spacer

EBI Dbfetch

ID   AM286421; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM286421;
XX
DT   30-AUG-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens partial HLA-DQB1 gene for MHC class II antigen, HLA-DQB1*03
DE   variant allele, exon 2
XX
KW   HLA-DQB1 gene; HLA-DQB1*03 variant allele;
KW   major histocompatability complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Lafarge X.;
RT   ;
RL   Submitted (03-JUL-2006) to the INSDC.
RL   Lafarge X., Laboratoire d'Histocompatibilite, Etablissement Francais du
RL   Sang, Place Amelie Raba Leon BP24, 33035 Bordeaux Cedex, FRANCE.
XX
RN   [2]
RA   Lafarge X., Fizet D., Boiron J.;
RT   "Sequencing of a new HLA class II variant, DQB1*03 (codon 38, GCA->GCG)";
RL   Unpublished.
XX
DR   MD5; 8c53db452b02a36978fcc9222501dfa9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="A*24 B*51 DRB1*0405 DRB4*0103"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03 variant"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q0JW41"
FT                   /db_xref="IMGT/HLA:DQB1*03:02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q0JW41"
FT                   /protein_id="CAL15002.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
FT   exon            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 71 C; 95 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer