spacer

EBI Dbfetch

ID   AM292927; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AM292927;
XX
DT   24-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-B gene for MHC class I antigen, HLA-B*53new
DE   allele, exons 2-3
XX
KW   HLA-B gene; HLA-B*53new allele; human leucocyte antigen B;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Tran H.;
RT   ;
RL   Submitted (17-JUL-2006) to the INSDC.
RL   Tran H., Transplantation Immunology, University of Heidelberg, Im
RL   Neuenheimer Feld 305, Heidelberg 69120, GERMANY.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2007.00900.x.
RX   PUBMED; 17767554.
RA   Heinold A., Bauer M., Scherer S., Opelz G., Tran T.H.;
RT   "Characterization of a new HLA-B allele, HLA-B*5312, and re-evaluation of
RT   the published sequences of the untranslated regions of HLA-B*35 and
RT   HLA-B*53";
RL   Tissue Antigens 70(4):319-323(2007).
XX
DR   MD5; 54d11d3b2812a0d310d4222928c3b63b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /country="Germany"
FT                   /sex="male"
FT                   /cell_type="leucocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53new"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q0VKE5"
FT                   /db_xref="IMGT/HLA:B*53:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VKE5"
FT                   /protein_id="CAL24627.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRTALRYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*53new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 177 C; 185 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer