spacer

EBI Dbfetch

ID   AM293569; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM293569;
XX
DT   25-JUL-2006 (Rel. 88, Created)
DT   18-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen,
DE   HLA-DQB1*0603XX allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*0603XX allele; human leukocyte antigen DQB1;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Tran H.;
RT   ;
RL   Submitted (21-JUL-2006) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00958.x.
RX   PUBMED; 17990990.
RA   Heinold A., Bauer M., Opelz G., Scherer S., Schmidt A.H., Tran T.H.;
RT   "Identification and characterization of three novel HLA alleles,
RT   HLA-A*240214, HLA-A*3215 and HLA-DQB1*060302";
RL   Tissue Antigens 70(6):511-514(2007).
XX
DR   MD5; a2494c1c06b72df5f38150fa3b2dd58e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0603XX"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q0VJC4"
FT                   /db_xref="IMGT/HLA:DQB1*06:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VJC4"
FT                   /protein_id="CAL25326.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0603XX"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 66 C; 98 G; 45 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtaccg cgcggtgacg ccgcaggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//


spacer
spacer