..445032
FT                   /transl_table=11
FT                   /gene="glpF1"
FT                   /locus_tag="SpyM50411"
FT                   /product="glycerol uptake facilitator protein 1"
FT                   /note="Similar to SpyM51434, 55.603% identity (55.603%
FT                   ungapped) in 232 aa overlap"
FT                   /db_xref="GOA:A2RD29"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD29"
FT                   /protein_id="CAM29754.1"
FT                   /translation="MDIFGEFLGAALLVLLGNGVVAGVVLPKTKTHASGWIVIASGWGI
FT                   AVAVAVFISGKVAPAHLNPAVSLAFAMSGTIAWSTAIAYSLAQLLGAMLGSTLVFLQFR
FT                   PHYLAAESQADILGTFATGPAIRDTSSNLLSEIFGTFVLMLGILAFGLYDMPAGLGTLC
FT                   VGTLVIGIGLSLGGTTGYAINPARDLGPRLVHAILPLNNKGDSDWSYAWIPVVGPIIGA
FT                   ALAVLLFQVMS"
FT   misc_feature    444331..445017
FT                   /gene="glpF1"
FT                   /locus_tag="SpyM50411"
FT                   /note="HMMPfam hit to PF00230, Major intrinsic
FT                   protein,score 1.4e-47"
FT                   /inference="protein motif:HMMPfam:PF00230"
FT   misc_feature    order(444349..444408,444436..444504,444523..444591,
FT                   444727..444786,444805..444873,444958..445026)
FT                   /gene="glpF1"
FT                   /locus_tag="SpyM50411"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50411 by TMHMM2.0 at aa 7-26,
FT                   36-58,65-87,133-152,159-181 and 210-232"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    444511..444537
FT                   /note="PS00221 MIP family signature"
FT                   /inference="protein motif:Prosite:PS00221"
FT   CDS             445141..446487
FT                   /transl_table=11
FT                   /locus_tag="SpyM50412"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="GOA:A2RD30"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD30"
FT                   /protein_id="CAM29755.1"
FT                   /translation="MTLTTKTIHVIGASFAGLAFVDKYKDLNPDSQIILIDKESCPNYI
FT                   PNGINQLFRGDIQDLSDAMWGRACLAAQIESNHRFIQAEVLAIEAPSNTLLLKDSQGRV
FT                   FEEGYETLVCAMGASPQSHYIETSQTNKVLVTKYYEESQASLKLIEASQEVLVIGAGLI
FT                   GLDLAYSLSLQGKRVKLIEAAERPDFYQTDAELIAPVMAEMSTHHVTFINNKRVTAIHE
FT                   IEGKVVAHTEQGDTFQGDLAILAINFRPNTHLLQGQVACALDKTILVNENLQTSQANIY
FT                   AIGDMVSLHFGILGMDYYTPLINQAMKTGQALALHLAGYPIPPLQTVKVLGSSHFGYYR
FT                   ASVGVTEEEAELYMDTCSYLYQNGDSKNLFWLKLIARKTDGILIGAQLLSKTNALVIAN
FT                   QLGQALALKVTDADLAFQDFLFLQGHSDLAYHLHEACLKLFEKRLRHED"
FT   misc_feature    445159..446022
FT                   /locus_tag="SpyM50412"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreducta, score 1.4e-26"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   CDS             446477..447976
FT                   /transl_table=11
FT                   /locus_tag="SpyM50413"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="GOA:A2RD31"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD31"
FT                   /protein_id="CAM29756.1"
FT                   /translation="MKIEDLMDKERRAQYRLLVTLYHAKETLRLKDLMRLSNLSKVTLL
FT                   KYIDNLNHLCREQGLACQLLLEKDSLSLKENGQFHWEDLVALLLKESVAYQILTYMYCH
FT                   EHFNITNLSVELMVSEATLNRQLAHLNQLLSEFDLALSQGRQLGSELQWRYFYFELFRH
FT                   TLTRQGIDALVNQLDASHLATLIERLIGQSLSAEALEQLLIWLAISQARMSFQKGYNDH
FT                   FLRDSDFMTSNIFFKRLESMLLHYLRRYALEFDAFEAKSLFVFLHAYPLLPIASMKYSL
FT                   GFGGPIADHISEALWLLKKAHVIIHQTKEEIIYGLGIFFSKAYFFKGAILSQPTNSQYL
FT                   YQLVGEDKRALLRVIINHLVLQMGQETDFSQQLSDDILALLIFSIERHHEPLLVGLALG
FT                   QNKVEAAIAELAIRRHLGHRRDFQLMPYDHQKVYDCLITYQTVCLPRQDLPYYRLKQYS
FT                   SPYELTALEAFLKDLFQQKNTREEELSLSPAAKSSFAHKTV"
FT   misc_feature    446558..446623
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1121.000, SD 3.00 at aa 28-49, sequence
FT                   LRLKDLMRLSNLSKVTLLKYID"
FT   misc_feature    446795..446860
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1197.000, SD 3.26 at aa 107-128, sequence
FT                   FNITNLSVELMVSEATLNRQLA"
FT   CDS             448102..448746
FT                   /transl_table=11
FT                   /locus_tag="SpyM50414"
FT                   /product="probable transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="GOA:A2RD32"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /protein_id="CAM29757.1"
FT                   /translation="MKFFLDTANVAAIKAINELGVVDGVTTNPTIISREGRDFETVIKE
FT                   ICDIVDGPISAEVTGLTADAMVEEARSIAKWHDNVVVKIPMTTEGLKATNILSKEGIKT
FT                   NVTLIFTVSQGLMAMKAGATYISPFIGRLEDIGTDAYQLISDLREIIDLYDFQAEIIAA
FT                   SIRTTAHVEAVAKLGAHIATIPDPLFAKMTQHPLTTNGLKTFMEDWASFKK"
FT   misc_feature    448105..448737
FT                   /locus_tag="SpyM50414"
FT                   /note="HMMPfam hit to PF00923, Transaldolase, score
FT                   1.1e-56"
FT                   /inference="protein motif:HMMPfam:PF00923"
FT   misc_feature    448171..448197
FT                   /note="PS01054 Transaldolase signature 1"
FT                   /inference="protein motif:Prosite:PS01054"
FT   CDS             448964..450949
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="SpyM50415"
FT                   /product="putative transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="GOA:A2RD33"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD33"
FT                   /protein_id="CAM29758.1"
FT                   /translation="MTFDAIDQLAVNTVRTLSMDAIQAANSGHPGLPMGAAPMAYVLWN
FT                   HFMNINPKTSRNWSNRDRFILSAGHGSAMLYSLLHLAGYDLSVEDLKNFRQWGSKTPGH
FT                   PEVNHTDGVEATTGPLGQGIANAVGMAMAEAHLAAKFNKPGFDIVDHYTFALNGDGDLM
FT                   EGVSQEAASMAGHLKLGKLVLLYDSNDISLDGPTSMAFTEDVKGRFEAYGWQHILVKDG
FT                   NDLEEIAAAIEAAKAETEKPTIIEVKTIIGFGAEKQGTSAVHGAPLGAEGIAFAKKAYQ
FT                   WTHQDFEVPAEVTERFAQGLQARGEKAEQAWNDLFAAYEAEYPELAAEYQQAFANEAAQ
FT                   VELEAHELGSSMASRVSSQQAIQQISEQVASFWGGSADLSASNNTMVKAETDFQPGHYE
FT                   GRNIWFGVREFAMAAAMNGIALHGGTRVYGGTFFVFSNYLLPAVRMAALQNLPTVYVMT
FT                   HDSIAVGEDGPTHEPIEQLASVRSMPNLNVIRPADGNETNAAWKRAIAETDRPTMLVLT
FT                   RQNLPVLEGTKELAEDGLNKGAYILSEAKGDLDGILIATGSEVKLAMDTQEALEAEGIH
FT                   VRVVSMPSQNIFDEQSAEYKESILPAAVTKRLAIEAGSSFGWAKYVGLAGKTLTIDTWG
FT                   ASAPGNRIFEEYGFTVANATELYKSL"
FT   misc_feature    448979..449980
FT                   /gene="tkt"
FT                   /locus_tag="SpyM50415"
FT                   /note="HMMPfam hit to PF00456, Transketolase, thiamine
FT                   diphosphate b, score 1.2e-201"
FT                   /inference="protein motif:HMMPfam:PF00456"
FT   misc_feature    449006..449068
FT                   /note="PS00801 Transketolase signature 1"
FT                   /inference="protein motif:Prosite:PS00801"
FT   misc_feature    450017..450532
FT                   /gene="tkt"
FT                   /locus_tag="SpyM50415"
FT                   /note="HMMPfam hit to PF02779, Transketolase, pyridine
FT                   binding domai, score 8.4e-63"
FT                   /inference="protein motif:HMMPfam:PF02779"
FT   misc_feature    450356..450406
FT                   /note="PS00802 Transketolase signature 2"
FT                   /inference="protein motif:Prosite:PS00802"
FT   misc_feature    450596..450925
FT                   /gene="tkt"
FT                   /locus_tag="SpyM50415"
FT                   /note="HMMPfam hit to PF02780, Transketolase, C-terminal
FT                   domain, score 7.1e-06"
FT                   /inference="protein motif:HMMPfam:PF02780"
FT   CDS             451141..451407
FT                   /transl_table=11
FT                   /locus_tag="SpyM50416"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD34"
FT                   /protein_id="CAM29759.1"
FT                   /translation="MEKKRQRLYDVIRHAYDYPENRENVALSQLLLAASNRLIKHSNPL
FT                   LVAYQLNQDVDNYLLDNDILLPKSLCRFKQSLEKYILEEASSV"
FT   CDS             451441..452175
FT                   /transl_table=11
FT                   /locus_tag="SpyM50417"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RD35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD35"
FT                   /protein_id="CAM29760.1"
FT                   /translation="MIEFKHVSKLYGDKEALSDLNVTINDGEIFGLIGHNGAGKTTTIS
FT                   ILTSIIEASYGEVFVDGQLLTENREAIKKQIAYVPDSPDIFLNLTPNEYWQFLAKIYGV
FT                   SDEDREERLAQLTTLFELKEEGNQTIDSFSHGMRQKVIVIGALVSNPNIWILDEPLTGL
FT                   DPQASFDLKEMMKAHAASGHTVLFSTHVLSVAEQLCDRIGILKKGKLIFVGTIDELKEH
FT                   HPDKDLESIYLELAGRKAQEEG"
FT   misc_feature    451519..452064
FT                   /locus_tag="SpyM50417"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   6.4e-41"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    451540..451563
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    451837..451881
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             452180..453808
FT                   /transl_table=11
FT                   /locus_tag="SpyM50418"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD36"
FT                   /protein_id="CAM29761.1"
FT                   /translation="MNWSTIWELIKINILYSNPQSLANLKKRQENHPKENFKAYKSMMR
FT                   QQALMIAMFLVIYLFMFIGVDFSHYPGLFSFDVAMFFIMSTLTAFSSLYTIFYESNDLK
FT                   LYIHLPVTSEELYIAKIVSSLGMGAVFLMPLISLLLIAYWQLLGNPLSILVAIVLFLVL
FT                   LVSSMVLAIYINAWVGKIIVRSRKRKLISTIMMFVSTFGAFVLIFAINISNNKRTMTDG
FT                   VFTDYPTIPYFKGFYDVIQAPFSTAALLNFWLPLLLILAMVYGIVTKVMPTYYREAFYI
FT                   SNENKAKQTKKPVNRPHQNQSLTQLLRKHHLLTLQNATLLTQTYLMPLMYVMLFIGPSL
FT                   SRGTGFFKHISPDYFGVALLFGVSLGVMCATPTSFIGVGISLEKDNFTFIKSLPITLKK
FT                   FLLDKFCLLVGLQLIVPMVIYLVFGLFVLHLHPLLTIAFCLGYALSLIVQGELMYRRDY
FT                   RLLDLKWQDMTQLFTRGNGQWLTMGLIFGNLIVTGVVGFGAVIIANTIQQPLLISILLS
FT                   CLTLMVLGIAHLWIQKTFWKSLEKL"
FT   misc_feature    order(452321..452374,452411..452479,452540..452608,
FT                   452636..452710,452747..452815,452909..452977,
FT                   453131..453199,453257..453325,453392..453460,
FT                   453473..453541,453629..453697,453707..453775)
FT                   /locus_tag="SpyM50418"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SpyM50418 by TMHMM2.0 at aa 48-65,
FT                   78-100,121-143,153-177,190-212, 244-266, 318-340,
FT                   360-382,405-427,432-454,484-506 and 510-532"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             join(453872..454099,454103..454693)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="SpyM50419"
FT                   /EC_number="2.7.2.11"
FT                   /note="CDS similar to Streptococcus thermophilus glutamate
FT                   5-kinase proB SWALL:PROB_STRTR (SWALL:P96488) (267 aa)
FT                   fasta scores: E(): 3.8e-73, 80% id in 265 aa. CDS contains
FT                   a nonsense mutation (ochre) after codon 75"
FT                   /db_xref="PSEUDO:CAM29762.1"
FT   misc_feature    453899..454600
FT                   /gene="proB"
FT                   /locus_tag="SpyM50419"
FT                   /note="HMMPfam hit to PF00696, Amino acid kinase
FT                   family,score 1.4e-56"
FT                   /inference="protein motif:HMMPfam:PF00696"
FT   CDS             454686..455936
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="SpyM50421"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="GOA:A2RD38"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /protein_id="CAM29763.1"
FT                   /translation="MTDMRRLGQRAKQASLLIAPLSTQIKNRFLSTLAKALVDDTQTLL
FT                   AANQKDLANAKEHGISDIMMDRLRLTSERIKAIAQGVQQVADLADPIGQVIKGYTNLDG
FT                   LKILQKRVPLGVIAMIFESRPNVSVDAFSLAFKTNNAIILRGGKDALHSNKALVKLIRQ
FT                   SLEKSGITPDAVQLVEDPSHAVAEELMQATDYVDVLIPRGGAKLIQTVKEKAKVPVIET
FT                   GVGNVHIYVDAQADLDMATNIVINAKTKRPSVCNAAEGLVIHEAVAARFIPMLEKAINQ
FT                   VQPVEWRADDKALPLFEQAVPAKAEDFETEFLDYIMSVKVVSSLEEAISWINQHTSHHS
FT                   EAIITRDIKAAETFQDLVDAAAVYVNASTRFTDGFVFGLGAEIGISTQKMHARGPMGLE
FT                   ALTSTKFYINGDGHIRE"
FT   CDS             455956..456177
FT                   /transl_table=11
FT                   /locus_tag="SpyM50422"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD39"
FT                   /protein_id="CAM29764.1"
FT                   /translation="MTNEREKEEAKVALEELLHQIQVIHLELKIVRNWGYFDLFGDGML
FT                   VSWIKRRKMSKVNQLLIDLQVTLQNCRR"
FT   CDS             456470..457420
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SpyM50423"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="GOA:A2RD40"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /protein_id="CAM29765.1"
FT                   /translation="MTKEFHHVTVLLHETVDMLDIKPDGIYVDATLGGSGHSAYLLSKL
FT                   GEEGHLYCFDQDQKAIDNAQVTLKSYIDKGQVTFIKDNFRHLKARLTALGVDEIDGILY
FT                   DLGVSSPQLDERERGFSYKQDAPLDMRMDRQSLLTAYEVVNTYPFNDLVKIFFKYGEDK
FT                   FSKQIARKIEQARAIKPIETTTELAELIKAAKPAKELKKKGHPAKQIFQAIRIEVNDEL
FT                   GAADESIQDAMELLALDGRISVITFHSLEDRLTKQLFKEASTVDVPKGLPLIPEDMKPK
FT                   FELVSRKPILPSHSELTANKRAHSAKLRVAKKIRK"
FT   misc_feature    456479..457411
FT                   /gene="mraW"
FT                   /locus_tag="SpyM50423"
FT                   /note="HMMPfam hit to PF01795, MraW methylase family,score
FT                   7.1e-191"
FT                   /inference="protein motif:HMMPfam:PF01795"
FT   CDS             457425..457748
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="SpyM50424"
FT                   /product="putative cell division protein"
FT                   /db_xref="GOA:A2RD41"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD41"
FT                   /protein_id="CAM29766.1"
FT                   /translation="MTNEKRTQAVTNALQKRIKTFSRIEKAFYTAIIVTAITMAVSIIY
FT                   LQSRKLQLQQEITSLNSHISDQKLELNNAKQEVNELSRRDRIIDIAGKAGLSNRNNNIK
FT                   KVE"
FT   misc_feature    457503..457562
FT                   /gene="ftsL"
FT                   /locus_tag="SpyM50424"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50424 by TMHMM2.0 at aa 27-46"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             457752..460007
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /product="putative penicillin binding protein 2x"
FT                   /db_xref="GOA:A2RD42"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD42"
FT                   /protein_id="CAM29767.1"
FT                   /translation="MKKWQKYVLDYVVRDRRTPVENRVRVGQNMMLLTIFIFFIFIINF
FT                   MIIIGTDQKFGVSLSEGAKKVYQETVTIQAKRGTIYDRNGTAIAVDSTTYSIYAILDKS
FT                   FVSASDEKLYVQPSQYETVADILKKHLGMKKTDVIKQLKRKGLFQVSFGPSGSGISYST
FT                   MSTIQKAMEDAKIKGIAFTTSPGRMYPNGTFASEFIGLASLTEDKKTGVKSLVGKTGLE
FT                   ASFDKILSGQDGVITYQKDRNGTTLLGTGKTVKKAIDGKDIYTTLSEPIQTFLETQMDV
FT                   FQAKSNGQLASATLVNAKTGEILATTQRPTYNADTLKGLENTNYKWYSALHQGNFEPGS
FT                   TMKVMTLAAAIDDKVFNPNETFSNANGLTIADATIQDWSINEGISTGQYMNYAQGFAFS
FT                   SNVGMTKLEQKMGNAKWMNYLTKFRFGFPTRFGLKDEDAGIFPSDNIVTQAMSAFGQGI
FT                   SVTQIQMLRAFTAISNNGEMLEPQFISQIYDPNTASFRTANKEIVGKPVSKKAASETRQ
FT                   YMIGVGTDPEFGTLYSKTFGPIIKVGDLPVAVKSGTAQIGSEDGSGYQDGGLTNYVYSV
FT                   VAMVPADKPDFLMYVTMTKPQHFGPLFWQDVVNPVLEEAYLMQDTLTKPVVSDANRQTT
FT                   YKLPNFVGKNPGETSSELRRNLVQPVVLGTGSKIKKVSHQPGQTLTENQQVLILSDRFV
FT                   EVPDMYGWTKSNVKTFAKWTGIDISFKGTDSGRVMKQSVDVGKSLKKIKKMTITLGD"
FT   misc_feature    457845..457904
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50425 by TMHMM2.0 at aa 32-51"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    457965..458504
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /note="HMMPfam hit to PF03717, Penicillin-binding Protein
FT                   dimerisatio, score 5.7e-48"
FT                   /inference="protein motif:HMMPfam:PF03717"
FT   misc_feature    458622..459590
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 1.1e-86"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    459651..459824
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /note="HMMPfam hit to PF03793, PASTA domain, score 1.7e-09"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    459825..460004
FT                   /gene="pbpX"
FT                   /locus_tag="SpyM50425"
FT                   /note="HMMPfam hit to PF03793, PASTA domain, score 2.6e-13"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   CDS             460009..461019
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SpyM50426"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transfera
FT                   se"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="GOA:A2RD43"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /protein_id="CAM29768.1"
FT                   /translation="MFLTLIAAIISFMVSAFTMPYFIKFYQLKKIGGQQMHEDVKQHLA
FT                   KAGTPTMGGTVFLLVATAVSLLVNLFSIKNTQSLALISGILSIVVIYGIIGFLDDFLKI
FT                   FKQINEGLTAKQKLALQLAGGLMFYFLHVSPSGISSINVFGYQLSLGIFYLFFVLFWVV
FT                   GFSNAVNLTDGIDGLASISVVISLVTYGVIAYVQGQFDVLLLIGTMIGALLGFFCFNHK
FT                   PAKVFMGDVGSLALGAMLAAISIALRQEWTLLIIGIVYVLETSSVMLQVSYFKYTKKKY
FT                   GEGRRIFRMTPFHHHLELGGLSGKGKKWSEWQVDAFLWGVGSLASLLVLAILYVF"
FT   misc_feature    order(460018..460086,460147..460215,460243..460302,
FT                   460363..460422,460435..460503,460540..460599,
FT                   460612..460665,460684..460752,460762..460830,
FT                   460954..461013)
FT                   /gene="mraY"
FT                   /locus_tag="SpyM50426"
FT                   /note="10 probable transmembrane helices predicted for
FT                   SpyM50426 by TMHMM2.0 at aa 4-26,
FT                   47-69,79-98,119-138,143-165, 178-197, 202-219, 226-248,
FT                   252-274 and 316-335"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    460249..460767
FT                   /gene="mraY"
FT                   /locus_tag="SpyM50426"
FT                   /note="HMMPfam hit to PF00953, Glycosyl transferase, score
FT                   2.7e-59"
FT                   /inference="protein motif:HMMPfam:PF00953"
FT   CDS             461177..462520
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SpyM50427"
FT                   /product="putative helicase"
FT                   /db_xref="GOA:A2RD44"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD44"
FT                   /protein_id="CAM29769.1"
FT                   /translation="MSFKDYHFKQYVQQALEEIGFVNPTEVQKRLIPIVNSGRDLVGES
FT                   KTGSGKTHTFLLPIFEKLDEAKAEVQVVITAPSRELATQIFDACKQIAKHSQEEIRLAN
FT                   YVGGTDKLRQIEKLKGSQPHIVIGTPGRIYDLVKSGDLAIHKATTFVVDEADMTMDMGF
FT                   LDTVDKIAASLPKSVQILVFSATIPQKLQPFLKKYLTNPVIEQIKTKTVIADTIDNWLV
FT                   STKGRDKNGQLLEILKTMQPYMAMLFVNTKERADDLHAFLTANGLKVAKIHGGIPPRER
FT                   KRIMNQVKKLDFEYIVATDLAARGIDIEGVSHVINDAIPQDLSFFVHRVGRTGRNGMAG
FT                   TAITLYQPSDDSDIKELEKMGIAFTPKVLKNGEFQDTYDRDRRQNREKAYQKLDTEMIG
FT                   LVKKKKKKVKPGYKKKIQWAVDEKRRKERRAENRAKGRAERKAKKQHF"
FT   misc_feature    461246..461758
FT                   /gene="mraW"
FT                   /locus_tag="SpyM50427"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   7.2e-53"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    461957..462187
FT                   /gene="mraW"
FT                   /locus_tag="SpyM50427"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 2e-27"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS             462714..463517
FT                   /transl_table=11
FT                   /locus_tag="SpyM50428"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="GOA:A2RD45"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD45"
FT                   /protein_id="CAM29770.1"
FT                   /translation="MTSVFLTSGWAFYDHLISPIPHGKLFSWHAVFDAIPNIIQRLPIT
FT                   LGLTLSGATFGLVLALIFALVKINKVKLLYPIQAIFVSFLRGTPILVQLMLTYYGIPLF
FT                   LKFLNQKYGFDWNVNAIPASIFAITAFAFNEAAYASETIRAAILSVDTGEIEAAKSLGM
FT                   TSVQVYRRVIIPNATVVAIPTLINGLIGLTKGTSLAFNAGIVEMFAQAQILGGSDYRYF
FT                   ERYISVALVYWSISILMEQVGRLIENKMAIKAPEQARNEKLGELR"
FT   misc_feature    462825..463469
FT                   /locus_tag="SpyM50428"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 4.1e-20"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    order(462843..462911,462948..463016,463059..463127,
FT                   463227..463286)
FT                   /locus_tag="SpyM50428"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50428 by TMHMM2.0 at aa 44-66, 79-101, 116-138 and
FT                   172-191"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    463152..463238
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             463517..464260
FT                   /transl_table=11
FT                   /locus_tag="SpyM50429"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:A2RD46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD46"
FT                   /protein_id="CAM29771.1"
FT                   /translation="MITIRNLSKTFSGQKVLDSLALDIEKGQVIALVGASGAGKSTFLR
FT                   SLNYLEKPDSGSISIGDFTVDFETITTEQVLILRRKLAMVFQQFNLFERRTALENVKEG
FT                   LKVVKKLSDQEATKLAQAELAKVGLADRKHHYPRHLSGGQKQRVALARALAMKPDVLLL
FT                   DEPTSALDPELVGEVEKSITDAAKSGQTMVLVSHDMNFVYQVADRVLFLDQGKILEQGT
FT                   PEEVFRHPQKERTKEFFASYSKTYI"
FT   misc_feature    463595..464161
FT                   /locus_tag="SpyM50429"
FT                   /note="HMMPfam hit to PF00005, ABC transporter, score
FT                   2.5e-66"
FT                   /inference="protein motif:HMMPfam:PF00005"
FT   misc_feature    463616..463639
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    463934..463978
FT                   /note="PS00211 ABC transporters family signature"
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             464364..464588
FT                   /transl_table=11
FT                   /locus_tag="SpyM50430"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR025134"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD47"
FT                   /protein_id="CAM29772.1"
FT                   /translation="MLVEIFSLYVKGLILSSLTMILICLIWTLWRAKTKRDKTLIERQA
FT                   FLYEMLMVAILTIPILSFAFMSILVVIKS"
FT   misc_feature    order(464400..464453,464511..464579)
FT                   /locus_tag="SpyM50430"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50430 by TMHMM2.0 at aa 13-30 and 50-72"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             464652..465569
FT                   /transl_table=11
FT                   /locus_tag="SpyM50431"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="GOA:A2RD48"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD48"
FT                   /protein_id="CAM29773.1"
FT                   /translation="MYDTLIIGSGPAGMTAALYAARSNLSVAIIEQGAPGGQMNNTFDI
FT                   ENYPGYDHISGPELAMKMYEPLEKFNVENIYGTVQKIENFGDYKCVLTEDASYEAKTVI
FT                   IATGAKYRVLGVPGEEYYTSRGVSYCAVCDGAFFRDQDLLVVGGGDSAVEEAIYLTQFA
FT                   KKVTVVHRRDQLRAQKILQDRAFANDKVDFIWDSVVKEIQGNDIKVSNVLIENVKTGQV
FT                   TDHAFGGVFIYVGMNPVTGMVKDLEITDSEGWIITDDHMRTSIPGIFAIGDVRQKDLRQ
FT                   ITTAVGDGAIAGQGVYHYLESFPS"
FT   misc_feature    464658..465503
FT                   /locus_tag="SpyM50431"
FT                   /note="HMMPfam hit to PF00070, Pyridine
FT                   nucleotide-disulphide oxidoreducta, score 4.5e-75"
FT                   /inference="protein motif:HMMPfam:PF00070"
FT   misc_feature    465039..465101
FT                   /note="PS00573 Pyridine nucleotide-disulphide
FT                   oxidoreductases class-II active site"
FT                   /inference="protein motif:Prosite:PS00573"
FT   CDS             465738..467117
FT                   /transl_table=11
FT                   /locus_tag="SpyM50432"
FT                   /product="amino acid permease"
FT                   /db_xref="GOA:A2RD49"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD49"
FT                   /protein_id="CAM29774.1"
FT                   /translation="MSIKEQTDNNELENGMVRGLENRHVQLIAIAGTIGTGLFLGAGRS
FT                   IALTGPSIIFVYMITGAFMFMMMRAIGEMLYYDPDQHTFINFISKYIGPGWGYFSGLSY
FT                   WISLIFIGMAEITAVGAYVQFWFPSWPAWLIQLVFLVLLSSINLIAVRVFGETEFWFAM
FT                   IKILAILALIATAIFMVLTGFETHTGHASLSNIFDHFSMFPNGKLKFFMAFQMVFFAYQ
FT                   AIEFVGITTSETANPRKVLPKAIQEIPTRIVIFYVGALVSIMAIVPWHQLPVDESPFVM
FT                   VFKLIGIKWAAALINFVVLTSAASALNSTLYSTGRHLYQIANETPNALTNRLKINTLSR
FT                   QGVPSRAIIASAVVVGISALINILPGVADAFSLITASSSGVYIAIYALTMIAHWKYRQS
FT                   KDFMADGYLMPKYKVTTPLTLAFFAFVFISLFLQESTYIGAIGATIWIIVFGIYSNVKF
FT                   K"
FT   misc_feature    465807..467114
FT                   /locus_tag="SpyM50432"
FT                   /note="HMMPfam hit to PF00324, Amino acid permease, score
FT                   4.5e-83"
FT                   /inference="protein motif:HMMPfam:PF00324"
FT   misc_feature    order(465813..465881,465894..465962,466020..466088,
FT                   466131..466199,466212..466280,466365..466433,
FT                   466491..466547,466605..466673,466761..466820,
FT                   466848..466916,466977..467036,467046..467105)
FT                   /locus_tag="SpyM50432"
FT                   /note="12 probable transmembrane helices predicted for
FT                   SpyM50432 by TMHMM2.0 at aa 30-52,
FT                   57-79,99-121,136-158,163-185, 214-236, 256-274,
FT                   294-316,346-365,375-397,418-437 and 441-460"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    465882..465974
FT                   /note="PS00218 Amino acid permeases signature"
FT                   /inference="protein motif:Prosite:PS00218"
FT   CDS             467288..468742
FT                   /transl_table=11
FT                   /locus_tag="SpyM50433"
FT                   /product="nicotinate phosphoribosyltransferase (NAPRTase)
FT                   family protein"
FT                   /db_xref="GOA:A2RD50"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD50"
FT                   /protein_id="CAM29775.1"
FT                   /translation="MYKDDSLTLHTDLYQINMMQVYFEQGIHNRHAVFEVYFRKEPFNN
FT                   GYAVFAGLQRMVEYLEQFQFSETDLAYLEELGYPDNFLTYLKELRLELTIRSAKEGDLV
FT                   FANEPIVQVEGPLGQCQLVETALLNIVNFQTLIATKAARIRSVIEDEPLLEFGTRRAQE
FT                   LDAAIWGTRAAIIGGADATSNVRAGKRFGIPVSGTHAHALVQAYGNDYDAFMAYAKTHK
FT                   DCVFLVDTYDTLKVGVPTAIRVAKEMGDKINFLGVRLDSGDLAYLSKTVRQQLDDAGFT
FT                   EAKIYASNDLDENTILNLKMQKAKIDVWGVGTKLITAYDQPALGAVYKIVSIEQEDGSM
FT                   RDTIKLSNNAEKVSTPGKKQVWRITSREKGKSEGDYITFTDINVNELTEIEMFHPTYTY
FT                   IKKTVRNFDAIPLLVDIFVKGELVYQLPTLSEIKAYAKKEFDKLWDEYKRVLNPQDYPV
FT                   DLARDVWQNKMALIDNIRKDAYGKSE"
FT   misc_feature    467303..468385
FT                   /locus_tag="SpyM50433"
FT                   /note="HMMPfam hit to PF04095, Nicotinate
FT                   phosphoribosyltransferase (NAPRTa, score 6.6e-12"
FT                   /inference="protein motif:HMMPfam:PF04095"
FT   CDS             468744..469568
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SpyM50434"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="GOA:A2RD51"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /protein_id="CAM29776.1"
FT                   /translation="MTLQEEIIRQLGVKASIDPKEEIRKTVDFLKAYLRKHSFLKTYVL
FT                   GISGGQDSTLAGKLAQMAIAELREETGDQAYQFIAVRLPYGVQADEADAQKALAFIAPD
FT                   QTLTINIKAAVDGQVEALQAAGVEISDFNKGNIKARQRMISQYAIAGQMAGAVIGTDHA
FT                   AENITGFFTKFGDGGADILPLFRLNKRQGKALLKVLGADAALYEKVPTADLEDQKPGLA
FT                   DEVALGVTYQDIDDYLEGKLISKVAQATIEKWWHKGQHKRHLPITIFDDFWK"
FT   misc_feature    468990..469550
FT                   /gene="nadE"
FT                   /locus_tag="SpyM50434"
FT                   /note="HMMPfam hit to PF02540, NAD synthase, score 3.8e-51"
FT                   /inference="protein motif:HMMPfam:PF02540"
FT   CDS             469753..471090
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="SpyM50435"
FT                   /product="aminopeptidase C"
FT                   /EC_number="3.4.22.40"
FT                   /db_xref="GOA:A2RD52"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD52"
FT                   /protein_id="CAM29777.1"
FT                   /translation="MSALTETFTEQLFAHYEANAKFSAIENAVTHNGLLKSLETRQSEV
FT                   DNDFVFSIDLTKDKVSNQKASGRCWMFAALNTFRHKLITEFKLENFELSQAHTFFWDKY
FT                   EKANWFMEQVIATADQELTSRKVKFLLDVPQQDGGQWDMVVSLFEKYGVVPKSVYPESI
FT                   SSSNSRELNQYLNKLLRQDAQILRDLIASGAKADQVVDRKAELLQEIFNFLAMTLGLPP
FT                   RHFDFAYRDKDDHYHVEKGLTPQAFYDKFVGLKLSNYVSVINAPTADKPYGKSYTVEML
FT                   GNVVGSREVRYLNLDMKRFKELAIKQMQAGESVWFGSDVGQVSDRQKGILATNTYDFEA
FT                   SMDINLSQDKAGRLDYSESLMTHAMVLTGVDLDETGKPLKWKVENSWGEKVGDKGYFVA
FT                   SDAWMDEYTYQIVVRKEFLTADELAAYEKEPQVLAPWDPMGALAQY"
FT   misc_feature    469759..471072
FT                   /gene="pepC"
FT                   /locus_tag="SpyM50435"
FT                   /note="HMMPfam hit to PF03051, Peptidase C1-like
FT                   family,score 3.1e-297"
FT                   /inference="protein motif:HMMPfam:PF03051"
FT   misc_feature    469939..469974
FT                   /note="PS00139 Eukaryotic thiol (cysteine) proteases
FT                   cysteine active site"
FT                   /inference="protein motif:Prosite:PS00139"
FT   misc_feature    470554..470577
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    470833..470865
FT                   /note="PS00639 Eukaryotic thiol (cysteine) proteases
FT                   histidine active site"
FT                   /inference="protein motif:Prosite:PS00639"
FT   CDS             complement(471557..473722)
FT                   /transl_table=11
FT                   /gene="pbp1A"
FT                   /locus_tag="SpyM50436"
FT                   /product="putative penicillin-binding protein 1A"
FT                   /db_xref="GOA:A2RD53"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011816"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD53"
FT                   /protein_id="CAM29778.1"
FT                   /translation="MITIKNPKILKWLKYVLSAILSLIILVIIIGGLLFTFYISSAPKL
FT                   SEAQLKSTNSSLVYDGNNNLIADLGSEKRENVTADSIPINLVNAITSIEDKRFFNHRGV
FT                   DLYRIFGAAFHNLTSQTTQGGSTLDQQLIKLAYFSTNESDQTLKRKAQEVWLALQMERK
FT                   YTKQEILTFYINKVYMGNGNYGMLTAAKSYYGKDLKDLSYAQLALLAGIPQAPSQYDPY
FT                   LHPEAAKNRRNVVLQQMYMEKHLTKAEYETAIATPVAEGLQSLQQRSTYPKYMDNYLKQ
FT                   VIEEVKKETNKDIFTAGLKVYTNIIPDAQQTLYNIYHSGDYVYYPDQDFQVASTIVDVT
FT                   NGHVIAQLGGRNQDENVSFGTNQAVLTDRDWGSTMKPITAYAPAIESGVYTSTAQSTND
FT                   SVYYWPGTTTQLFNWDLRYNGWMTIQAAIMLSRNVPAVRALEAAGLDYARSFLSSLGIN
FT                   YPEMHYSNAISSNNSSSDKKYGASSEKMAAAYAAFANGGIYHKPRYVNKVEFSDGTSKT
FT                   FNEKGKRAMKETTAYMMTDMLKTVLTYGTGTAAAIPGVAQAGKTGTSNYTDEELAKIGE
FT                   KYGLYPDYVGTLAPDENFVGFTKRYAMAVWTGYKNRLTPVYGSSLEIASDVYRSMMTYL
FT                   TNGYSEDWTVPNGLYRSGGFLYLSGTYASNTDYTNSVYNNLYSNNTTTASSQTTSDDTS
FT                   SSNDTSNSTNTDNNGSHPSTDDKKTTH"
FT   misc_feature    complement(471824..472729)
FT                   /gene="pbp1A"
FT                   /locus_tag="SpyM50436"
FT                   /note="HMMPfam hit to PF00905, Penicillin binding protein
FT                   transpeptid, score 1.7e-22"
FT                   /inference="protein motif:HMMPfam:PF00905"
FT   misc_feature    complement(472040..472063)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(473048..473557)
FT                   /gene="pbp1A"
FT                   /locus_tag="SpyM50436"
FT                   /note="HMMPfam hit to PF00912, Transglycosylase, score
FT                   8.5e-84"
FT                   /inference="protein motif:HMMPfam:PF00912"
FT   sig_peptide     complement(473582..473695)
FT                   /gene="pbp1A"
FT                   /locus_tag="SpyM50436"
FT                   /note="Signal peptide predicted for SpyM50436 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.994) with cleavage
FT                   site probability 0.341 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(473609..473677)
FT                   /gene="pbp1A"
FT                   /locus_tag="SpyM50436"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50436 by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(473709..474317)
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="SpyM50437"
FT                   /product="putative recombination protein U"
FT                   /db_xref="GOA:A2RD54"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /protein_id="CAM29779.1"
FT                   /translation="MVNYPHNLIRQKVSSVQKQTKQNKVDFANRGMSFEAAINATNDYY
FT                   LSRQIAVIHKKPTPVQIVKVDYPKRSRAKIVEAYFRQASTTDYCGVYKGHYVDFEAKET
FT                   RQKTAMPMKNFHLHQIEHMTCVLHQKGICFVLLHFSTLKETYYLPAQALISFYQIDNGS
FT                   KSMPIDYIRKNGFKVAFGAFPQVPYLNIIEQNFLGGDYN"
FT   misc_feature    complement(473733..474233)
FT                   /gene="recU"
FT                   /locus_tag="SpyM50437"
FT                   /note="HMMPfam hit to PF03838, Recombination protein
FT                   U,score 3.3e-122"
FT                   /inference="protein motif:HMMPfam:PF03838"
FT   misc_feature    complement(473907..473930)
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00030"
FT   CDS             474398..474913
FT                   /transl_table=11
FT                   /locus_tag="SpyM50438"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010697"
FT                   /protein_id="CAM29780.1"
FT                   /translation="MTAILITGYRSFEIGIFDHKDPRVSIIKQAIRKDLIGYLENGVDW
FT                   FIFTGNLGFEQWALEVANELKEEYPLQIATIFLFETHGDKWNEKNQEVLSQFKAVDFVK
FT                   YYFPNYEQPTQFSQYYQFLLEKTEGAYVFYDTENETNLKYFLKKAKDMPHYQLLLLTFD
FT                   RLNDMSQS"
FT   misc_feature    474398..474910
FT                   /locus_tag="SpyM50438"
FT                   /note="HMMPfam hit to PF06908, Protein of unknown function
FT                   (DUF1273), score 2.3e-117"
FT                   /inference="protein motif:HMMPfam:PF06908"
FT   CDS             475032..475358
FT                   /transl_table=11
FT                   /locus_tag="SpyM50439"
FT                   /product="DivIVA protein"
FT                   /db_xref="GOA:A2RD56"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /protein_id="CAM29781.1"
FT                   /translation="MTSIIYSPKDIFEQEFKTSMRGFDKKEVDEFLDNVIKDYENFNAQ
FT                   IEALKAENEALKKAKFQARNTVSATVQQPVPQPTRVAQSATNFDILKRISKLEKEVFGK
FT                   QIIE"
FT   misc_feature    475032..475355
FT                   /locus_tag="SpyM50439"
FT                   /note="HMMPfam hit to PF05103, DivIVA protein, score
FT                   3.4e-37"
FT                   /inference="protein motif:HMMPfam:PF05103"
FT   misc_RNA        475406..475735
FT                   /note="Bacterial RNase P class B (RF00011) as predicted by
FT                   Rfam, score 300.64"
FT                   /inference="nucleotide motif:Rfam:RF00011"
FT   CDS             475803..476957
FT                   /transl_table=11
FT                   /locus_tag="SpyM50440"
FT                   /product="putative RNA methylase family protein"
FT                   /db_xref="GOA:A2RD57"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD57"
FT                   /protein_id="CAM29782.1"
FT                   /translation="MKETFRLVATAAAGLEAVVGKEVRALGFDCQVENGKVYFEGDVEA
FT                   IVKTNLWLRAADRIKIIVGQFPARTFEELFQGVFALDWENYLPLGAKFPISKAKCVKSK
FT                   LHNEPSVQAITKKAVVKKLQKHFHRPEGVPLQEVGSTFNIEVSILKDQATIMIDTTGSS
FT                   LFKRGYRVQKGGAPIKENMAAAILALSNWFPDKPLVDPTCGSGTFCIEAALIGMNIAPG
FT                   FNRSFAFEEWSWVDKDMVQQVRDDAEQEANYEIELDISGFDIDGRMIEIAKSNAEEAGL
FT                   SDVITFKQMRLQDFRTDKINGVVISNPPYGERLLDDKAVDILYNEMGQTFAPLKTWSKF
FT                   ILTSDELFELKYGQKADKKRKLYNGTLKVDLYQFYGERVKRHLI"
FT   misc_feature    476301..476921
FT                   /locus_tag="SpyM50440"
FT                   /note="HMMPfam hit to PF01170, Putative RNA methylase
FT                   family UPF0020, score 1.3e-66"
FT                   /inference="protein motif:HMMPfam:PF01170"
FT   misc_feature    476712..476732
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS             476971..478440
FT                   /transl_table=11
FT                   /locus_tag="SpyM50441"
FT                   /product="putative membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD58"
FT                   /protein_id="CAM29783.1"
FT                   /translation="MSEESKEVEVTKESQTLGLNEAKSMTIGEAVRKQSEIKAGVTKDD
FT                   SILDKYIKQHRDEVSSQKFDAKYTELDTASLDNFIKKQREALSKAGLVDDEPVSAESAE
FT                   QDSTLVEEVAEDLAPMETTAVVTGIPVEATVPVLDLDPSERVIPEPQITKEEPKRDQFL
FT                   SEDSHHPAKQNTKKGWLIALFLLLLAILAVVFGWNHFLRQDSGKTTQTASKQTKTSLQT
FT                   DSAKKATRLKAAAKAFEKQYGTFYTDATKSKLKNSAFATLPDLEAALKALEGSAYYDKA
FT                   KAKVDSLKKAIAAITAVNGKFVSDVVVDGEKVSAEVKADANFDDLSSATLTTGNANLDA
FT                   VLQASITEGRQQLASKAEAAKAANEQEAQDQAAQGQSTSVAPSGYGLTSYDPASLQRHL
FT                   SRVPYNQDVIADRANPSWAFNPGVLEKIVATSQARGYISGNQYILEPVNIINGNGYYNM
FT                   FKPDGTYLFSINCKTGYFVGNGKGYADALDY"
FT   misc_feature    477505..477573
FT                   /locus_tag="SpyM50441"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50441 by TMHMM2.0 at aa 179-201"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(478585..479067)
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="SpyM50442"
FT                   /product="S-ribosylhomocysteinase"
FT                   /EC_number="3.13.1.-"
FT                   /db_xref="GOA:A2RD59"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /protein_id="CAM29784.1"
FT                   /translation="MTKEVIVESFELDHTIVKAPYVRLISEEFGPKGDRITNFDVRLVQ
FT                   PNQNSIETAGLHTIEHLLAKLIRQRIDGMIDCSPFGCRTGFHLIMWGKHSSTDIAKVIK
FT                   SSLEEIATGITWEDVPGTTLESCGNYKDHSLFAAKEWAQLIIDQGISDDPFSRHVI"
FT   misc_feature    complement(478594..479055)
FT                   /gene="luxS"
FT                   /locus_tag="SpyM50442"
FT                   /note="HMMPfam hit to PF02664, LuxS protein, score 2.8e-44"
FT                   /inference="protein motif:HMMPfam:PF02664"
FT   CDS             complement(479141..480472)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50443"
FT                   /product="putative permease"
FT                   /db_xref="GOA:A2RD60"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD60"
FT                   /protein_id="CAM29785.1"
FT                   /translation="MEIIGSLGVLVGVIVIIYLSVKEVNIIIAAPLATSLVILFNQMDP
FT                   TTTLLGKEPNQFMGALSTYILNYFAIFLLGSILAKLMETSGATTSIADYILKKVGHDSP
FT                   YKVLVAIFLISAILTYGGISLFVVMFAVLPLARSLFKKMDLAWNLIQVPLWLGIATFTM
FT                   TILPGTPAIQNVIPIQYLDTSLTAAAIPSIVGSIGCVTFGLFYMKYCLAKSMARGETYA
FT                   TYAFDNEIQVKTKNLPHFLASILPLLLLIIIALTGSLFGNDFFKKNIIFIALLAAILTA
FT                   SWLFRQFIPNKIAVFNLGASSSIAPIFATASAVAFGAVVMIAPGFTFFSDLILNIPGNP
FT                   LISLAVLTSSMSAITGSSSGALGIVMPNFAQYYLDQGLNPEMIHRVATIASNIFTIVPQ
FT                   SGVFLTFLALTGLNHKNAFKETFITVSVSTFIAQVIMIAFDLFS"
FT   misc_feature    complement(order(479156..479209,479246..479314,
FT                   479381..479449,479486..479554,479612..479671,
FT                   479690..479758,479852..479920,479957..480025,
FT                   480083..480151,480236..480304,480386..480454))
FT                   /locus_tag="SpyM50443"
FT                   /note="11 probable transmembrane helices predicted for
FT                   SpyM50443 by TMHMM2.0 at aa 7-29,
FT                   57-79,108-130,150-172,185-207, 239-261, 268-287,
FT                   307-329,342-364,387-409 and 422-439"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(480543..481322)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50444"
FT                   /product="putative D-beta-hydroxybutyrate dehydrogenase"
FT                   /EC_number="1.1.1.30"
FT                   /db_xref="GOA:A2RD61"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011294"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD61"
FT                   /protein_id="CAM29786.1"
FT                   /translation="MTHTKEVAFITGAASGIGKQIGETFLKEGKTVVFSDINKEKLDEV
FT                   VADYTKEGYDAFSVVCDVTKEEAINAAIDTVVEKYGRIDILVNNAGLQHVAMIEDFPTE
FT                   KFEFMIKIMLTAPFIAIKRAFPTMKAQKHGRIINMASINGVIGFAGKSAYNSAKHGLIG
FT                   LTKVTALEAADSGITVNAICPGYVDTPLVRGQFEDLSKTRGIPLENVLEEVLYPLVPQK
FT                   RLIDVQEIADYVSFLASDKAKGVTGQACILDGGYTAQ"
FT   misc_feature    complement(480555..481301)
FT                   /locus_tag="SpyM50444"
FT                   /note="HMMPfam hit to PF00106, short chain
FT                   dehydrogenase,score 1.4e-87"
FT                   /inference="protein motif:HMMPfam:PF00106"
FT   misc_feature    complement(480816..480902)
FT                   /note="PS00061 Short-chain dehydrogenases/reductases family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00061"
FT   CDS             complement(join(481355..481609,481615..482019))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="atoA2"
FT                   /locus_tag="SpyM50445"
FT                   /EC_number="2.8.3.8"
FT                   /note="Similar to Escherichia coli acetate CoA-transferase
FT                   beta subunit AtoA UniProt:ATOA_ECOLI (EMBL:CEK129C6R) (216
FT                   aa) fasta scores: E()=1.1e-38, 57.214% id in 201 aa. CDS
FT                   contains a frameshift mutation after codon 135. Similar to
FT                   SpyM50116, 68.571% identity (68.900% ungapped) in 210 aa
FT                   overlap"
FT                   /db_xref="PSEUDO:CAM29787.1"
FT   misc_feature    complement(481393..481980)
FT                   /gene="atoA2"
FT                   /locus_tag="SpyM50445"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,score
FT                   5.1e-40"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    complement(481837..481863)
FT                   /note="PS01274 CoA transferases signature 2"
FT                   /inference="protein motif:Prosite:PS01274"
FT   CDS             complement(482021..482671)
FT                   /transl_table=11
FT                   /gene="atoD2"
FT                   /locus_tag="SpyM50446"
FT                   /product="acetate CoA-transferase alpha subunit 2"
FT                   /EC_number="2.8.3.8"
FT                   /note="Similar to SpyM50115, 74.057% identity (74.057%
FT                   ungapped) in 212 aa overlap"
FT                   /db_xref="GOA:A2RD63"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD63"
FT                   /protein_id="CAM29788.1"
FT                   /translation="MCKEITIKEAVAHVKDGDTIMVGGFMTNGTPEKLIDALVEKGVKD
FT                   LTLICNNAGFPDKGVGKMVANKQFSTIIASHIGLNREAGRQMTEGETVIDLVPQGTLAE
FT                   RIRSGGFGLGGFLTPTGIGTEVAKGKEVITIDGKDYLLETPLKADVALIFANKADKNGN
FT                   LQYAGSENNFNHVMAANAKTTIVEAREIVDVGQMDPNFVHTPGIFVNYLVKGA"
FT   misc_feature    complement(482027..482662)
FT                   /gene="atoD2"
FT                   /locus_tag="SpyM50446"
FT                   /note="HMMPfam hit to PF01144, Coenzyme A transferase,score
FT                   2.4e-79"
FT                   /inference="protein motif:HMMPfam:PF01144"
FT   misc_feature    complement(482579..482626)
FT                   /note="PS01273 CoA transferases signature 1"
FT                   /inference="protein motif:Prosite:PS01273"
FT   CDS             complement(482695..483882)
FT                   /transl_table=11
FT                   /gene="atoB2"
FT                   /locus_tag="SpyM50447"
FT                   /product="acetyl-CoA acetyltransferase 2"
FT                   /EC_number="2.3.1.9"
FT                   /note="Similar to SpyM50114, 64.872% identity (64.872%
FT                   ungapped) in 390 aa overlap"
FT                   /db_xref="GOA:A2RD64"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD64"
FT                   /protein_id="CAM29789.1"
FT                   /translation="MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKP
FT                   EMVDEVILGNVLHAGLGQNVARQIAIHSGIPSDKTAFTLDMVCGSGLKAIQLATQSIML
FT                   GDADIVIAGGVENMSQAAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAEN
FT                   VAQKYGISREEQDQFALESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKV
FT                   DTSLEKLQQLRPAFLPKEGTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYA
FT                   SAGVAPELMGTGPIPATQKVLKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVN
FT                   VNGGAIALGHPIGASGARILVTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT"
FT   misc_feature    complement(482704..483072)
FT                   /gene="atoB2"
FT                   /locus_tag="SpyM50447"
FT                   /note="HMMPfam hit to PF02803, Thiolase, C-terminal domain,
FT                   score 2.4e-72"
FT                   /inference="protein motif:HMMPfam:PF02803"
FT   misc_feature    complement(482719..482760)
FT                   /note="PS00099 Thiolases active site"
FT                   /inference="protein motif:Prosite:PS00099"
FT   misc_feature    complement(482815..482865)
FT                   /note="PS00737 Thiolases signature 2"
FT                   /inference="protein motif:Prosite:PS00737"
FT   misc_feature    complement(483091..483882)
FT                   /gene="atoB2"
FT                   /locus_tag="SpyM50447"
FT                   /note="HMMPfam hit to PF00108, Thiolase, N-terminal domain,
FT                   score 6.7e-148"
FT                   /inference="protein motif:HMMPfam:PF00108"
FT   CDS             484081..484977
FT                   /transl_table=11
FT                   /locus_tag="SpyM50448"
FT                   /product="LysR family regulatory protein"
FT                   /db_xref="GOA:A2RD65"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD65"
FT                   /protein_id="CAM29790.1"
FT                   /translation="MDIKQIRYFIAIVENHFNLSQAAELLYVSQPTLSMMINDFEKREN
FT                   VKLFKRKRGRIIGLTYLGDNYYKDAQKVLSLYDDMFLKLHDHSKGLKGSINIGIPPLIL
FT                   SVVFSEVMPKLILENPGIQFNVKEIGAYQLKNELLVGNVDVAVLLSPTGIADNLVETYE
FT                   IQRSELSVCLSPRHRLASKKVIQWEDLTDEQLALFDPSFMVHHLVLEACERHQVRPNII
FT                   LTSSSWDFMLNSTKINHNVLTICPKPITELYQLKDIKCIPMERPISWRVVLTRLRKKSY
FT                   SEIEAYIMDDLLQSFFK"
FT   misc_feature    484087..484272
FT                   /locus_tag="SpyM50448"
FT                   /note="HMMPfam hit to PF00126, Bacterial regulatory
FT                   helix-turn-helix, score 2.7e-16"
FT                   /inference="protein motif:HMMPfam:PF00126"
FT   misc_feature    484129..484194
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1867.000, SD 5.55 at aa 17-38, sequence
FT                   FNLSQAAELLYVSQPTLSMMIN"
FT   misc_feature    484132..484224
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    484342..484971
FT                   /locus_tag="SpyM50448"
FT                   /note="HMMPfam hit to PF03466, LysR substrate binding
FT                   domain, score 1.4e-26"
FT                   /inference="protein motif:HMMPfam:PF03466"
FT   CDS             485107..486714
FT                   /transl_table=11
FT                   /locus_tag="SpyM50449"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="GOA:A2RD66"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /protein_id="CAM29791.1"
FT                   /translation="MVNIILLIVSALIGLILGYALISIRLKSAKEAAELTLLNAEQEAV
FT                   DIRGKAEVDAEHIKKTAKRESKANRKELLLEAKEEARKYREEIEQEFKSERQELKQLET
FT                   RLAERSLTLDRKDENLSSKEKVLDSKEQSLTDKSKHIDERQLQVEKLEEEKKAELEKVA
FT                   AMTIAEAREVILMETENKLTHEIATRIRDAERDIKDRTVKTAKDLLAQAMQRLAGEYVT
FT                   EQTITSVHLPDDNMKGRIIGREGRNIRTLESLTGIDVIIDDTPEVVILSGFDPIRREIA
FT                   RMTLESLIADGRIHPARIEELVEKNRLEMDNRIREYGEAAAYEIGAPNLHPDLIKIMGR
FT                   LQFRTSFGQNVLRHSVEVGKLAGILAGELGENVALARRAGFLHDMGKAIDREVEGSHVE
FT                   IGMEFARKYKEHPVVVNTIASHHGDVEPDSVIAVLVAAADALSSARPGARNESMENYIK
FT                   RLRDLEEIATSFDGVQNSFALQAGREIRIMVQPEKISDDQVVILSHKVREKIENNLDYP
FT                   GNIKVTVIREMRAVDYAK"
FT   sig_peptide     485107..485190
FT                   /locus_tag="SpyM50449"
FT                   /note="Signal peptide predicted for SpyM50449 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.921) with cleavage
FT                   site probability 0.430 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    485110..485178
FT                   /locus_tag="SpyM50449"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50449 by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    485782..485961
FT                   /locus_tag="SpyM50449"
FT                   /note="HMMPfam hit to PF00013, KH domain, score 1.1e-09"
FT                   /inference="protein motif:HMMPfam:PF00013"
FT   misc_feature    486157..486438
FT                   /locus_tag="SpyM50449"
FT                   /note="HMMPfam hit to PF01966, HD domain, score 7.6e-24"
FT                   /inference="protein motif:HMMPfam:PF01966"
FT   CDS             486824..487459
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SpyM50450"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="GOA:A2RD67"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD67"
FT                   /protein_id="CAM29792.1"
FT                   /translation="MSERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRPQR
FT                   PGEVDGVDYFFRTREEFEELIKTGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIE
FT                   VQGALQVKSKVPDGVFVFLTPPDLDELEDRLVGRGTDSQEVIAQRIERAKEEIALMREY
FT                   DYAVVNDEVALAAERVKRIIETEHFRVERVIGRYDKMIKITKNPFKAK"
FT   misc_feature    486944..487258
FT                   /gene="gmk"
FT                   /locus_tag="SpyM50450"
FT                   /note="HMMPfam hit to PF00625, Guanylate kinase, score
FT                   4.1e-43"
FT                   /inference="protein motif:HMMPfam:PF00625"
FT   CDS             487475..487792
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="SpyM50451"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="GOA:A2RD68"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /protein_id="CAM29793.1"
FT                   /translation="MMLKPSIDTLLDKVPSKYSLVILQAKRAHELEAGATPTQEFKSVK
FT                   STLQALEEIESGNVVIHPDPSAKREAVRAKIEAERLAKEEEERKIKEQIAKEKEEEGEK
FT                   I"
FT   misc_feature    487511..487669
FT                   /gene="rpoZ"
FT                   /locus_tag="SpyM50451"
FT                   /note="HMMPfam hit to PF01192, RNA polymerase Rpb6, score
FT                   3.8e-14"
FT                   /inference="protein motif:HMMPfam:PF01192"
FT   CDS             487857..490241
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SpyM50452"
FT                   /product="putative primosomal protein N'"
FT                   /db_xref="GOA:A2RD69"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD69"
FT                   /protein_id="CAM29794.1"
FT                   /translation="MEKVAHVIVDIPLMQTDKPFSYGIPKELVSLVQLGSRVHVPFGKG
FT                   NRLLQGFIIGFGQEDSSSLKLIQTVLDPEPVLNQEQLTLADQLRKTVFSYKITLLKAMI
FT                   PNLLNSNYDKVLRPESGLKKPDRDFLFEGQPSVLYSTLDREKGKIALKGIQAGHITVSY
FT                   LAKDKKNLKTEKYYHVDLDALAVHPISSRAKKRQLLKDYLLTHTKEAKLATLYQAFSRD
FT                   VVTYFVTNHLIRIDERPIDRSESYFDQIKPSSFLTLNEQQASAVTEIVEQIGKPSKPFL
FT                   IEGITGSGKTEVYLHIIEAVLKQDKTAIVLVPEISLTPQMTSRFISRFGKQVAIMHSGL
FT                   SDGEKFDEWRKIKTGQAKVVVGARSAIFSPLERIGAIIIDEEHESTYKQESNPRYHARE
FT                   VALLRAKHHQAVVVMGSATPSIESRARASKGVYHFIQLTQRANPLAKIPEVTIVDFRDY
FT                   IGQQAVSNFTPYLIDKIKERLVKKEQVVLMLNRRGYSSFVTCRDCGYVDKCLNCDISLT
FT                   LHMDTKTMNCHYCGFQKPIPITCPECYSNSIRYYGTGTQKAFDELQGVIPEARILRMDV
FT                   DTTRKKRSHKTILDSFGRQEADILLGTQMIAKGLDFPNVTLVGVLNADTSLNLPDFRAS
FT                   EKTFQLLTQVAGRAGRAHKPGEVLIQTYNPDHYAIQLAKKQDFEAFYRYEMAIRRQMAY
FT                   PPYYFTVGITLSHRLEASVVKKAYQVTELLKSHLSDNIKILGPTPKPIARTHNLYHYQI
FT                   LLKYRFEDNLEETLNRILDWSQEADNRHLKLIIDCEPQQFL"
FT   misc_feature    488622..489119
FT                   /gene="priA"
FT                   /locus_tag="SpyM50452"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 2.9e-29"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    488628..489137
FT                   /gene="priA"
FT                   /locus_tag="SpyM50452"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   2.6e-19"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    488706..488729
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    489543..489815
FT                   /gene="priA"
FT                   /locus_tag="SpyM50452"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 1.5e-06"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS             490303..491238
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SpyM50453"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="GOA:A2RD70"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR015518"
FT                   /protein_id="CAM29795.1"
FT                   /translation="MIKLLFMGTPQFSATVLKGLLDNPAYEILGVVTQPDRAVGRKKDI
FT                   KVTPVKQLALEHGISIYQPEKLSGSQELIEIMGLGADGIITAAFGQFLPTLLLDSVSFA
FT                   INVHASLLPKYRGGAPIHYAIMNGDKEAGVTIMEMIKEMDAGDMVAKASTPILETDNVG
FT                   TLFEKLAIIGRDLLLDSLPAYLSGELKPIPQDHSQATFSPNISPEQEKLDWTMSNQEVF
FT                   NHIRGMNPWPVAHTFLEGQRLKIYEAQLAEGEGLPGQVIVKTKKSLVIATGQGALSLIV
FT                   VQPAGKPKMSIIDFLNGIGRKLEVGDIIGR"
FT   misc_feature    490306..490845
FT                   /gene="fmt"
FT                   /locus_tag="SpyM50453"
FT                   /note="HMMPfam hit to PF00551, Formyl transferase, score
FT                   1.1e-36"
FT                   /inference="protein motif:HMMPfam:PF00551"
FT   misc_feature    490918..491202
FT                   /gene="fmt"
FT                   /locus_tag="SpyM50453"
FT                   /note="HMMPfam hit to PF02911, Formyl
FT                   transferase,C-terminal domain, score 1.2e-31"
FT                   /inference="protein motif:HMMPfam:PF02911"
FT   CDS             491228..492550
FT                   /transl_table=11
FT                   /locus_tag="SpyM50454"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase"
FT                   /db_xref="GOA:A2RD71"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD71"
FT                   /protein_id="CAM29796.1"
FT                   /translation="MADNWKKSTRGKALLVIEAIFDQGAYTNIALNQQLSNKALSAKDR
FT                   ALLTEIVYGTVSRKISLEWYLAHYVKDRDKLDKWVYYLLMLSLYQLTYLDKLPAHAIVN
FT                   DAVGIAKNRGNKKGAEKFVNAILRQFTNHPLPDMETIKRRNKYYSVKYSLPVWLVKKLE
FT                   DQFGSDRSVAIMESLFVRSKASIRVTDPLKLEEVAEALDAERSLLSATGLTKASGHFAA
FT                   SDYFTNGDITIQDESSQLVAPTLNIDGDDIILDACSAPGGKTSHIASYLKTGKVIALDL
FT                   YDHKLELVKENANRLGVADNIETRKLDAREVHRHFEKDSFDKILVDAPCSGIGLIRRKP
FT                   DIKYNKESQDFNALQAIQLEILSSVCQTLRKGGIITYSTCTIFDEENRQVIEAFLQSHP
FT                   NFEQVKLNHTQADIVKDGYLIITPEQYQTDGFFIGQVRRVL"
FT   misc_feature    491246..491629
FT                   /locus_tag="SpyM50454"
FT                   /note="HMMPfam hit to PF01029, NusB family, score 1.5e-29"
FT                   /inference="protein motif:HMMPfam:PF01029"
FT   misc_feature    491747..492538
FT                   /locus_tag="SpyM50454"
FT                   /note="HMMPfam hit to PF01189, NOL1/NOP2/sun family, score
FT                   2.2e-44"
FT                   /inference="protein motif:HMMPfam:PF01189"
FT   misc_feature    492188..492223
FT                   /note="PS01153 NOL1/NOP2/sun family signature"
FT                   /inference="protein motif:Prosite:PS01153"
FT   CDS             492588..493328
FT                   /transl_table=11
FT                   /locus_tag="SpyM50455"
FT                   /product="putative protein phosphatase"
FT                   /db_xref="GOA:A2RD72"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD72"
FT                   /protein_id="CAM29797.1"
FT                   /translation="MKISLKTDIGQKRSNNQDFINKFDNKKGITLVILADGMGGHRAGN
FT                   IASEMTVTDLGREWVKTDFTELSQIRDWLFETIQSENQRIYDLGQSEDFKGMGTTVEAV
FT                   ALVESSAIYAHIGDSRIGLVHDGHYTLLTSDHSLVNELVKAGQITEEEAASHPQRNIIT
FT                   QSIGQASPVEPDLGVRVLEPGDYLVINSDGLTNMISNDEIVTILGSKVSLDEKNQEMID
FT                   LANLRGGLDNITIALVHNESEDVE"
FT   misc_feature    492594..493286
FT                   /locus_tag="SpyM50455"
FT                   /note="HMMPfam hit to PF00481, Protein phosphatase 2C,score
FT                   2.9e-07"
FT                   /inference="protein motif:HMMPfam:PF00481"
FT   CDS             493325..495223
FT                   /transl_table=11
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /product="serine/threonine-protein kinase"
FT                   /db_xref="GOA:A2RD73"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD73"
FT                   /protein_id="CAM29798.1"
FT                   /translation="MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLR
FT                   TNYQTDQVAVARFQREARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQN
FT                   HAPLSNNEVVRIMEEVLSAMTLAHQKGIVHRDLKPQNILLTKDGVVKVTDFGIAVAFAE
FT                   TSLTQTNSMLGSVHYLSPEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIAL
FT                   QHFQKPLPSIIEENHNVPQALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRER
FT                   KIVFEDVESTKPLPKVASGPTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSG
FT                   RFLGTLFKILFSFFIVGVALFTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKI
FT                   RQIESDTVAEGNVVRTDPKAGTAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLI
FT                   ETYGVPKSKIKIERIVTNEYPENTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMV
FT                   TEYSYADAVNTLTALGIDASRIKAYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLS
FT                   LSDKGEISLYLYPEETHSSSSSSSSTSSSNSSSTNDSTAPGSNTELSPSETTAQTP"
FT   misc_feature    493358..494143
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /note="HMMPfam hit to PF00069, Protein kinase domain,score
FT                   5.2e-59"
FT                   /inference="protein motif:HMMPfam:PF00069"
FT   misc_feature    493376..493450
FT                   /note="PS00107 Protein kinases ATP-binding region
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00107"
FT   misc_feature    493718..493756
FT                   /note="PS00108 Serine/Threonine protein kinases active-site
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00108"
FT   misc_feature    494354..494422
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50456 by TMHMM2.0 at aa 344-366"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    494432..494629
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /note="HMMPfam hit to PF03793, PASTA domain, score 5.9e-19"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    494636..494842
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /note="HMMPfam hit to PF03793, PASTA domain, score 2.8e-15"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   misc_feature    494852..495091
FT                   /gene="stk1"
FT                   /locus_tag="SpyM50456"
FT                   /note="HMMPfam hit to PF03793, PASTA domain, score 2.1e-09"
FT                   /inference="protein motif:HMMPfam:PF03793"
FT   CDS             495346..496038
FT                   /transl_table=11
FT                   /locus_tag="SpyM50457"
FT                   /product="putative membrane protein"
FT                   /db_xref="GOA:A2RD74"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD74"
FT                   /protein_id="CAM29799.1"
FT                   /translation="MKKFQFFLLIECILLAMGIMTILDNDLSSFILILVLILLALRFYN
FT                   QDSRNNFLLTVSLLFLFLIFMLNPYIIMAVLLGIVYIFINHFSQVKKKNRFALIRFKEE
FT                   KVEVNNTKHQWIGTANYESDYYCFDDINIIRISGNDTVDLTNVIVTGMDNIIVIRKIFG
FT                   NTTILVPIDVTVTLDVSSIYGSVDFFRCQQYDLRNESIKLKETDNQSLKKVKIIVTTIA
FT                   GNVEVDRR"
FT   misc_feature    order(495358..495414,495424..495477,495496..495597)
FT                   /locus_tag="SpyM50457"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50457 by TMHMM2.0 at aa 5-23, 27-44 and 51-84"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             496035..497039
FT                   /transl_table=11
FT                   /locus_tag="SpyM50458"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="GOA:A2RD75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD75"
FT                   /protein_id="CAM29800.1"
FT                   /translation="MKKRYYALVWLYSTITILSIVFVVMDNLGITFNYLRNHLWQVERL
FT                   GFSILLLIVSVTLLLLLLWIIMDDNSKRNINQNLKYILNNRRLYLDETSEINTNLSRLS
FT                   KKMSHLTANMQKKESAYILDSQEVVKQERKRIARDLHDTVSQELFASSLILSGISMSLE
FT                   QLDKTQLQTQLTTVEAMLQNAQNDLRILLLHLRPTELANRTLSEGLHMILKELTDKSDI
FT                   EVIYKETIAQLPKTMEDNLFRIAQEFISNTLKHAKASRIEVYLNQTSTELQLKMIDDGV
FT                   GFDMDQVRDLSYGLKNIEDRVNDLAGNLHLISQKGKGVSMDIRLPIVKGDDDE"
FT   misc_feature    order(496053..496109,496167..496235)
FT                   /locus_tag="SpyM50458"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50458 by TMHMM2.0 at aa 7-25 and 45-67"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    496428..496634
FT                   /locus_tag="SpyM50458"
FT                   /note="HMMPfam hit to PF07730, Histidine kinase, score
FT                   2.3e-21"
FT                   /inference="protein motif:HMMPfam:PF07730"
FT   misc_feature    496740..497018
FT                   /locus_tag="SpyM50458"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP90, score 1.3e-11"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             497032..497673
FT                   /transl_table=11
FT                   /locus_tag="SpyM50459"
FT                   /product="response regulator protein"
FT                   /db_xref="GOA:A2RD76"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD76"
FT                   /protein_id="CAM29801.1"
FT                   /translation="MSKIKVILVDDHEMVRMGLKSFLNLQADIDVVGEASNGREGVDLA
FT                   LALKPDVLVMDLVMPELGGVEATLEVLKKWKEAKVLVLTSYLDNEKIYPVIDAGAKGYM
FT                   LKTSSAAEILNAIRKVLKGELAIETEVDKKIKAHDQHPDLHEELTAREYDILHLLAKGY
FT                   DNQTIADELFISLKTVKTHVSNILAKLEVDDRTQAVVYAFRHHLVPQDDN"
FT   misc_feature    497041..497403
FT                   /locus_tag="SpyM50459"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 8.1e-30"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    497464..497637
FT                   /locus_tag="SpyM50459"
FT                   /note="HMMPfam hit to PF00196, Bacterial regulatory
FT                   proteins, luxR fami, score 2.5e-23"
FT                   /inference="protein motif:HMMPfam:PF00196"
FT   misc_feature    497515..497598
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00622"
FT   CDS             497710..499110
FT                   /transl_table=11
FT                   /locus_tag="SpyM50460"
FT                   /product="cyclophilin type peptidyl-prolyl cis-trans
FT                   isomerase protein"
FT                   /db_xref="GOA:A2RD77"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD77"
FT                   /protein_id="CAM29802.1"
FT                   /translation="MDAKLKYKAKKIKMVFFDIDDTLRVKDTGYMPESIQRVFKALKAK
FT                   GILVGIASGRARYGVPQEVQDLHADYCVKLNGAYVKDDAKTIIFQAPIPADVVVAYKKW
FT                   ADDMGIFYGMAGRHEAVLSARNDMISNAIDNVYAQLEVCPDYNEYHDVYQMWTFEDKGD
FT                   GLQLPAELAEHLRLVRWHDNSSDVVLKGTSKALGVSKVVDHLGLKPENILVFGDELNDL
FT                   ELFDYAGISIAMGVSHPLLQEKADFITKKVEEDGILYALEELGLIDKELQFPQLDLENH
FT                   TGPKVTIKTNHGDMTLVLFPDHAPKTVANFLGLAKEGYYDGIIFHRIIPEFMIQGGDPT
FT                   GTGMGGQSIYGESFEDEFSDELYNLRGALSMANAGPNTNGSQFFIVQNSKIPYAKKELE
FT                   RGGWPTPIAAAYAENGGTPHLDRRHTVFGQLVDETSFQVLDLIAGVETGAQDKPKEDVI
FT                   IETIEVFD"
FT   misc_feature    497743..498423
FT                   /locus_tag="SpyM50460"
FT                   /note="HMMPfam hit to PF00702, haloacid dehalogenase-like
FT                   hydrolase, score 0.0016"
FT                   /inference="protein motif:HMMPfam:PF00702"
FT   misc_feature    498562..499104
FT                   /locus_tag="SpyM50460"
FT                   /note="HMMPfam hit to PF00160, Cyclophilin type
FT                   peptidyl-prolyl cis-tr, score 3.8e-54"
FT                   /inference="protein motif:HMMPfam:PF00160"
FT   CDS             499110..499487
FT                   /transl_table=11
FT                   /locus_tag="SpyM50461"
FT                   /product="putative S1 RNA binding domain protein"
FT                   /db_xref="GOA:A2RD78"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD78"
FT                   /protein_id="CAM29803.1"
FT                   /translation="MKIGDKLHGTITGIKPYGAFVALENGTTGLIHISEIKTGFIDDID
FT                   QLLAIGNQVLVQVIDIDEYSKKPSLSMRTLAEEKQHFFHRHRYSNSRHKIGFRPLEEQL
FT                   PQWIEESLQFLKKNTKKSLEP"
FT   misc_feature    499113..499328
FT                   /locus_tag="SpyM50461"
FT                   /note="HMMPfam hit to PF00575, S1 RNA binding domain,score
FT                   1.3e-16"
FT                   /inference="protein motif:HMMPfam:PF00575"
FT   CDS             complement(499505..500446)
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="SpyM50462"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /db_xref="GOA:A2RD79"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD79"
FT                   /protein_id="CAM29804.1"
FT                   /translation="MTKIYKTITELVGQTPIIKLNRLIPNEAADVYVKLEAFNPGSSVK
FT                   DRIALSMIEAAEAEGLISPGDVIIEPTSGNTGIGLAWVGAAKGYRVIIVMPETMSLERR
FT                   QIIQAYGAELVLTPGAEGMKGAIAKAETLAIELGAWMPMQFNNPANPSIHEKTTAQEIL
FT                   EAFKEISLDAFVSGVGTGGTLSGVSHVLKKASPETVIYAVEAEESAVLSGQEPGPHKIQ
FT                   GISAGFIPNTLDTKAYDQIIRVKSKDALETARLTGAKEGFLVGISSGAALYAAIEVAKQ
FT                   LGKGKHVLTILPDNGERYLSTELYDVPVIKTK"
FT   misc_feature    complement(499562..500425)
FT                   /gene="cysM"
FT                   /locus_tag="SpyM50462"
FT                   /note="HMMPfam hit to PF00291, Pyridoxal-phosphate
FT                   dependent enzyme, score 2.7e-114"
FT                   /inference="protein motif:HMMPfam:PF00291"
FT   misc_feature    complement(500291..500347)
FT                   /note="PS00901 Cysteine synthase/cystathionine
FT                   beta-synthase P-phosphate attachment site"
FT                   /inference="protein motif:Prosite:PS00901"
FT   CDS             complement(500574..501206)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD80"
FT                   /protein_id="CAM29805.1"
FT                   /translation="MEHFKTIKASGFFEESIKKSRFICHIKRVSTEEDGKNFVNAIKKE
FT                   HYKANHSCFAMIIGNNRQIKRSSDDGEPSGTAGIPILSVLEKQCLTNVVVVVTRYFGGI
FT                   KLGTGGLIRAYSNMTATAIKRFGIIEVKQQIGLEITLSYPQYQLYSNLLDQLALTETET
FT                   KFSDTIKTTLYCDTERVENLIDTLTNYYHGQISCEKIGSKVIEFPCD"
FT   misc_feature    complement(500835..501158)
FT                   /locus_tag="SpyM50463"
FT                   /note="HMMPfam hit to PF01205, Uncharacterized protein
FT                   family UPF0029, score 5.5e-56"
FT                   /inference="protein motif:HMMPfam:PF01205"
FT   misc_feature    complement(500886..500975)
FT                   /note="PS00910 Uncharacterized protein family UPF0029
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00910"
FT   CDS             501262..502587
FT                   /transl_table=11
FT                   /gene="comFA"
FT                   /locus_tag="SpyM50464"
FT                   /product="putative late competence protein"
FT                   /db_xref="GOA:A2RD81"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD81"
FT                   /protein_id="CAM29806.1"
FT                   /translation="MESIENSYGRLLLESQLPDSAKQLAQPLKSVVILRGKMICQRCHY
FT                   QLDEEARLPSGAYYCRFCLVFGRNQSDKLLYAIPPMHFPKGNYLVWSGQLTAYQEIISQ
FT                   QLLINMQNQKTTLVHAVTGSGKTEMIYAAIEAVINTGGWVCIASPRVDVCVEVATRLSQ
FT                   AFSCSICLMHAESLPYQRAPIIVATTHQLLKFHKAFDLLIIDEVDAFPFVNNIQLHYAA
FT                   SQALKEGGAKILLTATSTRTLERKVNKGEVVKLTLARRFHNRPLVIPKFIRSFNLFKMI
FT                   HRQKLPPKILKYLKKQRKTGYPLLIFLPTIIMAESVTAILKELLPAEQIACVSSQSQNR
FT                   KEDITAFRQGKKTILITTTILERGVTFPQIDVFVLGSHHRVYSSQSLVQIAGRVGRSID
FT                   RPDGTLYFFHEGISKAMLLAKKEIKEMNYKGYSHDLSTMSTN"
FT   misc_feature    501538..501984
FT                   /gene="comFA"
FT                   /locus_tag="SpyM50464"
FT                   /note="HMMPfam hit to PF04851, Type III restriction enzyme,
FT                   res subunit, score 2.3e-05"
FT                   /inference="protein motif:HMMPfam:PF04851"
FT   misc_feature    501544..501999
FT                   /gene="comFA"
FT                   /locus_tag="SpyM50464"
FT                   /note="HMMPfam hit to PF00270, DEAD/DEAH box helicase,score
FT                   3.9e-08"
FT                   /inference="protein motif:HMMPfam:PF00270"
FT   misc_feature    501619..501642
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    502231..502455
FT                   /gene="comFA"
FT                   /locus_tag="SpyM50464"
FT                   /note="HMMPfam hit to PF00271, Helicase conserved
FT                   C-terminal domain, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF00271"
FT   CDS             502559..503224
FT                   /transl_table=11
FT                   /gene="comFC"
FT                   /locus_tag="SpyM50465"
FT                   /product="putative late competence protein"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD82"
FT                   /protein_id="CAM29807.1"
FT                   /translation="MICLLCQQISQTPISITEIIFLRRISSPICQQCQKSFQKIGKSVC
FT                   ATCCANSDIIACRDCLKWENKGYNVNHRSLYCYNAAMKAYFSQYKFQGDYLLRKVFAVE
FT                   LADVITKYYKGYIPVPVPVSPGCFRERQFNQVSAILEAANVSYLSLFEKLDNTHQSSRT
FT                   KKERLLVEKSYRLLKVSNIPDKILIVDDIYTTGSTIIALRKQLAKVANSDIKSLSIAR"
FT   CDS             503304..503852
FT                   /transl_table=11
FT                   /locus_tag="SpyM50466"
FT                   /product="sigma 54 modulation protein / S30EA ribosomal
FT                   protein"
FT                   /db_xref="GOA:A2RD83"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD83"
FT                   /protein_id="CAM29808.1"
FT                   /translation="MIKFSIRGENIEVTEAIRDYVESKLTKIEKYFAKDQEIDARVNLK
FT                   VYRERSSKVEVTIPLDSVTLRAEDVSQDMYGSIDLVVDKIERQIRKNKTKIAKKHREKV
FT                   PTGQVFTTEFEAEEVDEIPEVQVVRTKNVTLKPMDVEEARLQMELLGHDFFIYTDSEDG
FT                   ATNILYRREDGNLGLIEAK"
FT   misc_feature    503310..503600
FT                   /locus_tag="SpyM50466"
FT                   /note="HMMPfam hit to PF02482, Sigma 54 modulation protein
FT                   / S30EA r, score 3.9e-33"
FT                   /inference="protein motif:HMMPfam:PF02482"
FT   rRNA            504768..506274
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT   tRNA            506361..506433
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT                   /anticodon="(pos:506394..506396,aa:Ala)"
FT   rRNA            506732..509632
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT   rRNA            509720..509835
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT   tRNA            509853..509925
FT                   /gene="tRNA-Val (TAC)"
FT                   /product="transfer RNA-Val (TAC)"
FT                   /anticodon="(pos:509886..509888,aa:Val)"
FT   tRNA            509943..510015
FT                   /gene="tRNA-Asp (GTC)"
FT                   /product="transfer RNA-Asp (GTC)"
FT                   /anticodon="(pos:509976..509978,aa:Asp)"
FT   tRNA            510047..510119
FT                   /gene="tRNA-Lys (TTT)"
FT                   /product="transfer RNA-Lys (TTT)"
FT                   /anticodon="(pos:510080..510082,aa:Lys)"
FT   tRNA            510125..510206
FT                   /gene="tRNA-Leu (TAG)"
FT                   /product="transfer RNA-Leu (TAG)"
FT                   /anticodon="(pos:510159..510161,aa:Leu)"
FT   tRNA            510217..510289
FT                   /gene="tRNA-Thr (TGT)"
FT                   /product="transfer RNA-Thr (TGT)"
FT                   /anticodon="(pos:510250..510252,aa:Thr)"
FT   tRNA            510325..510398
FT                   /gene="tRNA-Ile (GAT)"
FT                   /product="transfer RNA-Ile (GAT)"
FT                   /anticodon="(pos:510359..510361,aa:Ile)"
FT   tRNA            510421..510492
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu (TTC)"
FT                   /anticodon="(pos:510454..510456,aa:Glu)"
FT   CDS             complement(join(510873..511025,511025..511258))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50467"
FT                   /note="Similar to Streptococcus pyogenes (serotype M18)
FT                   hypothetical protein spym18_1619 UniProt:Q8P014
FT                   (EMBL:AE010074) (128 aa) fasta scores: E()=9.2e-43,92.188%
FT                   id in 128 aa, and to the N-terminal region of Lactobacillus
FT                   delbrueckii (subsp. lactis) putative transposase ISldl4
FT                   UniProt:Q937G2 (EMBL:LDE316615) (406 aa) fasta scores:
FT                   E()=9.4e-10, 42.857% id in 105 aa. CDS contains a
FT                   frameshift after codon 78. Frameshift occurs at a poly T
FT                   hexamer"
FT                   /db_xref="PSEUDO:CAM29809.1"
FT   CDS             complement(511373..511498)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50468"
FT                   /product="hypothetical protein"
FT                   /note="Possible gene remnant. Similar to the C-terminal
FT                   region of SpyM51517, 60.976% identity (71.429% ungapped) in
FT                   41 aa overlap"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD85"
FT                   /protein_id="CAM29810.1"
FT                   /translation="MFFVVVKVASMLVLTPLGIFEPRISKIRHGIPKEVAALSTT"
FT   CDS             complement(511630..512163)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /protein_id="CAM29811.1"
FT                   /translation="MKLPKEGDFITIQSYKHDGSLHRTWRDTMVLKTTENALIGVNDHT
FT                   LVTESDGRRWVTREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYMMDTEALKYIDY
FT                   DLDVKVFADGEKRLLDVDEYEIHKKEMQYSADMDFILKENVKILVDWINHEKGPFSKAY
FT                   ITIWYKRYLELKNR"
FT   misc_feature    complement(511762..512055)
FT                   /locus_tag="SpyM50469"
FT                   /note="HMMPfam hit to PF04167, Protein of unknown function
FT                   (DUF402), score 9.3e-40"
FT                   /inference="protein motif:HMMPfam:PF04167"
FT   CDS             complement(512243..513019)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50470"
FT                   /product="RecX family protein"
FT                   /db_xref="GOA:A2RD87"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR011991"
FT                   /protein_id="CAM29812.1"
FT                   /translation="MKITKIEKKKRLYLIELDNDDSLYVTEDTIVRFMLSKDKVLDNDQ
FT                   LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIEEHIIPDIITQLQEEQWID
FT                   DTKLADTYIRQNQLNGDKGPQVLKQKLLQKGIASHDIDPILSQTDFSQLAQKVSQKLFD
FT                   KYQEKLPPKALKDKITQALLTKGFSYDLAKRSLNHLNFDQDNQEIEDLLDKELDKQYRK
FT                   LSRKYDGYTLKQKLYQALYRKGYNSDDINCKLRNYL"
FT   misc_feature    complement(512402..512782)
FT                   /locus_tag="SpyM50470"
FT                   /note="HMMPfam hit to PF02631, RecX family, score 4.8e-10"
FT                   /inference="protein motif:HMMPfam:PF02631"
FT   misc_feature    513060..554532
FT                   /note="prophage phiMan.1"
FT   CDS             complement(513249..514334)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50471"
FT                   /product="putative integrase"
FT                   /db_xref="GOA:A2RD88"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="InterPro:IPR028259"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD88"
FT                   /protein_id="CAM29813.1"
FT                   /translation="MKYNKTKYPNIFWYITLKGKRYYIRRGYYLNGEKKEATESGIKTI
FT                   QEARLLLAEIERKIENNEFAYNKNLTVDEYWDIYVDNRLKAGVWSPDTYVERTNIFKNH
FT                   ISPKFGNKKMNAINRIEYENYINNLLNTNSRSTVKHIYDVFSIMLNHAVKNKMLDDNII
FT                   KFIDIGDSEIKPINKRRSMQEFKAWDKVARKMLDDYDYAMVRITYLGLRRSEVAGIKLG
FT                   NITFNDKDCAVVKIDESRTRGRKDGGGLKTAYSERYVYLDFETSQLLKKAIDTSIKIAV
FT                   CNDRILNKADFLFLGDDEKVKPSFVGKPIGSHYIYCLFKKINKNCDVHFTPHMMRHFFC
FT                   YTGPNSRCPNRAYGSGFRSFK"
FT   misc_feature    complement(513258..513806)
FT                   /locus_tag="SpyM50471"
FT                   /note="HMMPfam hit to PF00589, Phage integrase family,score
FT                   0.0036"
FT                   /inference="protein motif:HMMPfam:PF00589"
FT   CDS             complement(514516..515937)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50472"
FT                   /product="phage membrane protein"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR025280"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD89"
FT                   /protein_id="CAM29814.1"
FT                   /translation="MKKSDGLPFYFRFWFILIIILLYPFTYGISILFGLGLFLQRQKTY
FT                   PNLTPSQQKKWNEIKESEIEASAIKNDAYERAAEIKNEASKIAIKTEEEAVKKFNTLVS
FT                   SGEAKKQNLENDIKSLSSQKKEIEFFIEENSDKSLLSQTTVDFTDNVTSNEIKNELSIV
FT                   QLNEKELIKLGIAVNSLGATTKVNIAKQSKQLLRAFNAESDYYLSNITIKNVDTYRNKL
FT                   AKTFETLNKLFEIDGVKISKELLTSKLKQLDILYKYQKQIEIEKELLKAQKEEIREQQK
FT                   AEKDIQQAKAKLEKEERQFNNEMSKLLKYLNGAQNEIEQQIYADKIKELEDKIKELEKD
FT                   KEDVLKRESNTRAGYVYIISNIGSFGENVYKIGMTRRLEPMDRINELSSASVPFPFDVH
FT                   ALIFSEDAPALESTLHNYFRNKEVNKVNPRKEFFKVDLQEIKEVVLKEHNNTVHFTDLA
FT                   VAEQYYESIKKDVVI"
FT   misc_feature    complement(515833..515901)
FT                   /locus_tag="SpyM50472"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50472 by TMHMM2.0 at aa 13-35"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(515952..516320)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50473"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD90"
FT                   /protein_id="CAM29815.1"
FT                   /translation="MLSKYNIKLFEFPDTMWKMSGFYYPDLRIIYVNQNLSQIEKEKVI
FT                   LHELGHIEHDPKQYQRLLLKYENQADRFMIRELIKNYLSSHDVVDFNWLQFATTYQIST
FT                   TWGQKMIQDEFYKIVSGS"
FT   misc_feature    complement(515985..516317)
FT                   /locus_tag="SpyM50473"
FT                   /note="HMMPfam hit to PF06114, Domain of unknown function
FT                   (DUF955), score 5.6e-24"
FT                   /inference="protein motif:HMMPfam:PF06114"
FT   CDS             complement(516322..516663)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50474"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:A2RD91"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD91"
FT                   /protein_id="CAM29816.1"
FT                   /translation="MDEKDLKRIIESRYNSVRAFAIENDIPYTTMRSILERGVMNAKAE
FT                   TIFKICDILGINPESFAEEKTDWQATIDLSNLREKVVMFDGKPLSDKDVEKIEAIIKIS
FT                   LGVGNGEDK"
FT   CDS             516846..517073
FT                   /transl_table=11
FT                   /locus_tag="SpyM50475"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:A2RD92"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD92"
FT                   /protein_id="CAM29817.1"
FT                   /translation="MERNDMKNIEHIRKEKGVSLVDIADCLRLKSQTVREKINGDSDFK
FT                   FGEALKVQQTFFPEFDIVYLFKERKESSVG"
FT   CDS             517101..517820
FT                   /transl_table=11
FT                   /locus_tag="SpyM50476"
FT                   /product="putative phage antirepressor protein"
FT                   /db_xref="GOA:A2RD93"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD93"
FT                   /protein_id="CAM29818.1"
FT                   /translation="MNHLINVTLNENQEPVVSARDLHKELKVKTRFSEWVKQNFKILEE
FT                   GYDFTSVVGTTVVNNGAVREIQDYVLSLDAAKNLAMVSKTDKGKEVRKYFIQVEKDFNS
FT                   PEKIMARALLMADKKVHKLEAQIEADRPKVLFADAVEASETSILIGDFAKILRQNGYNI
FT                   GQNRLFAWLRENGFLIRKNGESYNMPTQRSMDMKLFEVKERTHQEPNGSIRISKTTKMT
FT                   GKGQQYFINKFLNEKVG"
FT   misc_feature    517413..517817
FT                   /locus_tag="SpyM50476"
FT                   /note="HMMPfam hit to PF03374, Phage antirepressor protein,
FT                   score 4.1e-84"
FT                   /inference="protein motif:HMMPfam:PF03374"
FT   CDS             complement(517918..518157)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50477"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD94"
FT                   /protein_id="CAM29819.1"
FT                   /translation="MDTKEFMKVVSKHINQNFNVDNQLVEFVVAELNQMNAPITQKQAQ
FT                   HIVNILEYVSKSTSKSTIAAMTNALLELGVLKGD"
FT   CDS             518324..518509
FT                   /transl_table=11
FT                   /locus_tag="SpyM50478"
FT                   /product="putative DNA-binding phage protein"
FT                   /db_xref="GOA:A2RD95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD95"
FT                   /protein_id="CAM29820.1"
FT                   /translation="MWGKIEALLIEKKMTKYELSQKAGLNQNCLIDLKKGRKKSLKFDD
FT                   VVKIADVLGVSLDEFR"
FT   misc_feature    518336..518503
FT                   /locus_tag="SpyM50478"
FT                   /note="HMMPfam hit to PF01381, Helix-turn-helix, score
FT                   1.7e-08"
FT                   /inference="protein motif:HMMPfam:PF01381"
FT   misc_feature    518363..518428
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1225.000, SD 3.36 at aa 14-35, sequence
FT                   MTKYELSQKAGLNQNCLIDLKK"
FT   CDS             518580..518831
FT                   /transl_table=11
FT                   /locus_tag="SpyM50479"
FT                   /product="putative DNA binding phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD96"
FT                   /protein_id="CAM29821.1"
FT                   /translation="MDNILMSLSDWIKEFIEKTVNKLVQMKLDELNAELWTREKVAERL
FT                   NMSPSTFDKYYRRDKNFPKELPAVRWKKAEIIAWLNNK"
FT   misc_feature    518685..518750
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1928.000, SD 5.75 at aa 36-57, sequence
FT                   WTREKVAERLNMSPSTFDKYYR"
FT   CDS             518862..518999
FT                   /transl_table=11
FT                   /locus_tag="SpyM50480"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD97"
FT                   /protein_id="CAM29822.1"
FT                   /translation="MKLLDFIFAKPKKQEPIKHDTLRASSEKQWAEFDAYMRKQYGRQA
FT                   "
FT   CDS             519093..519809
FT                   /transl_table=11
FT                   /locus_tag="SpyM50481"
FT                   /product="putative phage replication protein"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD98"
FT                   /protein_id="CAM29823.1"
FT                   /translation="MHIDEVKNNQFYQFPQWLLKEPYNVLSDKAKLIYMLLFDRRTLSV
FT                   ENKWFDDDGKVYMYFTNEQFMELLKCSNKTVVKAKKELHDLSLLREVRQGINKPNRLYI
FT                   NGSVESTLQDVYKLHTINTNIINTNISNYYDDKGTSFLEEIENLWGRQFNGYEVQQINR
FT                   FLLEEHISNDLLKKAIETSLANGARNMNYVSAVINNWIDSGITTVEQVDAAQELRLKQK
FT                   SKTNSKDEEVSEYDTW"
FT   misc_feature    519117..519341
FT                   /locus_tag="SpyM50481"
FT                   /note="HMMPfam hit to PF06970, Replication initiator
FT                   protein A (RepA) N-ter, score 1e-36"
FT                   /inference="protein motif:HMMPfam:PF06970"
FT   misc_feature    519513..519731
FT                   /locus_tag="SpyM50481"
FT                   /note="HMMPfam hit to PF04271, DnaD-like domain, score
FT                   1.2e-13"
FT                   /inference="protein motif:HMMPfam:PF04271"
FT   CDS             519796..520578
FT                   /transl_table=11
FT                   /locus_tag="SpyM50482"
FT                   /product="putative phage DNA replication protein"
FT                   /db_xref="GOA:A2RD99"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RD99"
FT                   /protein_id="CAM29824.1"
FT                   /translation="MILGDEDALAKIAISYQQNTKKQDAVCEKHGCRYITVLKTGLTVC
FT                   PDCHREELDNQNTLHVQKQYERELENKRLYYLKKLSIMDDELENASFDNFRADTAKHKE
FT                   VLYWAKTMANDWFSGGKGNIIMTGKAGRGKSHLAYSIIRGLSDKTKKLGLLVNVTDLLS
FT                   EIKRDFSKEAFWMDKLKDVDYLVLDDLGAEKVSDWSTSIIYSLLNKRTNTIITTNLTPA
FT                   EIRKIYGERIASRIRKGCDKSHIMEFDGMEDERMKLWN"
FT   misc_feature    520177..520200
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             520569..520706
FT                   /transl_table=11
FT                   /locus_tag="SpyM50483"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA0"
FT                   /protein_id="CAM29825.1"
FT                   /translation="MELTLTTFFGLSEEHAAKIMALDEDVRTKKIEELRAWRECSKVTF
FT                   "
FT   CDS             520719..521072
FT                   /transl_table=11
FT                   /locus_tag="SpyM50484"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA1"
FT                   /protein_id="CAM29826.1"
FT                   /translation="MVMPLDELEKRIFCYLPIGSNMMVNSKEICRTFDIKDPKTLRDII
FT                   HGMVMKGYLIGSSRRKGGGYYLIDNDDERAEAISSLESQVRKEQKRINILKNGNLNEFV
FT                   EIANEVRNGWNQN"
FT   CDS             521053..521307
FT                   /transl_table=11
FT                   /locus_tag="SpyM50485"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA2"
FT                   /protein_id="CAM29827.1"
FT                   /translation="MVGIRINGELVTFDSNFRDALIFTIDCLRGSEEPTLKQTYQTFKD
FT                   YTDEDLMDYIETEFDVWPELIVNRKIDSKWSTKQHILDD"
FT   CDS             521329..521811
FT                   /transl_table=11
FT                   /locus_tag="SpyM50486"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR008840"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA3"
FT                   /protein_id="CAM29828.1"
FT                   /translation="MAYLYELEGIAAYLESLDLDDETFQNTLDSIDFQSDLENTIEYFV
FT                   KMLKNAQADVEMYKAEKEAFYKKQKQAEAKVEKYKETIRRAMELSQKKKVDAGMFKVSL
FT                   RKSKKVEILDETKIPLDYMQEKIEYKPMKSEISKALKSGIDISGVELIETESLQVK"
FT   misc_feature    521332..521808
FT                   /locus_tag="SpyM50486"
FT                   /note="HMMPfam hit to PF05565, Siphovirus Gp157, score
FT                   2.2e-84"
FT                   /inference="protein motif:HMMPfam:PF05565"
FT   CDS             join(521812..522477,522477..522485)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50487"
FT                   /note="Similar to Streptococcus pyogenes (serotype M3)
FT                   putative recombination protein UniProt:Q79XW0
FT                   (EMBL:BA000034) (224 aa) fasta scores: E()=1.1e-75,97.768%
FT                   id in 224 aa. CDS contains a frameshift after codon 222.
FT                   Frameshift occurs at a poly A pentamer"
FT                   /db_xref="PSEUDO:CAM29829.1"
FT   misc_feature    521839..522303
FT                   /locus_tag="SpyM50487"
FT                   /note="HMMPfam hit to PF04404, ERF superfamily, score
FT                   2.4e-35"
FT                   /inference="protein motif:HMMPfam:PF04404"
FT   CDS             522478..522903
FT                   /transl_table=11
FT                   /locus_tag="SpyM50487"
FT                   /product="single-strand binding protein"
FT                   /note="Similar to Streptococcus agalactiae (serotype V).
FT                   Single-strand binding protein 3 Ssb3 UniProt:SSB3_STRA5
FT                   (EMBL:AE014217) (138 aa) fasta scores: E()=6.1e-42,80.851%
FT                   id in 141 aa"
FT                   /db_xref="GOA:A2RDA5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA5"
FT                   /protein_id="CAM29830.1"
FT                   /translation="MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGERE
FT                   ADFINCVIWRQSAENLANWAKKGALIGVTGRIQTRNYENQQEQRVYVTEVVAESFQMLE
FT                   SRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF"
FT   misc_feature    522481..522789
FT                   /locus_tag="SpyM50487"
FT                   /note="HMMPfam hit to PF00436, Single-strand binding
FT                   protein family, score 8.9e-34"
FT                   /inference="protein motif:HMMPfam:PF00436"
FT   CDS             522909..523112
FT                   /transl_table=11
FT                   /locus_tag="SpyM50488"
FT                   /product="putative phage DNA-binding protein"
FT                   /db_xref="GOA:A2RDA6"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA6"
FT                   /protein_id="CAM29831.1"
FT                   /translation="MANRYRQRIYAVYDGDSFVDVGTKHELAERLGVTADTIVFIASPA
FT                   HKKRRPDGRHAEFIGYEDELEE"
FT   misc_feature    522972..523037
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1037.000, SD 2.72 at aa 22-43, sequence
FT                   GTKHELAERLGVTADTIVFIAS"
FT   CDS             523112..523552
FT                   /transl_table=11
FT                   /locus_tag="SpyM50489"
FT                   /product="putative phage endodeoxyribonuclease"
FT                   /db_xref="GOA:A2RDA7"
FT                   /db_xref="InterPro:IPR008822"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA7"
FT                   /protein_id="CAM29832.1"
FT                   /translation="MVKFIIPIEPKPQKRPRFSRWSGAYEDGDMMAWRKQVTDYVKNNY
FT                   EGPYFDDGLKVDVTFYLKAPELVSKKPSERAKDKTKQKYQDYINELLYVPKKPDLDNLE
FT                   KAVYDSISKSEVVWTDDNIIVEHTTRKLYSPNPRIEVKINEL"
FT   misc_feature    523127..523549
FT                   /locus_tag="SpyM50489"
FT                   /note="HMMPfam hit to PF05866, Endodeoxyribonuclease
FT                   RusA,score 1.6e-63"
FT                   /inference="protein motif:HMMPfam:PF05866"
FT   CDS             523549..523905
FT                   /transl_table=11
FT                   /locus_tag="SpyM50490"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA8"
FT                   /protein_id="CAM29833.1"
FT                   /translation="MTLVDDFYKQMEPSIKAFLDDNITIADKEEADRVYRSVKYYKKLN
FT                   RLPPPDVLEWFQRIYTTKEMIMLIKQSYRLKQKKTDEDDKIYEKWMFKNYGDVKLVKKI
FT                   KRTDALERARRMGL"
FT   CDS             523902..524147
FT                   /transl_table=11
FT                   /locus_tag="SpyM50491"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDA9"
FT                   /protein_id="CAM29834.1"
FT                   /translation="MKRHRQWHNDIKYTPRSYDNLLPYDISELLIAHRCKIKMSDDVLA
FT                   DKIGIYTWQLKALLERRILPNESVCKTIVNYLREVE"
FT   CDS             524147..524383
FT                   /transl_table=11
FT                   /locus_tag="SpyM50492"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR021739"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB0"
FT                   /protein_id="CAM29835.1"
FT                   /translation="MIEELVHKPKHYNHGEIDLIESWYKTYPWDQFVAIMESHIDKYIK
FT                   RHRYKGNATQDLEKALEYTKRLIEYWLIESVEE"
FT   CDS             524380..524550
FT                   /transl_table=11
FT                   /locus_tag="SpyM50493"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB1"
FT                   /protein_id="CAM29836.1"
FT                   /translation="MKRYIEVKDEWKSATDHLNDFIDKNKYAKVTVVGYQVVQLSPYGR
FT                   DLTYILAEVEE"
FT   CDS             524547..524831
FT                   /transl_table=11
FT                   /locus_tag="SpyM50494"
FT                   /product="putative phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB2"
FT                   /protein_id="CAM29837.1"
FT                   /translation="MTIDEALQNLRDNFNKIMNVLKNDWKALLFLAIAIFGMMVTVSYF
FT                   SYRDARQYYESQITGLRTQLSRTQKQLKRASEDRARQTKRIAEFTHNGG"
FT   misc_feature    524628..524687
FT                   /locus_tag="SpyM50494"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50494 by TMHMM2.0 at aa 28-47"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             524833..525465
FT                   /transl_table=11
FT                   /locus_tag="SpyM50495"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:A2RDB3"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB3"
FT                   /protein_id="CAM29838.1"
FT                   /translation="MIKIDEIHRILGIDEVYKAPKRLTDILFDKDSREDIFRQFLKYET
FT                   DVSYDWFMQYFEEEQADRKNKKQDFTPKSVSTLLSKIISGNQYYEVAVGTGGILIQAWQ
FT                   EQRLNDSPFTYRPSKYWYHVEELSDKAVPFLLFNMSIRGINGVVVHGDSLTRQVKNIYF
FT                   LQNTKDDMLSFSDINVMPRTQDIEQEFNVKEWIGDAIVHVESKLNAR"
FT   CDS             525470..525949
FT                   /transl_table=11
FT                   /locus_tag="SpyM50496"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR012865"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB4"
FT                   /protein_id="CAM29839.1"
FT                   /translation="MNIEEAIKKIRELEAFNYFDFKGNLIRRIDVLGIIDQLKIIVQQC
FT                   VADWYEKHKDNLEYDLYLYQMSIYDEKVEEDDFYYWMQKSKNPVRTLINMHQFGYEIEQ
FT                   EQLYTVDLPNGQPLVRGKNTLYFSQNLTAENAKLTESEIRKDFEWAWQFAKEVTE"
FT   CDS             525946..526116
FT                   /transl_table=11
FT                   /locus_tag="SpyM50497"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB5"
FT                   /protein_id="CAM29840.1"
FT                   /translation="MTEELGVLYSEKWHKYYLYKTCRYISYVDNPHQATKCTRKQAEQF
FT                   PQFKWVSLTKL"
FT   CDS             526233..526358
FT                   /transl_table=11
FT                   /locus_tag="SpyM50498"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB6"
FT                   /protein_id="CAM29841.1"
FT                   /translation="MIIQGVANALTRHRAPVSKNKGKRGLFSTKQKDVHTERPLG"
FT   CDS             526400..526834
FT                   /transl_table=11
FT                   /locus_tag="SpyM50499"
FT                   /product="putative autolysin regulatory protein"
FT                   /db_xref="InterPro:IPR006524"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB7"
FT                   /protein_id="CAM29842.1"
FT                   /translation="MTFFPEIDIQKTKSNAKRKLREYPRWRRIANDVDTQKVTATYSFE
FT                   PRQPYGTPSKPVERLALNRVSAEQELDAIEQAVSMILEPERRRILYDKYLAPYKKADKV
FT                   IYTELCMSESFYYDTLDIALLSFAELYREGVLLVEEGVFS"
FT   CDS             526983..527177
FT                   /transl_table=11
FT                   /locus_tag="SpyM50500"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDB8"
FT                   /protein_id="CAM29843.1"
FT                   /translation="MGRAGSNPAVSITQRLHAVTLRNVIKAKRITELCDVRRELTPLFD
FT                   IGVPLRRIRNLGSVLMIKT"
FT   CDS             join(527468..528397,528401..528634)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50501"
FT                   /EC_number="2.1.1.72"
FT                   /note="Highly similar to Streptococcus pyogenes
FT                   hypothetical protein spy0679. UniProt:Q9A0P6
FT                   (EMBL:AE006521) (388 aa) fasta scores: E()=2.2e-149,99.227%
FT                   id in 388 aa. CDS contains a nonsense mutation (opal) after
FT                   codon 310"
FT                   /db_xref="PSEUDO:CAM29844.1"
FT   misc_feature    527477..527734
FT                   /locus_tag="SpyM50501"
FT                   /note="HMMPfam hit to PF02195, ParB-like nuclease
FT                   domain,score 1.5e-21"
FT                   /inference="protein motif:HMMPfam:PF02195"
FT   misc_feature    528014..528034
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00092"
FT   misc_feature    528137..528592
FT                   /locus_tag="SpyM50501"
FT                   /note="HMMPfam hit to PF01555, DNA methylase, score
FT                   2.3e-08"
FT                   /inference="protein motif:HMMPfam:PF01555"
FT   CDS             528978..529454
FT                   /transl_table=11
FT                   /locus_tag="SpyM50504"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC0"
FT                   /protein_id="CAM29845.1"
FT                   /translation="MANEDNLIPNSKRTPSELREIAKKGGIASGKARREKANLRKAVEL
FT                   VLGSTVPSALLREQLEQLDISPTNQSAIALKLVENALKGDVRSAELLAKITTTEVKDSL
FT                   DRKEQRQRIKAAELATDEQRTRIELLKVKLDAEKGAKPDTSLMRALLDAVEGGD"
FT   CDS             529537..530748
FT                   /transl_table=11
FT                   /locus_tag="SpyM50505"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="GOA:A2RDC1"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC1"
FT                   /protein_id="CAM29846.1"
FT                   /translation="MTPRSGKTTAGHFRYARYLIESEDENHLVTAYNQEQAYRLFIDGD
FT                   GTGLMHIFDGNCEIKHDERGDHLLITTPKGNKRVYYKGGGKVNSVGAITGMSLGSVVFC
FT                   EINLLHMDFIQECFRRTWAAKLRYHLADLNPPAPQHPVIKDVFDVQNTRWTHWTMDDNP
FT                   ILTAERKQNIINSLKKNPYLYKRDVLGQRVMPQGVIYGLFDTEKNVLDALIGEPVEMYF
FT                   CADGGQSDATSMSCNIVTRVRDNGRISFRLNRVAHYYHSGADTGQVKAMSTYALELKVF
FT                   IDWCVKKYQMRYTEVFVDPACKSLREELHKLGVFTLGAPNNSKDVSSKAKGIEVGIERG
FT                   QNIISDGAFYLVNHSEEEYDHYHFLKEIGLYSRDDNGKPIDKDNHAMDEFRYSVNVFVH
FT                   RYYN"
FT   misc_feature    529537..530253
FT                   /locus_tag="SpyM50505"
FT                   /note="HMMPfam hit to PF03237, Protein of unknown function
FT                   DUF264, score 2.4e-06"
FT                   /inference="protein motif:HMMPfam:PF03237"
FT   CDS             530762..532264
FT                   /transl_table=11
FT                   /locus_tag="SpyM50506"
FT                   /product="putative minor capsid protein"
FT                   /db_xref="InterPro:IPR006432"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC2"
FT                   /protein_id="CAM29847.1"
FT                   /translation="MGVIQKIKNLVTRSKYVMTTQSLTNITDHPKIAISKLEYDRITTN
FT                   LKYYKSDWDSVLYLNTDGETKKRDLNHLPIARTAAKKIASLVFNEQAEIKVDDDAANEF
FT                   ISETLKNDRFNKNFERYLESCLALGGLAMRPYVDGDKVRVAFVQAPVFLPLQSNTQDVS
FT                   SAAVVIKSVKTINGKEVYYTLIEFHEWQSSDDYVISNELYRSDDKAKVGSRVPLSEVYK
FT                   DLKDEAKVTDVTRPIFTYLKTPGMNNKDINSPLGLSIFDNAKTTIDFINTTYDEFMWEV
FT                   KMGQRRVAVPESLTALTVRTADGDVVPRPRFESDQNVYIRMGGRDLDSSAIQDLTTPIR
FT                   ADDYIKAINEGLSLFEMQIGVSAGLFSFDGKSMKTATEIVSENSDTYQMRNSIVTLVEQ
FT                   SLKELVISIFEIAKAYDLYQSEVPSMDNISISLDDGVFTDRDAELDYWIKVVNAGFGTR
FT                   EMAIQKVLNVTEEKAQEIAAEINTGIVDEINQQRTDTHLYGE"
FT   misc_feature    530804..532231
FT                   /locus_tag="SpyM50506"
FT                   /note="HMMPfam hit to PF05126, Phage minor capsid
FT                   protein,score 0"
FT                   /inference="protein motif:HMMPfam:PF05126"
FT   CDS             join(532269..532769,532773..533762)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50507"
FT                   /note="Similar to Bacteriophage phig1e minor capsid protein
FT                   rorf347 SWALL:O03929 (EMBL:X98106) (347 aa) fasta scores:
FT                   E(): 6.2e-22, 29.73% id in 333 aa. CDS contains a nonsense
FT                   mutation (ochre) after codon 167"
FT                   /db_xref="PSEUDO:CAM29848.1"
FT   misc_feature    532269..533360
FT                   /locus_tag="SpyM50507"
FT                   /note="HMMPfam hit to PF06152, Phage minor capsid
FT                   protein,score 9.1e-242"
FT                   /inference="protein motif:HMMPfam:PF06152"
FT   CDS             533762..533989
FT                   /transl_table=11
FT                   /locus_tag="SpyM50509"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC4"
FT                   /protein_id="CAM29849.1"
FT                   /translation="MKLKSILNDSQIDFVKNELPGLPVDIDVNSEKYDVFCEGIETYYQ
FT                   TESFDEKYNITAKGKLAESIIDLLTDKGYW"
FT   CDS             534076..534342
FT                   /transl_table=11
FT                   /locus_tag="SpyM50510"
FT                   /product="putative secreted phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC5"
FT                   /protein_id="CAM29850.1"
FT                   /translation="MNKRIKKKRKLETAVVMLVAENATQVEAIKNQNKQIMELKSIVQR
FT                   NALATNEELATVKAATLDNQSVIKAIGDTVDYIKKNYKRKWGK"
FT   sig_peptide     534076..534159
FT                   /locus_tag="SpyM50510"
FT                   /note="Signal peptide predicted for SpyM50510 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.992) with cleavage
FT                   site probability 0.623 between residues 28 and 29"
FT                   /inference="protein motif:SignalP:2.0"
FT   CDS             534468..535082
FT                   /transl_table=11
FT                   /locus_tag="SpyM50511"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC6"
FT                   /protein_id="CAM29851.1"
FT                   /translation="MHMENVTNENVDQETTDLENNQQEDKAFTQDDLNRVGTKEHSKGY
FT                   NKAVKDLGFDDVESAKDALKAFQEWQESQRSESEKQTEILNAKDKELEEARANNKALNA
FT                   KLAAMSLGVNAESIDDVIALSERLVTDETSMEDAIKTVLGKYPHFGQTKDKAPKITVAG
FT                   NPSADNGQGSVSKEDFSKMSYQEKLNLKLKNKSLYDQLKGN"
FT   CDS             535086..535904
FT                   /transl_table=11
FT                   /locus_tag="SpyM50512"
FT                   /product="putative major head protein"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC7"
FT                   /protein_id="CAM29852.1"
FT                   /translation="MAVGTTKMAQMLDPEVLADMIDAEVGKAIRFAPLAEVDTTLEGQP
FT                   GTTLTVPKWDYIGDAEDVAEGEAIPMTQLGFKKTTMTIKKAGKGVEITDEAILSGYGDP
FT                   VGQAAKQIVEAIDHKVDADVLDALSKSTQTVEATATVDGVSKALDIFNDEDDAETVIVM
FT                   NPADASTLRLDAAKEWLGATEVGANRVVSGVYSEVLGVQIVRSRKCPKGTAYMVRKGAL
FT                   RIMLKRNTMVETDRDITKAINQIVANKHYGVYLYKAEKAVKITLKDAAKK"
FT   CDS             535958..536374
FT                   /transl_table=11
FT                   /locus_tag="SpyM50513"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC8"
FT                   /protein_id="CAM29853.1"
FT                   /translation="MEVVIIAFLTQKEFEDLGFDDVEDFEKMEKRASHAVNLYCRNRYD
FT                   YKDLKKEIVLVQKAVKRAIAYQIAYLNDSGVMTAEDKQSFAGISLGRTSISYTVGHGQG
FT                   SQQKTLADRFNLCLDAENELLAVGLGYTGISYDR"
FT   CDS             536364..536696
FT                   /transl_table=11
FT                   /locus_tag="SpyM50514"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR019612"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDC9"
FT                   /protein_id="CAM29854.1"
FT                   /translation="MIDKRLLIDELQVKLVKDKGDYGGFVYDGPFTLSPVRFDRNLATA
FT                   GKDNARQETKPSVIFIYPKYCKTVADRSWVDAVVIDGDTEYTVDKVIPVYHPLTNKIFC
FT                   FEVEVI"
FT   CDS             536696..537052
FT                   /transl_table=11
FT                   /locus_tag="SpyM50515"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR021080"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD0"
FT                   /protein_id="CAM29855.1"
FT                   /translation="MAKVVVELGGIKRKVSPQALAKGKLIMNNQVMMSMNPYVPYRDGA
FT                   LRGSSRANSVGVTWSGPHARAQFYGGAYNKYKSFKFKKYTTPGTGKRWDKRALANATIV
FT                   KDWEKSLLRGMGFK"
FT   CDS             537049..537447
FT                   /transl_table=11
FT                   /locus_tag="SpyM50516"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR024411"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD1"
FT                   /protein_id="CAM29856.1"
FT                   /translation="MTNDFATVLRQFVEGLDLGIKPRLDYLTRQEDLAIYPMPGGKVNN
FT                   EYMDGTREISLPFEIAIKTKNQELASTVMWTINSALSNFDLKLPSLNHSYTFTSLDVEK
FT                   PFLNDLSDQGFYIYVLDITAHLEIEGKN"
FT   CDS             537447..537908
FT                   /transl_table=11
FT                   /locus_tag="SpyM50517"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD2"
FT                   /protein_id="CAM29857.1"
FT                   /translation="MARQKNALRGHFIAPYNAGVEPEAKGSEWMEIAKWIKDISDDTDE
FT                   KTEDEAYYDGDGTEETTVVGVKGAYTFEGTYDPEDKAQKHIADMKYKTGEGRKVWHKVV
FT                   ASDNKKQWIGLSTVSEIIAGSGAAADFEAFSCKITYNSLPKESVPSEVL"
FT   CDS             537952..538386
FT                   /transl_table=11
FT                   /locus_tag="SpyM50518"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD3"
FT                   /protein_id="CAM29858.1"
FT                   /translation="MSEIIVDLKRTGFPVKIGQVELWFDTSQERLIEFFDIETEVNRRL
FT                   NEYEKQVIEANLDNEIEDKGVTKDVAQSALDLEAKYLEINYDLLFGEGTFAQLYAEYPD
FT                   KEALENTLEIVCREIEVKLKELAIEREKIVKQKTKKYKKE"
FT   misc_feature    538024..538062
FT                   /note="PS00018 EF-hand calcium-binding domain"
FT                   /inference="protein motif:Prosite:PS00018"
FT   CDS             538390..538971
FT                   /transl_table=11
FT                   /locus_tag="SpyM50519"
FT                   /product="putative phage Gp15 protein"
FT                   /db_xref="InterPro:IPR009660"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD4"
FT                   /protein_id="CAM29859.1"
FT                   /translation="MKLNDPLVESFEFRGEIYSINLSFNKVLDVFDVIDDDFLNEAEKC
FT                   FLCLDILLDRTDLPFSYAVDLWIHIKKNYIDTKKPEKPQLDIKGNPMPVVKEKEDNKKV
FT                   IDLSLDAEFIYASFRQAYQINLLKEQNRLSWIEFKALLNALPDDTVMQRIIAIRQWEDD
FT                   GEGSKKYRDNMRKLKAKYSLDDGEEEDDGS"
FT   misc_feature    538393..538938
FT                   /locus_tag="SpyM50519"
FT                   /note="HMMPfam hit to PF06854, Bacteriophage Gp15
FT                   protein,score 2.6e-136"
FT                   /inference="protein motif:HMMPfam:PF06854"
FT   CDS             join(538961..539554,539558..542215)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50521"
FT                   /note="Highly similar to Streptococcus pyogenes (serotype
FT                   M3) putative minor tail protein-phage associated (putative
FT                   tail protein) UniProt:Q8K6Q1 (EMBL:AE014160) (1086 aa)
FT                   fasta scores: E()=0, 99.355% id in 1086 aa. CDS contains a
FT                   nonsense mutation (opal) after codon 198"
FT                   /db_xref="PSEUDO:CAM29860.1"
FT   CDS             542212..542928
FT                   /transl_table=11
FT                   /locus_tag="SpyM50522"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD6"
FT                   /protein_id="CAM29861.1"
FT                   /translation="MTAFIKFDGKKSSDFDLRIINDVEHDSSFYDVDQVKVPGRDGVVL
FT                   KDNKRLEAIERSYPLRLYSKRRLTEVETDISNWLNVKGWKDLELSWEPDYIYKATHITP
FT                   FSIKEVLRNFGRLKINFLIHPIKYLKTGKQKVTLVNGGTLQNPGNVQAKPILKIKGTGN
FT                   GVLTINDFETGLENVQGELVIDMERHLVYKDVLSAWDNIVRTERHRMPLFDVGQNKISW
FT                   TGSFTITAVPNWGVKV"
FT   CDS             542925..545069
FT                   /transl_table=11
FT                   /locus_tag="SpyM50523"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD7"
FT                   /protein_id="CAM29862.1"
FT                   /translation="MIPVLYEAKETKFRTFGLGEIADAYEVKATRERNGNYSLYIKYPL
FT                   DGVFASVFKEEMKIKSDAGRRTKWQTFEINRVLRNSKDHIEIFARHISMRTQDIALKPF
FT                   VNGASVGAESALEIWKKNLVGDDKFDVKSDILTLGSFNWEIDKIGNARGALGGVAGSIL
FT                   DVYGGEYEFDNRTIILRKQMGRKAPTVLEYGRNIVSVEEERLLDGNYTSIYPYVRYTPQ
FT                   PKPQEETPGKPHVGEHKQPEEQLVTLPEFILDGQYLSLYAQRRIQMVDLSSHFNDDKNK
FT                   KEPTVEEIRKLAQKYLKDNNVGAPKVSIEVDYIDLSQTLDYQDFRVMEEVELCDIVPLY
FT                   YPKFGITTESEKVVEIVYDVYTDSNHTIKLGTIGQSISKSLTGGVSERINALENNQKVI
FT                   TNNQKQFELNLPKYLNDINGKRVWYEKPDDNIEHKIGDYWFEKNGKYQRTWIWDGNQWV
FT                   KVLDTEDLNPNQRAFDEAMAEIEKAKKAQEEINQRTDKELEEFRATLKNLALPEEAIKK
FT                   ITEAIKVDDIPSIKQSFDDLKNKVSETSETSRLNAEILGNNGKTRYNKNLLVGDPNRTK
FT                   TYDEDYIEVEANDGGFKRGETYTISFSQTCELLQKVAITLTQANNKGVKLVLTPTKAKT
FT                   DAQTFEVTKDKQSIEVYPLSYTGVLTGDWYKPKQIDLNASDTQELALEMAYKEVVDGKD
FT                   AAITGIWSDSPQIILDGGKK"
FT   CDS             545066..546076
FT                   /transl_table=11
FT                   /locus_tag="SpyM50524"
FT                   /product="putative phage hyaluronidase"
FT                   /db_xref="GOA:A2RDD8"
FT                   /db_xref="InterPro:IPR009860"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDD8"
FT                   /protein_id="CAM29863.1"
FT                   /translation="MTETIPLRVQFKRMTAEEWTRSDVILLESEIGFETDTGYAKFGDG
FT                   KNQFSKLKYLNKPDLGAFAQKEETNSKITKLESSKADKNAVYLKAESKIELDKKLNLKG
FT                   GVMTGQLQFKPNKSGIKPSSSVGGAINIDMSKSEGAGVVVYSNNDTSDGPLMSLRTGKE
FT                   TFNQSALFVDYSGKTNAVNIAMRQPTTPNFSSALNITSGNENGSAMQIRGVEKALGTLK
FT                   ITHENPNVEANYDENAAALSIDIVKKQKGGKGTAAQGIYINSTSGTTGKLLRIRNLGDD
FT                   KFYVKHDGGFYAKKTSQIDGNLKLKNPTADDHAATKAYVDSEVKKLKALLMDKQV"
FT   misc_feature    545231..546067
FT                   /locus_tag="SpyM50524"
FT                   /note="HMMPfam hit to PF07212, Hyaluronidase protein
FT                   (HylP), score 3.6e-203"
FT                   /inference="protein motif:HMMPfam:PF07212"
FT   CDS             join(546089..546754,546754..547974)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50525"
FT                   /note="Almost identical to Streptococcus pyogenes (serotype
FT                   M18) hypothetical protein spym18_0771 UniProt:Q8P1N6
FT                   (EMBL:AE010008) (628 aa) fasta scores: E()=3.6e-205,
FT                   99.522% id in 628 aa. CDS contains a frameshift after codon
FT                   222"
FT                   /db_xref="PSEUDO:CAM29864.1"
FT   CDS             547986..548417
FT                   /transl_table=11
FT                   /locus_tag="SpyM50527"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR011675"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE0"
FT                   /protein_id="CAM29865.1"
FT                   /translation="MDLTLKNKELNTLYRVLDKIKITNMRANRGRAKLLAKVVDKINEY
FT                   AKDETDLIDMYAAKDKDDKFVIDEHKNIKLADPAKLDELNDLLNELADEEIVIKGGEYS
FT                   KRFIDFLNFLEECEDEFTSSEIILIDNILEQFEESKKGE"
FT   misc_feature    547986..548414
FT                   /locus_tag="SpyM50527"
FT                   /note="HMMPfam hit to PF07761, Protein of unknown function
FT                   (DUF1617), score 1.3e-102"
FT                   /inference="protein motif:HMMPfam:PF07761"
FT   CDS             548420..549052
FT                   /transl_table=11
FT                   /locus_tag="SpyM50528"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE1"
FT                   /protein_id="CAM29866.1"
FT                   /translation="MKTLTLSGKPYPIHEDGKVVKTEVRLIGDNGLFIPIELIGDQTAK
FT                   GADDLIKEGLDAFVREYVTKYAVAESVQKVEELSLAQKEIEQNAEQAKVTAEAAEKQAK
FT                   SLELVIAKSQKMANLQAIHLLTSGSKVEPDIYKGLLELIEPAKKGEYQAYDVFTVVDES
FT                   HEEQAGEGNLVFVHVNEAFEYDKQTLEELESEAKVTVIKYADLVKQD"
FT   CDS             549062..549517
FT                   /transl_table=11
FT                   /locus_tag="SpyM50529"
FT                   /product="putative phage holin protein"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE2"
FT                   /protein_id="CAM29867.1"
FT                   /translation="MIIDLTSLIHLFGDLVRTVEIHVFTLFVCFDIITGLTKGITNKRA
FT                   NSTKGLSGIIKHFLVVLLVYTVYPYLILLGAKPLAVAFVLFFIACYGISIVENWGQLGL
FT                   PMPSFVRSFFEKLKRDTDQFDIATIKIDKTGVKLEAPQVDLKQKEEE"
FT   misc_feature    549083..549445
FT                   /locus_tag="SpyM50529"
FT                   /note="HMMPfam hit to PF05105, Holin family, score 5.6e-14"
FT                   /inference="protein motif:HMMPfam:PF05105"
FT   misc_feature    order(549104..549172,549233..549286,549296..549349)
FT                   /locus_tag="SpyM50529"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50529 by TMHMM2.0 at aa 15-37, 58-75 and 79-96"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             549629..550834
FT                   /transl_table=11
FT                   /locus_tag="SpyM50530"
FT                   /product="putative phage amidase protein"
FT                   /db_xref="GOA:A2RDE3"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE3"
FT                   /protein_id="CAM29868.1"
FT                   /translation="MAFLDKIKSAVIAEWHTHKILPSLTTAQAILESGWGKHAPHNALF
FT                   GIKADSSWTGKSFNTKTQEEYQPGIVTDIVDRFRAYDSWDESIADHGQFLVDNPRYEAV
FT                   VGETDYKKACHAIKEAGYATASGYAELLIQLIEENDLQKWDEEAIVRKEEQMINSQCRE
FT                   VIEFFINLANAGVGVDKDKFAGWQCADVPCYAAKHWFDVDLWGNAIDLLDSAAAVGWEV
FT                   HRMPTDANPRTGAFFVQSVPYHQFGHTGIVIEDSDGYTMRTVEQNIDGNPDALYVGAPA
FT                   RFNTRDFTGVIGWFYPPYQGDTVTQPVSTEPQTSDTIVETAKTGTFTLDVAEINIRRWP
FT                   SLASEVVGIYKQGDTVSFDSEGYANGYYWISYVGGLGMRDYLAIGQTDKDGNRISIWGK
FT                   LN"
FT   misc_feature    549647..550051
FT                   /locus_tag="SpyM50530"
FT                   /note="HMMPfam hit to PF01832, Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglu, score 2.9e-21"
FT                   /inference="protein motif:HMMPfam:PF01832"
FT   misc_feature    550133..550516
FT                   /locus_tag="SpyM50530"
FT                   /note="HMMPfam hit to PF05257, CHAP domain, score 8.4e-31"
FT                   /inference="protein motif:HMMPfam:PF05257"
FT   CDS             550974..551498
FT                   /transl_table=11
FT                   /locus_tag="SpyM50531"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE4"
FT                   /protein_id="CAM29869.1"
FT                   /translation="MHALFVANYIIEYSNKKGYKINNLKLQKLLYFVNVRNILENGAPL
FT                   FEESMEKWKYGPVVPDVYHEYKRFGAFSISTDEMIMEYVEFSVSPFGELSDLEITEYDS
FT                   QKVENTQLIENTVDALHGFGPFELVDITHDHTPWKKYEDRIMDGVQGIKYTIEEIKDFF
FT                   GHNPGAKIWVQ"
FT   CDS             551486..552352
FT                   /transl_table=11
FT                   /locus_tag="SpyM50532"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="InterPro:IPR005602"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE5"
FT                   /protein_id="CAM29870.1"
FT                   /translation="MGTIAPAFMELLLDANFCKAPVNNQDTLLKVYHREMAKDNVTIPY
FT                   EIIAEYVYSHEDSVEENEKLNSNIDFIISEFSGTDTQKDILIKNLDKIKSNYSLAQTQK
FT                   KFILKNSQEAKDVLEKIIPELNTLAKETSNLAATNDELKKQSAETDGVLQKVKQGVDDV
FT                   RNTKSSIYTDFIAILGVFSAFVFVMFGGIDVARAIFDIGNDLQTLDLSRMITVSSLMLI
FT                   GVLTLMYSLLLWVARITGKNFGNCYSSKCDNGCRHKWRHFLMRHSFYFSLMFLLVLTTV
FT                   VSHCLFK"
FT   misc_feature    order(552014..552082,552125..552193,552287..552346)
FT                   /locus_tag="SpyM50532"
FT                   /note="3 probable transmembrane helices predicted for
FT                   SpyM50532 by TMHMM2.0 at aa 177-199, 214-236 and 268-287"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(552402..552836)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50533"
FT                   /product="hypothetical phage membrane protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE6"
FT                   /protein_id="CAM29871.1"
FT                   /translation="MKRSKKASLLSVIVGMALAVIPIYIVNYDNELIVLLMSIFFNGII
FT                   VSAFELIKTYDGLQEEYKKLTVDRWKNTILLAFNSLYFASILTNSLSNNLSTILSTNRS
FT                   DKVNAIFLTGCSILALLPFLLHRLIKREIEIENERKKLKK"
FT   misc_feature    complement(order(552450..552518,552561..552620,
FT                   552681..552749,552759..552818))
FT                   /locus_tag="SpyM50533"
FT                   /note="4 probable transmembrane helices predicted for
FT                   SpyM50533 by TMHMM2.0 at aa 7-26, 30-52, 73-92 and 107-129"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(553108..553914)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50534"
FT                   /product="streptococcal phage DNAse"
FT                   /note="Similar to SpyM51263, 56.962% identity (58.442%
FT                   ungapped) in 237 aa overlap"
FT                   /db_xref="GOA:A2RDE7"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE7"
FT                   /protein_id="CAM29872.1"
FT                   /translation="MDMSKSNRRTWQGLVVILIAILTTFTTSTVTAARKIRNFPDTTEI
FT                   LLGTKATETPGILPFTGSYQLVLGDLDNLQRPTFAHIQLKDQDEPNIKRKGLKFNPPGW
FT                   HNYKLTDANGKTTWLMDRGHLVGYQFSGLNDEPKNLVTMTKYLNTGFSDKNPLGMLYYE
FT                   NRLDSWLALHPNFWLDYKVTPVYHKNELVPRQVVLQYVGIDENGDLLQIKLGSEKESVD
FT                   NFGVTSVTLDNVSPLAELDYQTGMMLDSTQNEEDSNLETEEFEEAA"
FT   misc_feature    complement(553150..553737)
FT                   /locus_tag="SpyM50534"
FT                   /note="HMMPfam hit to PF01223, DNA/RNA non-specific
FT                   endonuclease, score 2.8e-06"
FT                   /inference="protein motif:HMMPfam:PF01223"
FT   misc_feature    complement(553726..553743)
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide"
FT                   /inference="protein motif:Prosite:PS00343"
FT   sig_peptide     complement(553819..553914)
FT                   /locus_tag="SpyM50534"
FT                   /note="Signal peptide predicted for SpyM50534 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.907 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    complement(553819..553878)
FT                   /locus_tag="SpyM50534"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50534 by TMHMM2.0 at aa 13-32"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             554146..554328
FT                   /transl_table=11
FT                   /locus_tag="SpyM50535"
FT                   /product="hypothetical phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE8"
FT                   /protein_id="CAM29873.1"
FT                   /translation="MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEV
FT                   VTEEIVEEVMVELDK"
FT   CDS             554519..555874
FT                   /transl_table=11
FT                   /locus_tag="SpyM50536"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="GOA:A2RDE9"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDE9"
FT                   /protein_id="CAM29874.1"
FT                   /translation="MVVKVKQKIPLKIKRMGINGEGIGFYQKTLVFVPGALKGEDIFCQ
FT                   ITAVKRNFAEAKLLMVNKASKNRVKPACSVYETCGGCQIMHLAYPKQLDFKDDVIRQAL
FT                   KKFKPTGYEQFEIRPTLGMKKPDHYRAKLQFQLRSFGGTVKAGLFSQGSHRLVPIDNCL
FT                   VQDQLTQDIINKITQLVDKYKLPIYNERKIAGIRTIMVRKAQASDQVQIIVVSSKEVRL
FT                   ARFIGELTKAFPQVKTVALNSNCSKSSEIYGDETEILWGQEAIHEEVLDYGFALSPRAF
FT                   YQLNPQQTEVLYGEVVKALDVGSKDHIIDAYCGVGSIGFAFAGKVKSVRGMDIIPEAIE
FT                   DAQKNAKSMGFDNAYYEAGKAEDIIPKWYKQGYRADAIIVDPPRTGLDDKLLETILHYQ
FT                   PKQMVYVSCNTSTLARDLVQLTKIYDVHYIQSVDMFPHTARTEAVVKLQKRV"
FT   misc_feature    554522..554698
FT                   /locus_tag="SpyM50536"
FT                   /note="HMMPfam hit to PF01938, TRAM domain, score 8.7e-08"
FT                   /inference="protein motif:HMMPfam:PF01938"
FT   misc_feature    554780..555868
FT                   /locus_tag="SpyM50536"
FT                   /note="HMMPfam hit to PF05958, tRNA
FT                   (Uracil-5-)-methyltransferase, score 6.5e-06"
FT                   /inference="protein motif:HMMPfam:PF05958"
FT   misc_feature    555659..555754
FT                   /note="PS01230 RNA methyltransferase trmA family signature
FT                   1"
FT                   /inference="protein motif:Prosite:PS01230"
FT   misc_feature    555734..555757
FT                   /note="PS00071 Glyceraldehyde 3-phosphate dehydrogenase
FT                   active site"
FT                   /inference="protein motif:Prosite:PS00071"
FT   CDS             556540..557895
FT                   /transl_table=11
FT                   /locus_tag="SpyM50537"
FT                   /product="putative sensor kinase"
FT                   /db_xref="GOA:A2RDF0"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF0"
FT                   /protein_id="CAM29875.1"
FT                   /translation="MLEDFLQFLGFIFLDIIEIMLTLKLFSFVSAIPLRLKNIFYLSLS
FT                   MALFQVVFWAFFPDHFILDVVMLAQFLFFALIALYYGKSIKAKFLMFYAFFPLVSISLV
FT                   KRFIVFFVMPLFGMPYSVVKHNTLLIYSITCFSIFLIYRCIQVFHFDFSTWRQYFQSHR
FT                   ASKLLVFTNSSMALYYLCVQGIDVMSPSLSGLATTTARSIIVLFYFILFLTLLIHLERY
FT                   VKQNSIEAIVQQKEYRELINYSQHLGLLYQDIQELRQLLTTVSSRLKIGIEQNDISIVR
FT                   LTYEGILNAEKNNAKDDRLDLTCLDKLQVEAIRHIVLAKLIEAKNKKLKVEVSIPNCIA
FT                   TFFLEVVDFTKLLSFLLDNAIEMSLETKQPCLSIAFLDQNHKLVIVIQSSTKQGQNDSQ
FT                   SVFATSALKKRDDWQFDLRNVTTILNRYDYLTISSQIHDGILTQLIEIAKPD"
FT   misc_feature    order(556567..556635,556654..556707,556717..556785,
FT                   556804..556872,556915..556974,557032..557100,
FT                   557128..557196)
FT                   /locus_tag="SpyM50537"
FT                   /note="7 probable transmembrane helices predicted for
FT                   SpyM50537 by TMHMM2.0 at aa 10-32,
FT                   39-56,60-82,89-111,126-145, 165-187 and 197-219"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(557996..560701)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50538"
FT                   /product="glycosyl hydrolases family protein"
FT                   /db_xref="GOA:A2RDF1"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF1"
FT                   /protein_id="CAM29876.1"
FT                   /translation="MATKKVHIISHSHWDREWYMAYEQHHMRLINLIDDLLEVFQTDPD
FT                   FHSFHLDGQTIILDDYLQVRPEREPEIRQAIASGKLRIGPFYILQDDFLTSSESNVRNM
FT                   LIGKEGCDKWGASVPLGYFPDTFGNMGQTPQLMLKADLQAAAFGRGIRPTGFNNQVDTS
FT                   EKYSSQFSEISWQGPDDSHILGLLFANWYSNGNEIPTTEAEARLFWDKKLADAERFAST
FT                   KHLLMMNGCDHQPVQLDVTKAIALANQLYPDYEFVHSCFEDYLADLADDLPENLSTVQG
FT                   EITSQETDGWYTLANTASARIYLKQANTRVSRQLENITEPLAAMAYEVTSIYPHDQLRY
FT                   AWKTLMQNHPHDSICGCSVDSVHREMMTRFEKAYEVGHYLAKEAAKQIADAIDTRDFPM
FT                   DSQPFVLFNTSGHSKTSVAELSLTWKKYHFGQRFPKEVYQEAQEYLARLSQSFQIIDTS
FT                   GQVRPEAEILGTSIAFDYDLPKRFFREPYFAIKVRLRLPITLPAMSWKTLALKLGNETT
FT                   PSETDSLYDDSNQCLENGFLKVMIQTDGRLTITDKQSGLIYQDLLRFEDCGDIGNEYIS
FT                   RQPTHDQPFYADQGVTHISVRSNTIQVAELEIQQTFTIPVSADDRLQAEMEAVIDITER
FT                   QARRSQEKAELTLTTLIRMEKNNPRLQFTTRFDNQMTNHRLRVLFPTHLKTDHHLADSI
FT                   FETVKRPNHPDATFWKNPSNPQHQECFVSLFDGENGVTIGNYGLNEYEILPDTNTIAIT
FT                   LLRSVGEMGDWGYFPTPEAQCLGKHSLSYSFESITKQTQFASYWRAQEGQVPVITTQTN
FT                   QHEGTLAAEYSYLTGTNDQVALTAFKRRLADNALITRSYNLSNDKTCDFSLSLPNYNAK
FT                   VTNLLEKDSKQSTPSQLGKAEILTLAWKKQ"
FT   misc_feature    complement(558011..559498)
FT                   /locus_tag="SpyM50538"
FT                   /note="HMMPfam hit to PF07748, Glycosyl hydrolases family
FT                   38 C-termi, score 1.3e-06"
FT                   /inference="protein motif:HMMPfam:PF07748"
FT   misc_feature    complement(559847..560689)
FT                   /locus_tag="SpyM50538"
FT                   /note="HMMPfam hit to PF01074, Glycosyl hydrolases
FT                   family,score 3.4e-19"
FT                   /inference="protein motif:HMMPfam:PF01074"
FT   CDS             complement(560716..562029)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RDF2"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF2"
FT                   /protein_id="CAM29877.1"
FT                   /translation="MIYHFGGYDMTRPIPTSVSQFMAKVESLCGDQHPDWALNFKTSFA
FT                   NTLETTLKTYEDGTSFLLTGDIPAMWLRDSTAQMKPYLFLAKEDEEIRKIIAGLVKRQF
FT                   RYICIDPYANAFNEEANEKGHQTDHTQMNPWIWERKYEIDSLCYPIQLAYLLYRETGST
FT                   DQFNDDFHRGVELILDLWTVEQDHAQSPYLFERDTWRKEDTLTHAGKGSPVAPTGMTWS
FT                   GFRPSDDACQYGYLIPSNMFAVVVLSYLEDLYNNLFHNESVATRAKQLKEAIQSGIADH
FT                   ALVQNSKGETIYAYEVDGLGQFSIMDDANIPSLLAAPYLGFCAKDDPIYLATRRTILSQ
FT                   ENPYYYQGNAAAGIGSSHTPENYIWHIALALQGLTALDQDSKKEMLDLLVATDAGTHLM
FT                   HEGFDVNDPYQYTREWFSWANMMFCELLLDYLGFSIAP"
FT   misc_feature    complement(560743..561933)
FT                   /locus_tag="SpyM50539"
FT                   /note="HMMPfam hit to PF06824, Protein of unknown function
FT                   (DUF1237), score 0"
FT                   /inference="protein motif:HMMPfam:PF06824"
FT   CDS             562135..563175
FT                   /transl_table=11
FT                   /locus_tag="SpyM50540"
FT                   /product="GntR family regulatory protein"
FT                   /db_xref="GOA:A2RDF3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF3"
FT                   /protein_id="CAM29878.1"
FT                   /translation="MTKLLYKKIYHFIKEQIASGRLQIGDRLPTEKELSEQFSVSRITS
FT                   KRALVELEQEGLITRSRGKGSFVAKKQVTSPEANKDLLLILPFASDYELGDYAKGIMTS
FT                   IAETGYRLMVQLASTVRLDTLSDYAGIIYYPEDVNHSIDFLFYCDHHHIPLVLLDKSLD
FT                   LFQFPAVVADNKGGAYQLTQHLIEQGCDQIWFVATGSFGEVSSVRDRYLGYLAAMAESS
FT                   LKSHYFPKTETETTDAYLDRLVKTLSETTATKRGLVVENDWLAIQLIQKITQVGLSIPD
FT                   QVAIVGFDNSQASRLLSPKLSTAAQDFYQMGQEAAKVLLQIIHEPDQAVVSCQLPVQVF
FT                   IRESSH"
FT   misc_feature    562147..562338
FT                   /locus_tag="SpyM50540"
FT                   /note="HMMPfam hit to PF00392, Bacterial regulatory
FT                   proteins, gntR fami, score 1.1e-22"
FT                   /inference="protein motif:HMMPfam:PF00392"
FT   misc_feature    562369..563163
FT                   /locus_tag="SpyM50540"
FT                   /note="HMMPfam hit to PF00532, Periplasmic binding proteins
FT                   and sugar b, score 8.1e-05"
FT                   /inference="protein motif:HMMPfam:PF00532"
FT   CDS             563226..564920
FT                   /transl_table=11
FT                   /locus_tag="SpyM50541"
FT                   /product="beta-N-acetylglucosaminidase"
FT                   /db_xref="InterPro:IPR011496"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF4"
FT                   /protein_id="CAM29879.1"
FT                   /translation="MTIYHALKDYQEVMTRGDYLVFDTPLTCRFIGHFFRFENQKALLA
FT                   ELATSKYFQWIEEGQAEVTMKHFFNRQLAKDAFTLKVSEDKEIIIESQNLRGFRYAQEA
FT                   LLKVMTFKGDKLYLPIVSVKHSPSFPMRGIIEGFYGTPWTREERIDCLRFIGNKRMNTY
FT                   MYAPKDDDYQRKLWRDLYPEDWVTYFKELLAVAKEEGIDFWYMISPGLDFDYTKEADYQ
FT                   LLYQKLQQLLALGVCHFGLLLDDIDYQIVDAVERRFKKTAYAQAHLATEVHHFLNQQHA
FT                   APELVICPTEYDNHHDSIYLQELSERIPKEVAFFWTGPSTLASQISQADIETMAAVYQR
FT                   PIIIWDNIPVNDYQKDPERLFLTPFANRSPFLCQPDYQVKGIVSNPMISWELSKLTLTD
FT                   MSHYLWDANRYQPSHSWLETLTDYTEDTELALALQAFAWHNGNRHLHRDLPFEVEEALL
FT                   AKDVSTLSAWVAELVERVNTLRKLDKPAFQQAIAPWFERVAKDQDFWQAMLNQEPQLET
FT                   LYADLQEDKHRIGSDIPSRYYRIYYQQQDKLTANQGQVTQARPEDYA"
FT   misc_feature    563619..564548
FT                   /locus_tag="SpyM50541"
FT                   /note="HMMPfam hit to PF07555, Hyaluronidase, score
FT                   1.3e-174"
FT                   /inference="protein motif:HMMPfam:PF07555"
FT   CDS             564945..566387
FT                   /transl_table=11
FT                   /locus_tag="SpyM50542"
FT                   /product="putative beta-glucosidase"
FT                   /db_xref="GOA:A2RDF5"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF5"
FT                   /protein_id="CAM29880.1"
FT                   /translation="MLAFPKEFWWGGATSGPQSEGRFAKQHRNLFDYWYEEEPDLFYDY
FT                   VGPDTASDAYHQIESDLALLASLGHNSYRTSIQWTRLIDDFEQATINPDGLAYYNRVIN
FT                   ACLANGIRPVINLHHFDLPIALYQAYGGWESKHVVDIFVAFSKVCFEQFGDRVKDWFVH
FT                   NEPMVVVEGSYLMQFHYPAIVDGKKAVQVAYNLALATAKVIQAYRRGPAELSNGRIGTI
FT                   LNLTPAYPASQSEADMAAAHFTELWNNDLFMEAAVHGKFPEELVAVLKKDGVLWQSTPE
FT                   ELALIAENRVDYLGLNFYHPKRVKAPDVIPVISPSWSPEWYYDPYLMPGRRMNVDKGWE
FT                   IYPEAVYDIAIKMRDHYDNIPWFLSENGVGISGEDRYRDETGQIQDDYRIQFLKEHLTY
FT                   LHKGIEAGSNCFGYHVWTPIDGWSWLNAYKNRYGLVENNIHTQVRRPKASAYWFKKVAT
FT                   HNCLISLEVMEEFGGSASHLSD"
FT   misc_feature    564945..566330
FT                   /locus_tag="SpyM50542"
FT                   /note="HMMPfam hit to PF00232, Glycosyl hydrolase
FT                   family,score 2.4e-101"
FT                   /inference="protein motif:HMMPfam:PF00232"
FT   CDS             complement(join(566733..566879,566883..566966))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="SpyM50543"
FT                   /note="Probable gene remnant. Similar to an internal region
FT                   of Lactococcus lactis (subsp. lactis) (Streptococcus
FT                   lactis) sugar hydrolase YpdD UniProt:Q9CFH5 (EMBL:AE006380)
FT                   (717 aa) fasta scores: E()=5.5e-10,56.757% id in 74 aa. CDS
FT                   contains a nonsense mutation (opal) after codon 28"
FT                   /db_xref="PSEUDO:CAM29881.1"
FT   CDS             complement(566998..567876)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50544"
FT                   /product="ROK family protein"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF7"
FT                   /protein_id="CAM29882.1"
FT                   /translation="MSLLCLDIGGTSLKFALCHNGQLSQQSSFPTPSSLEKFYQLLDQE
FT                   VARYSAYHFSGIAVSPPGAVNKEKGIIEGASAIPYIHHFKIQEALEERLHYPISIENDA
FT                   NCAALAEATLGAGKGASSLAMLVLGTGVGGSLVIDGKIYHGAHLFGGEFGFMIMNDRYQ
FT                   TFSQLGTVVNMAKRYSAIVNNGKDYTGKAVLALAEQGDPLALKERQVFLQSLAIGIFNI
FT                   QHAFDPQLILIGGGVSQADFLLSAIEAELDKLYQAVEISDLRPQLAICHFKNEANLLGA
FT                   AIDFYQEHKEA"
FT   misc_feature    complement(567334..567864)
FT                   /locus_tag="SpyM50544"
FT                   /note="HMMPfam hit to PF00480, ROK family, score 1.9e-24"
FT                   /inference="protein motif:HMMPfam:PF00480"
FT   CDS             568093..569043
FT                   /transl_table=11
FT                   /locus_tag="SpyM50545"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /db_xref="GOA:A2RDF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF8"
FT                   /protein_id="CAM29883.1"
FT                   /translation="MTKQTNKKTSFWKNVIKYRALLLMVLPGFIWFIFFFYIPVLANVV
FT                   AFKDFHYSAGGFMESLKESPWVGLANFKYLFASKDAWLITRNTIAYNVIFLLFNVFFAI
FT                   AFAIIMSELRNKRTVKVYHTMSLLPYFLSWVVIEYFVSAFLNTDKGFINQLLTGSGADP
FT                   IKWYSNPTWWPLILLFMSVWKGLGYNSIIYYASVKGISDTYYEAAMVDGASKWQQIRNI
FT                   TIPQLLPMMSILLIINIGNIFKSDFGLFYVIPKNSGPLYDVTSVLDTYVYNALTATGDI
FT                   GMASAASLYQSVVGTSILLVTNAIVRRMDPDAALF"
FT   misc_feature    order(568150..568218,568354..568422,568459..568527,
FT                   568606..568674,568753..568821,568942..569010)
FT                   /locus_tag="SpyM50545"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50545 by TMHMM2.0 at aa 36-58,104-126,139-161,188-210,
FT                   237-259 and 300-322"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    568345..569025
FT                   /locus_tag="SpyM50545"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 5.8e-08"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   misc_feature    568681..568767
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign"
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             569053..569979
FT                   /transl_table=11
FT                   /locus_tag="SpyM50546"
FT                   /product="binding-protein-dependent transport system
FT                   membrane protein"
FT                   /db_xref="GOA:A2RDF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDF9"
FT                   /protein_id="CAM29884.1"
FT                   /translation="MEKKKKVEKVNVRTFDRKTNAIFNILIGLFAISCIIPFIFVIIIS
FT                   FTDESYLINHGYSFFPDVWSTKAYQYIFQGAMSHRIMRSFGISVFITVVGTFINTTMTS
FT                   TYAYAISRPYFPYRRFFTVYALITMLFAPGMVANYLVVSNLLHLKDTVWALILPMALGP
FT                   FGILVMRTFFKKTVPDSIIESARMDGASEWMIFMKIVLPLAVPGIATISLFSALTYWND
FT                   WFNALLYVQSENLYPMQYLLMKIQSNLQALAQNAGMSAQMADSLASLPKESVRMAIVVI
FT                   ATLPIALTYPFFQKYFVGGLTIGGVKE"
FT   sig_peptide     569053..569193
FT                   /locus_tag="SpyM50546"
FT                   /note="Signal peptide predicted for SpyM50546 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.703) with cleavage
FT                   site probability 0.591 between residues 47 and 48"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(569113..569181,569305..569373,569410..569478,
FT                   569506..569574,569635..569703,569872..569931)
FT                   /locus_tag="SpyM50546"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50546 by TMHMM2.0 at aa 21-43,
FT                   85-107,120-142,152-174,195-217 and 274-293"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    569293..569961
FT                   /locus_tag="SpyM50546"
FT                   /note="HMMPfam hit to PF00528, Binding-protein-dependent
FT                   transport syst, score 7.6e-14"
FT                   /inference="protein motif:HMMPfam:PF00528"
FT   CDS             570060..571505
FT                   /transl_table=11
FT                   /locus_tag="SpyM50547"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG0"
FT                   /protein_id="CAM29885.1"
FT                   /translation="MKKWQKIVCVTGTVLAASSLAACESKSASKDSDVKLLMYQVGDKP
FT                   DNFDELMTIANKRIKEKTGATVDLQYIGWGDWDDKMSTIIASGENYDIAFANNYVVNAQ
FT                   KGAFADLTTLMPKYAKKTYKNLDPAYIKGNTIDGKLYAFPVDANVYAQQMLSFNKELVD
FT                   KYGLDISNIKSYADAENVLKQFHEKEPNTAAFAIGQVFSMSGDYDYPLTKTQPFAVKID
FT                   EGKPTIINQYEDESFKNNLRLMHKWYKEGLIPTDAATNTEGYPLEGNTWFMREETQGPM
FT                   DYGDTILTNAAGKDIVSRPLTKPLKTTSQAQMANFVVSSVSKNKEKAVEVLSLLNSDPE
FT                   LLNGLVYGVEGKAWEKIGDKKIKLLDGYQPKMHMGAWNTGNNKILYTQESVTDDMIAKR
FT                   DQSIKDAKESPILGFTVDTKVIKTELSNISNVMNRYKASINTGTVDPDEALPKLLADLK
FT                   GAGWDKVQKEVQKQLDDFVAKDK"
FT   sig_peptide     570060..570149
FT                   /locus_tag="SpyM50547"
FT                   /note="Signal peptide predicted for SpyM50547 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.403 between residues 30 and 31"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    570084..571085
FT                   /locus_tag="SpyM50547"
FT                   /note="HMMPfam hit to PF01547, Bacterial extracellular
FT                   solute-binding prot, score 1.8e-09"
FT                   /inference="protein motif:HMMPfam:PF01547"
FT   misc_feature    570096..570128
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             571811..572416
FT                   /transl_table=11
FT                   /locus_tag="SpyM50548"
FT                   /product="putative membrane protein"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG1"
FT                   /protein_id="CAM29886.1"
FT                   /translation="MNGIEKTCFLIWKMIQLTLIFHLLSLAGLIVFGVGPAWQTIVTLF
FT                   LKTSQEENHYSLKRAVQLWKSYFKEANLRFGLFALTFLFLTFNLHWAVQFPSLFWFTVS
FT                   FLIVIAMVWLTMTYLYMVFYAVSYEISLWNNMKLAFISVFLSFKSFLLMLSVLLGITLV
FT                   TWQYKGLYLFLTFGALVFCLDFVTKANRRLVDGVIDEC"
FT   misc_feature    571850..572077
FT                   /locus_tag="SpyM50548"
FT                   /note="HMMPfam hit to PF04854, Protein of unknown function,
FT                   DUF624, score 1.3e-30"
FT                   /inference="protein motif:HMMPfam:PF04854"
FT   misc_feature    order(571853..571921,572021..572089,572117..572185,
FT                   572222..572290,572318..572371)
FT                   /locus_tag="SpyM50548"
FT                   /note="5 probable transmembrane helices predicted for
FT                   SpyM50548 by TMHMM2.0 at aa 15-37, 71-93, 103-125, 138-160
FT                   and 170-187"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             572406..574130
FT                   /transl_table=11
FT                   /locus_tag="SpyM50549"
FT                   /product="sensor histidine kinase"
FT                   /note="Possible alternantive translational start site"
FT                   /db_xref="GOA:A2RDG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG2"
FT                   /protein_id="CAM29887.1"
FT                   /translation="MSVKTLGRYVTNHFKQGFLINRLMKLYSLLIVSFFTLAAIGLSSY
FT                   SISSTYKRVDAEAQMRLEETLGRLQSQNDITLRVLDQLVGRSEDYHNLYQYMTLTPNQY
FT                   FSNVFEDWEKGKDTVLFSEEVRRLFDLYPDVTSMTLLLEDSSAYLYADRVIKTGRLLYS
FT                   KPEKVTGNVLVRSIRNPESGDVTGRLYLTFDKPPTLVETQQDHYLATFAFDYYGRKLFH
FT                   QGGRRFPHLEAEVKKAIKADRAADLSNLSKAYRMQYNRSGDLLAYVAVRKSYLLAEAVR
FT                   TVFVYGLVSLLLAWLLLQLLFRVFRNYIQQVSEITDTVEMVAAGDLSLTIDNSHMELEL
FT                   YHISEAINQMLASIKAYIDEVYVLEVEQRDAQMRALQSQINPHFLYNTLEYIRMYALSC
FT                   QQEELADVIYAFASLLRNNISQDKMTTLKEELAFCEKYIYLYQMRYPDSFAYHVKIDES
FT                   IADLAIPKFVIQPLVENYFVHGIDYSRNDNALSIKALDETDHLLIQVLDNGRGISQERL
FT                   ADMEKRLQEHQTTGNSSIGLQNVYLRLFHHFRDRVSWSMAKEPNGGFIIQIRIRKDA"
FT   sig_peptide     572421..572543
FT                   /locus_tag="SpyM50549"
FT                   /note="Signal peptide predicted for SpyM50549 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.992) with cleavage
FT                   site probability 0.609 between residues 41 and 42"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(572481..572549,573252..573320)
FT                   /locus_tag="SpyM50549"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50549 by TMHMM2.0 at aa 21-43 and 278-300"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    573264..573473
FT                   /locus_tag="SpyM50549"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 9.8e-08"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    573519..573767
FT                   /locus_tag="SpyM50549"
FT                   /note="HMMPfam hit to PF06580, Histidine kinase, score
FT                   1e-39"
FT                   /inference="protein motif:HMMPfam:PF06580"
FT   misc_feature    573795..574124
FT                   /locus_tag="SpyM50549"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP9, score 0.0075"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             574130..575614
FT                   /transl_table=11
FT                   /locus_tag="SpyM50550"
FT                   /product="response regulator protein"
FT                   /db_xref="GOA:A2RDG3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG3"
FT                   /protein_id="CAM29888.1"
FT                   /translation="MYKVLLVDDEYMILQGLTMIIDWQALGFEVVQTARSGKEALAYLT
FT                   QYPVDVMISDVTMPGMTGLDLIEAAKTYHPQLQTLILSGYQEFSYVQKAMELETKGYLL
FT                   KPVDKAELQAKMKQFKDCLDAQQAESIRQEAYHDSLLTLWLTDELSEKEFQQLSQSLPA
FT                   AALTGFTALYLDCQEWQAAIDAYFEREGQPFYLKKEEDKKVYLAVLLGKTDQAKAFTYD
FT                   LQKRFSRNMHQLILGETVDDWENVYESYNQVLKSLFYNCEVSPIRAKDKSKIELPESRL
FT                   QFFAFNKALMIGDEPTILSKLEAIFDEMKTLNFSPEDVKHVSFLLFSDIYRQFPILDKM
FT                   TYLSMVKTIHDSQSIDRILRELKKVLDVTNQNNSPEKRYSDLVSETIDCIRKEYHQELT
FT                   LKAIADRLHVNGVYLGQCFKNETERSFTQYLNHVRIQKAQQLLLYTNQSINEIAYETGY
FT                   NTNHYFIKMFKKLNGLPPKEFRDRYKDNYQAIKGDQ"
FT   misc_feature    574133..574501
FT                   /locus_tag="SpyM50550"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 8.9e-29"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    575282..575422
FT                   /locus_tag="SpyM50550"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 0.0051"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    575321..575386
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1443.000, SD 4.10 at aa 399-420, sequence
FT                   LTLKAIADRLHVNGVYLGQCFK"
FT   misc_feature    575429..575557
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    575438..575572
FT                   /locus_tag="SpyM50550"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 4.3e-08"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS             575634..579050
FT                   /transl_table=11
FT                   /locus_tag="SpyM50551"
FT                   /product="glycosyl hydrolase family 2 protein"
FT                   /note="N-terminal region is similar to Thermoanaerobacter
FT                   ethanolicus (Clostridium thermohydrosulfuricum)
FT                   beta-galactosidase LacZ UniProt:BGAL_THEET (EMBL:TEMELA)
FT                   (EC 3.2.1.23 ( 743 aa) fasta scores: E()=6.8e-19, 24.205%
FT                   id in 818 aa. Full length CDS is similar to Streptococcus
FT                   pyogenes (serotype M3) putative beta-galactosidase.
FT                   UniProt:Q8K6M1 (EMBL:AE014161) (1138 aa) fasta scores:
FT                   E()=0, 98.682% id in 1138 aa"
FT                   /db_xref="GOA:A2RDG4"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013812"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG4"
FT                   /protein_id="CAM29889.1"
FT                   /translation="MTPDSKEQTVTGYQCHYIDQEGRKQPFNQGWRFLMADVACAQAPS
FT                   FDDSNWQVIHLPHDFSLTQPYTRNGEAESAYKLGGVGWYRHYLVLDEVLAGCHVAITFE
FT                   GSYMETEIYVNGQFIGKHLNGYQEFTYDISDVVTFGAENLLAVRVENKVPSSRWYSGSG
FT                   LYREVSLSVLPQLHFVADQVAMTLADTAVQEKGQQKVDLRFALNQSIQTCHYQLSLCLW
FT                   EQSHCSKDKKLLYQETEVPLADLAFQRQYGLTLSLEELQLWSPDNPHLYDLELTLYYQG
FT                   QVIDCFCLETGFRQLTFTANQGLFVNGRAVKLKGVCLHHDQGGLGACAYEDALARQLVL
FT                   LKDMGANTIRSTHNPSSPKLRQLANRLGFFVIEEAFDTWTYAKNGNVNDFSNYFHQTIG
FT                   TENANYLQRVRSPETSWAQYSIEAMVWSAKNDPSVLMWSIGNELMEGFSADVSHYPELT
FT                   RQMCQWIAAIDTSRPITFGDNKLKEADFCWHEEVSQMATLLSQLDHPQGLIGLNYANGK
FT                   DYDKLHEEHSDWLLYGSETVSAITSRAYYKETKKVLDSGYHLTSYDHAKVDWGAFASQA
FT                   WYDTITRDFVAGECVWTGFDYLGEPTPWNKIDSGVVGLWPSPKNAYFGILDTAGFPKDS
FT                   YYFYQSQWAQGQTTLHLLPVWQKDQLCFDEQGLVEVVVYSNAASVQLMFEDEQGNLTDY
FT                   GRKAFHTYSTPTGHTYQLYQGADAAKNPHENLYLTWRVPYQKGLLRAVAYDISGKSIPK
FT                   TSGRSQVRTYGSVAKLSWKAFEAPIDAPWELLYLDLSLLDSRGELVSHAQDWLQVQVEG
FT                   PARLLALDNGNPTDHTPYQEPLRQAYGGKLLAILALTGEAGHIKVTAKVSQQLSSVFQT
FT                   QVACRAPKEHLVTLPLEKYQFKKSRLTSQQEIGQSCLKTTQFLSVLENKDTQQKAGKVS
FT                   TPHILITSYQHYLSLPLQVCSQAFDFKKGDDIFLPQWLQLKDAQGSFVKKAFPMTWYLK
FT                   EKIFAKPILVTGYVSCFGQSIPVEARLNLAQASKRRHQDLSLVAKQSLAASQKRLTYCY
FT                   QYDTVQAIGAISFQNHTGTSLSVSVAISYGSQSSIKQETLMLADSHLSQLEEVIFFDDI
FT                   LTVLYLAVTLEVIEGPDLTEDSIQIGLWDLA"
FT   misc_feature    575694..576155
FT                   /locus_tag="SpyM50551"
FT                   /note="HMMPfam hit to PF02837, Glycosyl hydrolases family
FT                   2, sugar b, score 6.9e-56"
FT                   /inference="protein motif:HMMPfam:PF02837"
FT   misc_feature    576162..576515
FT                   /locus_tag="SpyM50551"
FT                   /note="HMMPfam hit to PF00703, Glycosyl hydrolases family
FT                   2, immunog, score 0.00083"
FT                   /inference="protein motif:HMMPfam:PF00703"
FT   misc_feature    576519..577535
FT                   /locus_tag="SpyM50551"
FT                   /note="HMMPfam hit to PF02836, Glycosyl hydrolases family
FT                   2, TIM bar, score 7.9e-09"
FT                   /inference="protein motif:HMMPfam:PF02836"
FT   misc_feature    577860..577883
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)"
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    578325..578390
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1016.000, SD 2.65 at aa 898-919, sequence
FT                   TSQQEIGQSCLKTTQFLSVLEN"
FT   CDS             579188..580066
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="SpyM50552"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="GOA:A2RDG5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG5"
FT                   /protein_id="CAM29890.1"
FT                   /translation="MSERLSGHTLLVSLLATPIRHSLSPKMHNEAYAKLGLDYAYLAFE
FT                   VGTEQLADAVQGIRALGIRGSNVSMPNKEAILPLLDDLSPAAELVGAVNTVVNKDGKGH
FT                   LVGHITDGIGALRALADEGVSVKNKIITLAGVGGTGKAIAVQLAFDGAKEIRLFNRQAT
FT                   RLSSVQKLVTKLNQLTRTKVTLQDLEDQTAFKEAIRESHLFIDATSVGMKPLENLSLIT
FT                   DPELIRPDLVVFDIVYSPAETKLLAFARQHGAQKVINGLGMVLYQGAEAFKLITGQDMP
FT                   VDAIKPLLGDE"
FT   misc_feature    579266..580021
FT                   /gene="aroE"
FT                   /locus_tag="SpyM50552"
FT                   /note="HMMPfam hit to PF01488, Shikimate / quinate
FT                   5-dehydrogenase, score 2e-73"
FT                   /inference="protein motif:HMMPfam:PF01488"
FT   misc_feature    580028..580057
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS             580318..581073
FT                   /transl_table=11
FT                   /locus_tag="SpyM50553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:A2RDG6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG6"
FT                   /protein_id="CAM29891.1"
FT                   /translation="MVTKEVGHDFLARLGKKRLRPGGVEATNWLIDQGQFSQDCHVLEV
FT                   ACNRCTTAIELAKTFGCQIDAVDLNPKVVKEAQERVAVEGLTRHITVSQANALSLPFPD
FT                   NHFDIVINEAMLTMLNAQAKEKALNEYWRVLKPGGRLLTHDVAYEDPKTRQVLDELRQT
FT                   IHVNVAPLSLTGWQALYQEHGFSQVTYHHGKISLMTPRGMIKDEGLMNTLNIMRRGLKK
FT                   ENRQQFLKMRRFFTRTGKNLCYIAVKSVK"
FT   CDS             581126..581464
FT                   /transl_table=11
FT                   /locus_tag="SpyM50554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG7"
FT                   /protein_id="CAM29892.1"
FT                   /translation="MSYINNIEHAKVLDLTQEVMIEQDQMLSRTLVQRQDLGITVFSLD
FT                   KGQEIGRHSSPGDAMVTILSGLAEITIDQETYRVAEGQTIVMPAAIPHALYAVEAFQML
FT                   LVVVKPEA"
FT   CDS             581466..581771
FT                   /transl_table=11
FT                   /locus_tag="SpyM50555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG8"
FT                   /protein_id="CAM29893.1"
FT                   /translation="MIENLSQLVQYHDHQVASRSLSRLLGLSQSIVLYAMAQGESISQE
FT                   TSPRDKVILILEGQLIFDLEDQKQVLTQESLIAIPAQKVHHLEAKTDCKLLQVLLD"
FT   CDS             581791..581937
FT                   /transl_table=11
FT                   /locus_tag="SpyM50556"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDG9"
FT                   /protein_id="CAM29894.1"
FT                   /translation="MGGLWKSKREGDAHLLFLRIQSDDNTNFKAWLSHLQIKPFSLVYF
FT                   RIH"
FT   CDS             complement(582207..583280)
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="SpyM50557"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="GOA:A2RDH0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /protein_id="CAM29895.1"
FT                   /translation="MPQTLHVHSRVKDYDILFTNHVLKTLADCLGERKQRKLLFITDQT
FT                   VYHLYQTLFEEFAQQYNAFVHVCPPGGQSKSLERVSAIYDQLIAENFSKKDMIVTIGGG
FT                   VVGDLGGFVAATYYRGIPYIQIPTTLLSQVDSSIGGKVGVHFKGLTNMIGSIYPPEAII
FT                   ISTTFLETLPQREFSCGISEMLKIGFIHDRPLFQQLRDFQKETDKQGLERLIYQSISNK
FT                   KRIVEQDEFENGLRMSLNFGHTLGHAIESLCHHDFYHHGEAIAIGMVVDAKLAVSKGLL
FT                   PKEDLDSLLQVFERYQLPTTLERADVSATSLFDVFKTDKKNSEQHIIFILPTETGFTTL
FT                   AINKDDHQFVEKLDSLL"
FT   misc_feature    complement(582312..583229)
FT                   /gene="aroB"
FT                   /locus_tag="SpyM50557"
FT                   /note="HMMPfam hit to PF01761, 3-dehydroquinate
FT                   synthase,score 1.7e-140"
FT                   /inference="protein motif:HMMPfam:PF01761"
FT   CDS             complement(583336..584088)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50558"
FT                   /product="DAHP synthetase I family protein"
FT                   /note="Similar to the C-terminal region of Bacillus
FT                   subtilis AroA(G) protein [Includes:
FT                   Phospho-2-dehydro-3-deoxyheptonate aldolase (EC 2.5.1.54)
FT                   (Phospho-2-keto-3-deoxyheptonate aldolase) (DAHP
FT                   synthetase) (3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   synthase); Chorismate mutase (EC 5.4.99.5)]
FT                   UniProt:AROG_BACSU (EMBL:AF008220) (G aa) fasta scores:
FT                   E()=1.3e-49, 54.251% id in 247 aa. Full length CDS is
FT                   similar to Streptococcus pyogenes putative chorismate
FT                   mutase UniProt:Q99YR4 (EMBL:AE006589) (250 aa) fasta
FT                   scores: E()=6e-96, 99.600% id in 250 aa"
FT                   /db_xref="GOA:A2RDH1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH1"
FT                   /protein_id="CAM29896.1"
FT                   /translation="MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNY
FT                   FRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGLLSVSEIMSERQLEEAYDYLDVIQV
FT                   GARNMQNFEFLKILSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGVRGY
FT                   DVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHP
FT                   DPDHALSDAAQQIDYKQLEQLGQELWQD"
FT   misc_feature    complement(583342..584070)
FT                   /locus_tag="SpyM50558"
FT                   /note="HMMPfam hit to PF00793, DAHP synthetase I
FT                   family,score 1.4e-81"
FT                   /inference="protein motif:HMMPfam:PF00793"
FT   tRNA            complement(584329..584399)
FT                   /gene="tRNA-Thr (GGT)"
FT                   /product="transfer RNA-Thr (GGT)"
FT                   /anticodon="(pos:584365..584367,aa:Thr)"
FT   CDS             584566..584820
FT                   /transl_table=11
FT                   /locus_tag="SpyM50559"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR015026"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH2"
FT                   /protein_id="CAM29897.1"
FT                   /translation="MSYEKEFLKDFEDWVKTQIQVNQLAMATSQEVAQEDGDERAKDAF
FT                   IRYESKLDAYEFLLGKFDNYKNGKAFHDIPDELFGARHY"
FT   CDS             584884..585237
FT                   /transl_table=11
FT                   /locus_tag="SpyM50560"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2RDH3"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH3"
FT                   /protein_id="CAM29898.1"
FT                   /translation="MKRNGLLKKAGQVFDKAVESVETAVDKTISAGKNLVEKGSQTVEN
FT                   LTASKERLTLDEFAGQPVVAGIRSDLVETLYAEGIHSAQAFKEWTEKDLLALKGIGPAT
FT                   VKKLVENGASFKK"
FT   CDS             join(585522..585600,585603..585841)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="sag0443"
FT                   /locus_tag="SpyM50562"
FT                   /note="Probable gene remnant. Similar to the C-terminal
FT                   region of Streptococcus agalactiae (serotype V)
FT                   acetyltransferase, GNAT family UniProt:Q8E1B7
FT                   (EMBL:AE014212) (194 aa) fasta scores: E()=5.8e-26,78.889%
FT                   id in 90 aa"
FT                   /db_xref="PSEUDO:CAM29899.1"
FT   CDS             585838..586401
FT                   /transl_table=11
FT                   /locus_tag="SpyM50563"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH5"
FT                   /protein_id="CAM29900.1"
FT                   /translation="MNLIIIGAQASGKMTIGQEVARQTGMTLFHNHDSIDFVLRFMPWS
FT                   QESTALIERIRFAFFETFAKTGQDMIFTIVIDFNDPNDVAMLEKIQAVFQSYDQEVLFV
FT                   ELKTDIEERLKRNRTENRLKHKPLKRNIEWSEQDIQSTMAYAVFNPEEPPKTLTHYQKI
FT                   NNTHLTAAETAQLIIQKMTHIKEN"
FT   CDS             586403..589051
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="SpyM50564"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="GOA:A2RDH6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH6"
FT                   /protein_id="CAM29901.1"
FT                   /translation="MTELSPKYNPAEVEAGRYQKWLDADVFKPSGDQKAKPYSIVIPPP
FT                   NVTGKLHLGHAWDTTLQDIIIRQKRMQGFDTLWLPGMDHAGIATQAKVEERLREQGISR
FT                   YDLGRDKFLDKVWEWKDEYATTIKEQWGKMGLSVDYSRERFTLDEGLSKAVRKVFVDLY
FT                   KKGWIYRGEFIINWDPAARTALSDIEVVHKDVEGAFYHMNYMLEDGSRALQVATTRPET
FT                   MFGDVAVAVNPEDPRYKDLIGKHVILPIVNKLIPIVGDEHADPEFGTGVVKITPAHDPN
FT                   DFEVGQRHNLPQVNVMNDDGTMNELAGDFAGMDRFEARQATVAKLEELGALVNIEKRVH
FT                   SVGHSERSGAVVEPRLSTQWFVKMDELAKQAMDNQETDDRVDFYPPRFNDTFLQWMENV
FT                   HDWVISRQLWWGHQIPAWYNAEGEIYVGEEAPEGDGWTQDEDVLDTWFSSALWPFSTMG
FT                   WPDTDVEDFKRYFPTSTLVTGYDIIFFWVSRMIFQSLEFTGRQPFQNVLIHGLIRDEEG
FT                   RKMSKSLGNGIDPMDVIEKYGADSLRWFLSNGSAPGQDVRFSYEKMDASWNFINKIWNI
FT                   SRYILMNNEGLTLEEAESNVAKVAASEAGNVTDQWILHNLNETIAKVTENFDKFEFGVA
FT                   GHILYNFIWEEFANWYVELTKEVLYSDNEAEKVITRSVLLYTLDKILRLLHPIMPFVTE
FT                   EIYAQYAQGSIVTVDYPTVTPAFENEAAHKGVESLKDLIRAVRNARAEVNVAPSKPITI
FT                   LVKTADSELEDFFTSNVNYIKRFTNPEKLEISSAIAVPELAMTSIITGAEIYLPLADLL
FT                   NVEEELARLDKELAKWQKELDMVGKKLGNERFVANAKPEVVQKEKDKQADYQAKYDATQ
FT                   ERIAEMQKLVK"
FT   misc_feature    586448..588079
FT                   /gene="valS"
FT                   /locus_tag="SpyM50564"
FT                   /note="HMMPfam hit to PF00133, tRNA synthetases class I (I,
FT                   L, M and V), score 1.2e-282"
FT                   /inference="protein motif:HMMPfam:PF00133"
FT   misc_feature    586535..586570
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00178"
FT   CDS             complement(589268..590122)
FT                   /transl_table=11
FT                   /locus_tag="SpyM50565"
FT                   /product="hypothetical protein"
FT                   /note="Possible alternative translational start site"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH7"
FT                   /protein_id="CAM29902.1"
FT                   /translation="MHVFLLEKNFLYVIIIMNRNQKENGMLNSDFIISKSLANYIHHRR
FT                   LEVGVSSTDLAEISNMSKSDWESFEKNGGAIPLKSKDIILDLLFLERFPKEKECDFIDK
FT                   LFEEAKENKLWPEKIYQTMGLTPALSFIAGCEILSDDINNDLEELSKLPKESHLGQLDT
FT                   SLLLSLLPQQFITKYDYEFVYKLSKVLAQYTSRNKVGSPYTAHSVIEEICLYLIAKESI
FT                   LYFESLDENSHLQLKELLDYNDEWPFDIFDDMDSYTFLYTDIYIEEDSLYHFKNWFVPQ
FT                   FYL"
FT   misc_feature    complement(589910..589975)
FT                   /note="Predicted helix-turn-helix motif with score 989.000,
FT                   SD 2.56 at aa 55-76, sequence VSSTDLAEISNMSKSDWESFEK"
FT   CDS             590442..591422
FT                   /transl_table=11
FT                   /locus_tag="SpyM50566"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="GOA:A2RDH8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH8"
FT                   /protein_id="CAM29903.1"
FT                   /translation="MHDKGVRMAKVRYGIVSTAQVAPRFIEGVRLAGNGEVVAVSSRSL
FT                   DKAKAFATAHQLPKAYGSLDDMLLDASIDAIYVASINQDHFPAAKKALLAGKHVLVEKP
FT                   FTLTAAQAEELFALAQERGLFLMEAQKAVFIPMTQRLKGLIAAGELGDIVSVSSTTAYP
FT                   NIDHVTWFRDLEKGGGTVHFMAPYALSYLPYLFDADIVSASGVAHFPKGQSDSQSKLVL
FT                   ALSNGVLVDIFLTTHLSLPHELVIYGTKGRLEIPHFWKTTQATLVRPDGSRSVIEAIMS
FT                   SDFEAEAHHVSQMILEGQLTSPVMTKSLTLSGVGLIEKLYRSWGK"
FT   misc_feature    590472..590831
FT                   /locus_tag="SpyM50566"
FT                   /note="HMMPfam hit to PF01408, Oxidoreductase
FT                   family,NAD-binding Ros, score 1.9e-37"
FT                   /inference="protein motif:HMMPfam:PF01408"
FT   misc_feature    590865..591185
FT                   /locus_tag="SpyM50566"
FT                   /note="HMMPfam hit to PF02894, Oxidoreductase
FT                   family,C-terminal alph, score 0.0087"
FT                   /inference="protein motif:HMMPfam:PF02894"
FT   CDS             591514..592446
FT                   /transl_table=11
FT                   /locus_tag="SpyM50567"
FT                   /product="CorA-like Mg2+ transporter protein"
FT                   /db_xref="GOA:A2RDH9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDH9"
FT                   /protein_id="CAM29904.1"
FT                   /translation="MPTLPKASSAITLINLDQLTEHDQEALVSEGLIDAEVFDYAKDKN
FT                   ETSFMEENKEKLTIVFQILDRQEESYHPNYIPRVIPITLFLNDQSLYILGHDHSLTLIE
FT                   EVFPDLDESRSPRHLVFQLLTAFTKQYVPLMDEIAQQRDKLIEALRQKANKTNLESLAN
FT                   LQSGTVYILMGSKQNEQMLAELKDMPGQQDLEEDEAEQLRDAIIEARQLSNMCDLNTRV
FT                   LKEISSSYNNVLSNNLNNNVTSLTIFSIGISIIAMVTSFYGMNVKLPFAKVDSVWFWIV
FT                   LTTSLVALLIMVVMYWYVHKRNRNASKRI"
FT   misc_feature    591535..592428
FT                   /locus_tag="SpyM50567"
FT                   /note="HMMPfam hit to PF01544, CorA-like Mg2+ transporter
FT                   protein, score 3.7e-06"
FT                   /inference="protein motif:HMMPfam:PF01544"
FT   misc_feature    order(592231..592299,592342..592410)
FT                   /locus_tag="SpyM50567"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50567 by TMHMM2.0 at aa 240-262 and 277-299"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             592666..593376
FT                   /transl_table=11
FT                   /locus_tag="SpyM50568"
FT                   /product="putative cytochrome c-type biogenesis protein"
FT                   /db_xref="GOA:A2RDI0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI0"
FT                   /protein_id="CAM29905.1"
FT                   /translation="MTLSLVLMVSVFGAGLLSFFSPCIFPVLPVYLGILLDADDSKTIT
FT                   IFGKKLYWYGIVKTLAFIFGLSTIFVILGYGAGFLGNILYAVWFRYLLGALVIILGIHQ
FT                   MGLITIKSLQFQKSLTFHNDKNRNGLLNAFILGLTFSFGWTPCVGPVLSSVLALVASGG
FT                   NGAWQGGLLMIVYTLGLGIPFLLLSFASGFVLKHFNKLKPHMLLLKKVGGVLIIVMGIL
FT                   LMTGTLNNLAQLFG"
FT   sig_peptide     592666..592779
FT                   /locus_tag="SpyM50568"
FT                   /note="Signal peptide predicted for SpyM50568 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.922) with cleavage
FT                   site probability 0.726 between residues 38 and 39"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(592693..592761,592816..592884,592927..592995,
FT                   593053..593121,593179..593247,593281..593349)
FT                   /locus_tag="SpyM50568"
FT                   /note="6 probable transmembrane helices predicted for
FT                   SpyM50568 by TMHMM2.0 at aa 10-32,
FT                   51-73,88-110,130-152,172-194 and 206-228"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    592696..593340
FT                   /locus_tag="SpyM50568"
FT                   /note="HMMPfam hit to PF02683, Cytochrome C biogenesis
FT                   protein transmembran, score 2.6e-61"
FT                   /inference="protein motif:HMMPfam:PF02683"
FT   misc_feature    593083..593112
FT                   /note="PS00086 Cytochrome P450 cysteine heme-iron ligand
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00086"
FT   CDS             593389..594012
FT                   /transl_table=11
FT                   /locus_tag="SpyM50569"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:A2RDI1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI1"
FT                   /protein_id="CAM29906.1"
FT                   /translation="MKKGLLVTTGLACLGLLTACSTQDNMAKKEITQDKMSMAAKKKDK
FT                   MSTSKDKSMMADKSSDKKMTNDGPMAPDFELKGIDGKTYRLSEFKGKKVYLKFWASWCS
FT                   ICLSTLADTEDLAKMSDKDYVVLTVVSPGHQGEKSEADFKKWFQGTDYKDLPVLLDPDG
FT                   KLLGAYGVRSYPTEVFIGSDGVLAKKHIGYVKKSDIKKTLKGIH"
FT   sig_peptide     593389..593475
FT                   /locus_tag="SpyM50569"
FT                   /note="Signal peptide predicted for SpyM50569 by SignalP
FT                   2.0 HMM (Signal peptide probability 1.000) with cleavage
FT                   site probability 0.641 between residues 29 and 30"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    593416..593448
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site"
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             594055..595161
FT                   /transl_table=11
FT                   /gene="msrAB"
FT                   /locus_tag="SpyM50570"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="C-terminal region is similar to SpyM50988, 52.174%
FT                   identity (52.174% ungapped) in 138 aa overlap"
FT                   /db_xref="GOA:A2RDI2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI2"
FT                   /protein_id="CAM29907.1"
FT                   /translation="MEHKWKLWLFIVGVVLLIGGASVLIQKGQAKAFSQGKPQLPAKKV
FT                   KSTKVDPNAPVDQKVIYLAGGCFWGVEEYFSQVDGVLDAVSGYANGRGDTTNYQLIHQT
FT                   GHAETVEVTYDANRISLKELLLHFFRIIDPTSLNKQGNDRGSQYRTGIYYTDKADLAII
FT                   DEVFKEKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNGYCHIDINQATYPVIDES
FT                   KYPKPSATEIKAKLSADEYRVTQKNETEKAFSNRYWDSFDAGIYVDVVTGEPLFSSKDK
FT                   FESGCGWPSFSRPVSPDVIRYKEDKSFNMTRTEVRSRSGDSHLGHVFTDGPKDQGGLRY
FT                   CINSLSITFIPKVDMEAKGYGYLLSSVE"
FT   sig_peptide     594055..594150
FT                   /gene="msrAB"
FT                   /locus_tag="SpyM50570"
FT                   /note="Signal peptide predicted for SpyM50570 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.990) with cleavage
FT                   site probability 0.697 between residues 32 and 33"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    594073..594132
FT                   /gene="msrAB"
FT                   /locus_tag="SpyM50570"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50570 by TMHMM2.0 at aa 7-26"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    594229..594690
FT                   /gene="msrAB"
FT                   /locus_tag="SpyM50570"
FT                   /note="HMMPfam hit to PF01625, Peptide methionine sulfoxide
FT                   reductase, score 5e-88"
FT                   /inference="protein motif:HMMPfam:PF01625"
FT   misc_feature    594739..595110
FT                   /gene="msrAB"
FT                   /locus_tag="SpyM50570"
FT                   /note="HMMPfam hit to PF01641, SelR domain, score 2.2e-80"
FT                   /inference="protein motif:HMMPfam:PF01641"
FT   CDS             595249..595989
FT                   /transl_table=11
FT                   /locus_tag="SpyM50571"
FT                   /product="response regulator protein"
FT                   /db_xref="GOA:A2RDI3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI3"
FT                   /protein_id="CAM29908.1"
FT                   /translation="MYSLLIVEDEYLVRQGIRSLVDFSQFKIDRVNEAENGQLAWDLFQ
FT                   KEPYDIVLTDINMPKLNGIQLAELIKQESPQTHLVFLTGYDDFNYALSALKLGADDYLL
FT                   KPFSKADVEDMLGKLRKKLELSKKTETIQELVEQPQKEVSAIAMAIHERLADSDLTLKS
FT                   LAQQLGFSPNYLSVLIKKELGMPFQDYLVQERLKKAKLLLLTSNLKIYEIAEQVGFEDM
FT                   NYFSQRFKQLVGVTPSQYKKGGQA"
FT   misc_feature    595252..595620
FT                   /locus_tag="SpyM50571"
FT                   /note="HMMPfam hit to PF00072, Response regulator receiver
FT                   domain, score 2.4e-32"
FT                   /inference="protein motif:HMMPfam:PF00072"
FT   misc_feature    595684..595824
FT                   /locus_tag="SpyM50571"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 1.1e-08"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   misc_feature    595723..595788
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1909.000, SD 5.69 at aa 159-180, sequence
FT                   LTLKSLAQQLGFSPNYLSVLIK"
FT   misc_feature    595831..595959
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature"
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    595840..595974
FT                   /locus_tag="SpyM50571"
FT                   /note="HMMPfam hit to PF00165, Bacterial regulatory
FT                   helix-turn-helix pr, score 1.1e-11"
FT                   /inference="protein motif:HMMPfam:PF00165"
FT   CDS             595986..597719
FT                   /transl_table=11
FT                   /locus_tag="SpyM50572"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="GOA:A2RDI4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI4"
FT                   /protein_id="CAM29909.1"
FT                   /translation="MKRYPLLVQLISYVFVIVIALITTLGLLYYQTSSRNIRQLIERDT
FT                   RQSIRQSSQFIDAYIKPLKETTSVLAKNSEIQDFASQIHQENDKQVLQLMKMVLATNSD
FT                   LQAAVLVTKDGRTVSTNPQLTMKTSSDMMAETWYKAAIDRQAMPVLTPARQLSLSSKKE
FT                   WVVSVTQEVVDAAGHNLGVLRLDIAYPTIKASLDQLQLGRQGFAFIVNDKHEFVYHPKK
FT                   SVYSSSKEMAAMKPYLAIQNGYTKDKTFFVYQKLIPNSQWTLVGVASLDQLHRVQRQIF
FT                   WSFLGMGLLACLICGLTTILVLRKWIRPIQQLQQVILAIQKGDRQLRAQETGSPELTDL
FT                   AQQFNALLDQIDSLMVAVADKEKAIGQYRLQALASQINPHFLYNTLDTIIWMAEFNDSK
FT                   RVVEVTKSLAKYFRLALNQGNEYIRLADELDHVSQYLFIQKQRYGDKLSYEVQGLDVYA
FT                   DFVIPKLILQPLVENAIYHGIKEVDRKGMIKVTVSDTAQHLMLTVWDNGKGIEDSSLTN
FT                   SQSLLARGGVGLKNVDQRLKLHYGEGYHMTIHSQSDHFTEIQLSLPKMHELMADDTQEN
FT                   E"
FT   sig_peptide     595986..596090
FT                   /locus_tag="SpyM50572"
FT                   /note="Signal peptide predicted for SpyM50572 by SignalP
FT                   2.0 HMM (Signal peptide probability 0.682) with cleavage
FT                   site probability 0.340 between residues 35 and 36"
FT                   /inference="protein motif:SignalP:2.0"
FT   misc_feature    order(596013..596072,596826..596894)
FT                   /locus_tag="SpyM50572"
FT                   /note="2 probable transmembrane helices predicted for
FT                   SpyM50572 by TMHMM2.0 at aa 10-29 and 281-303"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    596430..596681
FT                   /locus_tag="SpyM50572"
FT                   /note="HMMPfam hit to PF02743, Cache domain, score 1.9e-17"
FT                   /inference="protein motif:HMMPfam:PF02743"
FT   misc_feature    596835..597044
FT                   /locus_tag="SpyM50572"
FT                   /note="HMMPfam hit to PF00672, HAMP domain, score 5.5e-13"
FT                   /inference="protein motif:HMMPfam:PF00672"
FT   misc_feature    597090..597341
FT                   /locus_tag="SpyM50572"
FT                   /note="HMMPfam hit to PF06580, Histidine kinase, score
FT                   2.3e-43"
FT                   /inference="protein motif:HMMPfam:PF06580"
FT   misc_feature    597357..597680
FT                   /locus_tag="SpyM50572"
FT                   /note="HMMPfam hit to PF02518, Histidine kinase-, DNA
FT                   gyrase B-, and HSP9, score 4.3e-15"
FT                   /inference="protein motif:HMMPfam:PF02518"
FT   CDS             597792..598871
FT                   /transl_table=11
FT                   /locus_tag="SpyM50573"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI5"
FT                   /protein_id="CAM29910.1"
FT                   /translation="MNLATDYFSRQTPIVEKLVAYGFEKRDNGYFYNERFMEGEFEAQL
FT                   RIDEAGNIWDRVIDCDLEEDYLPLQQAAWQGTYTGQVRAAYLELLERLSVACFEVTPFQ
FT                   SMQANRLAKHITKEWSDPMDYPFEKHPDLATYRVEGKWYAMIFSLLADKLDQIPERLVG
FT                   QTCEVMTVKVNPKDLPQLLQQEGIYPAYHMSKKNWISIILDDKVTDDKLWTLVTQSRQL
FT                   VNPNGLSNPNGPDYWVIPANLKYYDIDAEFAANDVILWTQKAGIAVGDYVLIYMTAPVK
FT                   SIRYVCQVLETNIPNEGYRKNPNIDKLMRLRKCQQYKDGLLSFDLMKKHGVAAVRGPRR
FT                   LSPQLIAFLKEKEYLKENN"
FT   misc_feature    598134..598463
FT                   /locus_tag="SpyM50573"
FT                   /note="HMMPfam hit to PF04237, Protein of unknown function
FT                   (DUF419), score 2.1e-62"
FT                   /inference="protein motif:HMMPfam:PF04237"
FT   misc_feature    598185..598226
FT                   /note="PS00213 Lipocalin signature"
FT                   /inference="protein motif:Prosite:PS00213"
FT   CDS             598894..599610
FT                   /transl_table=11
FT                   /locus_tag="SpyM50574"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:A2RDI6"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI6"
FT                   /protein_id="CAM29911.1"
FT                   /translation="MVEFVADQSFWELFPDAKLGVVLLKDVQNQAESPEDVKQLLADSH
FT                   ELAKAYLTADNFSDNQVVQVYRKAYQHFKTKKGARSSIEALLKRVSNGQSIPSINPLVD
FT                   IYNAASLRFGLPVGAEDSDSFIGDLRLTTTDGGDDFYLIGDADNNPTLPNELCYKDDIG
FT                   AVCRCLNWRDGERTMVTEHTKNAFLIIEALDQEGQNRLQEALDFIEGSAKMYLHAITSV
FT                   HVLDKDNPHVPLFTEN"
FT   misc_feature    599083..599529
FT                   /locus_tag="SpyM50574"
FT                   /note="HMMPfam hit to PF03483, B3/4 domain, score 4.7e-32"
FT                   /inference="protein motif:HMMPfam:PF03483"
FT   CDS             complement(599776..600249)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="SpyM50575"
FT                   /product="arginine repressor"
FT                   /db_xref="GOA:A2RDI7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI7"
FT                   /protein_id="CAM29912.1"
FT                   /translation="MNKKETRHQLIRSLISETTIHTQQELQERLQKNGITITQATLSRD
FT                   MKELNLVKVTSGNDTHYEALAISQTRWEHRLRFYMEDALVMLKIVQHQIILKTLPGLAQ
FT                   SFGSILDAMQIPEIVATVCGDDTCLIVCEDNEQAKACYETLSHYTPPFFFSNK"
FT   misc_feature    complement(599806..600015)
FT                   /gene="argR"
FT                   /locus_tag="SpyM50575"
FT                   /note="HMMPfam hit to PF02863, Arginine
FT                   repressor,C-terminal domain, score 7.6e-27"
FT                   /inference="protein motif:HMMPfam:PF02863"
FT   misc_feature    complement(600037..600246)
FT                   /gene="argR"
FT                   /locus_tag="SpyM50575"
FT                   /note="HMMPfam hit to PF01316, Arginine repressor, DNA
FT                   binding domai, score 1.9e-23"
FT                   /inference="protein motif:HMMPfam:PF01316"
FT   CDS             600391..601071
FT                   /transl_table=11
FT                   /locus_tag="SpyM50576"
FT                   /product="Crp family regulatory protein"
FT                   /db_xref="GOA:A2RDI8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDI8"
FT                   /protein_id="CAM29913.1"
FT                   /translation="MIRREDYQYLRKLNDFRYFSIEQFDKIVGQMEFRKAKKDHILFFE
FT                   GDKRDKLFLVTSGYFKVEQSDQSGTFMYTDFIRHGTIFPYGGLFTDDYYHFSVVAMTDV
FT                   TYFYFPVDLFEDYSLENRLQMKHLYSKMSKLLELHELRVRNLITSSASSRVIQSLAILL
FT                   VEMGKDSDTLPFQLTTTDIAQISGTTRETVSHVLRDLKKQELITIKGKYLTYLDKDYFL
FT                   QYTK"
FT   misc_feature    600478..600759
FT                   /locus_tag="SpyM50576"
FT                   /note="HMMPfam hit to PF00027, Cyclic nucleotide-binding
FT                   domain, score 1.1e-12"
FT                   /inference="protein motif:HMMPfam:PF00027"
FT   misc_feature    600913..601008
FT                   /locus_tag="SpyM50576"
FT                   /note="HMMPfam hit to PF00325, Bacterial regulatory
FT                   proteins, crp famil, score 9.2e-07"
FT                   /inference="protein motif:HMMPfam:PF00325"
FT   misc_feature    600919..600984
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2085.000, SD 6.29 at aa 177-198, sequence
FT                   LTTTDIAQISGTTRETVSHVLR"
FT   CDS             601345..602580
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="SpyM50577"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /db_xref="GOA:P58827"
FT                   /db_xref="InterPro:IPR003198"
FT                   /db_xref="InterPro:IPR003876"
FT                   /protein_id="CAM29914.1"
FT                   /translation="MTAQTPIHVYSEIGKLKKVLLHRPGKEIENLMPDYLERLLFDDIP
FT                   FLEDAQKEHDAFAQALRDEGIEVLYLETLAAESLVTPEIREAFIDEYLSEANIRGRATK
FT                   KAIRELLMAIEDNQELIEKTMAGVQKSELPEIPASEKGLTDLVESNYPFAIDPMPNLYF
FT                   TRDPFATIGTGVSLNHMFSETRNRETLYGKYIFTHHPIYGGGKVPMVYDRNETTRIEGG
FT                   DELVLSKDVLAVGISQRTDAASIEKLLVNIFKQNLGFKKVLAFEFANNRKFMHLDTVFT
FT                   MVDYDKFTIHPEIEGDLRVYSVTYDNEELHIIEEKGDLAELLAANLGVEKVDLIRCGGD
FT                   NLVAAGREQWNDGSNTLTIAPGVVVVYNRNTITNAILESKGLKLIKIHGSELVRGRGGP
FT                   RCMSMPFEREDI"
FT   misc_feature    601375..602568
FT                   /gene="arcA"
FT                   /locus_tag="SpyM50577"
FT                   /note="HMMPfam hit to PF02274, Amidinotransferase, score
FT                   2.2e-197"
FT                   /inference="protein motif:HMMPfam:PF02274"
FT   CDS             602680..603108
FT                   /transl_table=11
FT                   /locus_tag="SpyM50578"
FT                   /product="acetyltransferase (GNAT) family protein"
FT                   /db_xref="GOA:A2RDJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDJ0"
FT                   /protein_id="CAM29915.1"
FT                   /translation="MADKFDANDETRTVYAVVYDNDQPVSTGQFLAETKIEARLTRIVT
FT                   LADYCGCGYGAKVTEALETYTRREGFYQLTIHSELTAQTFYENLGYQTYGPKCLEDGEY
FT                   CQSLAKTILKWEKNMDIAMLIAIVGGLLGCYLYLTKNN"
FT   misc_feature    602725..602955
FT                   /locus_tag="SpyM50578"
FT                   /note="HMMPfam hit to PF00583, Acetyltransferase (GNAT)
FT                   family, score 1.6e-06"
FT                   /inference="protein motif:HMMPfam:PF00583"
FT   misc_feature    603040..603093
FT                   /locus_tag="SpyM50578"
FT                   /note="1 probable transmembrane helix predicted for
FT                   SpyM50578 by TMHMM2.0 at aa 121-138"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             603148..604161
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="SpyM50579"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="GOA:A2RDJ1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /protein_id="CAM29916.1"
FT                   /translation="MTQVFQGRSFLAEKDFTRAELEYLIDFSAHLKDLKKRGVPHHYLE
FT                   GKNIALLFEKTSTRTRAAFTTAAIDLGAHPEYLGANDIQLGKKESTEDTAKVLGRMFDG
FT                   IEFRGFSQRMVEELAEFSGVPVWNGLTDEWHPTQMLADYLTVKENFGKLEGLTLVYCGD
FT                   GRNNVANSLLVTGAILGVNVHIFSPKELFPEEEIVTLAEGYAKESGARILITEDADEAV
FT                   KGADVLYTDVWVSMGEEDKFKERVELLQPYQVNMDLVQKAGNDKLIFLHCLPAFHDTNT
FT                   VYGKDVAEKFGVKEMEVTDEVFRSKYARHFDQAENRMHTIKAVMAATLGNLFIPKV"
FT   misc_feature    603169..603597
FT                   /gene="arcB"
FT                   /locus_tag="SpyM50579"
FT                   /note="HMMPfam hit to PF02729, Aspartate/ornithine
FT                   carbamoyltransferase, ca, score 4.5e-70"
FT                   /inference="protein motif:HMMPfam:PF02729"
FT   misc_feature    603304..603327
FT                   /note="PS00097 Aspartate and ornithine
FT                   carbamoyltransferases signature"
FT                   /inference="protein motif:Prosite:PS00097"
FT   misc_feature    603604..604134
FT                   /gene="arcB"
FT                   /locus_tag="SpyM50579"
FT                   /note="HMMPfam hit to PF00185, Aspartate/ornithine
FT                   carbamoyltransferase, As, score 1.1e-79"
FT                   /inference="protein motif:HMMPfam:PF00185"
FT   CDS             604331..605824
FT                   /transl_table=11
FT                   /locus_tag="SpyM50580"
FT                   /product="C4-dicarboxylate anaerobic carrier protein"
FT                   /db_xref="GOA:A2RDJ2"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A2RDJ2"
FT                   /protein_id="CAM29917.1"
FT