spacer

EBI Dbfetch

ID   AM286415; SV 1; circular; genomic DNA; STD; PRO; 4615899 BP.
XX
AC   AM286415;
XX
PR   Project:PRJNA190;
XX
DT   20-DEC-2006 (Rel. 90, Created)
DT   06-FEB-2015 (Rel. 123, Last updated, Version 9)
XX
DE   Yersinia enterocolitica subsp. enterocolitica 8081 complete genome
XX
KW   complete genome.
XX
OS   Yersinia enterocolitica subsp. enterocolitica 8081
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Yersinia.
XX
RN   [1]
RP   1-4615899
RA   Thomson N.R.;
RT   ;
RL   Submitted (30-JUN-2006) to the INSDC.
RL   Thomson N.R., Pathogen Sequencing Unit, The Wellcome Trust Sanger
RL   Institute, Genome Campus, Hinxton, Cambridge, CB10 1SA, UNITED KINGDOM.
XX
RN   [2]
RX   DOI; 10.1371/journal.pgen.0020206.
RX   PUBMED; 17173484.
RA   Thomson N.R., Howard S., Wren B.W., Holden M.T.G., Crossman L.,
RA   Challis G.L., Churcher C., Mungall K., Brooks K., Chillingworth T.,
RA   Feltwell T., Abdellah Z., Hauser H., Jagels K., Maddison M., Moule S.,
RA   Sanders M., Whitehead S., Quail M.A., Dougan G., Parkhill J.,
RA   Prentice M.B.;
RT   "The complete genome sequence and comparative genome analysis of the high
RT   pathogenicity Yersinia enterocolitica strain 8081";
RL   PloS Genet. 2(12):e206-e206(2006).
XX
RN   [3]
RX   DOI; 10.1186/1471-2180-3-13.
RX   PUBMED; 12834539.
RA   Delihas N.;
RT   "Annotation and evolutionary relationships of a small regulatory RNA gene
RT   micF and its target ompF in Yersinia species";
RL   BMC Microbiol. 3:13-13(2003).
XX
DR   MD5; 1645852648e62a3cc4e296c0787c534b.
DR   BioSample; SAMEA1705958.
DR   EnsemblGenomes-Gn; EBG00000016359.
DR   EnsemblGenomes-Gn; EBG00000016360.
DR   EnsemblGenomes-Gn; EBG00000016361.
DR   EnsemblGenomes-Gn; EBG00000016362.
DR   EnsemblGenomes-Gn; EBG00000016363.
DR   EnsemblGenomes-Gn; EBG00000016364.
DR   EnsemblGenomes-Gn; EBG00000016365.
DR   EnsemblGenomes-Gn; EBG00000016366.
DR   EnsemblGenomes-Gn; EBG00000016367.
DR   EnsemblGenomes-Gn; EBG00000016368.
DR   EnsemblGenomes-Gn; EBG00000016369.
DR   EnsemblGenomes-Gn; EBG00000016370.
DR   EnsemblGenomes-Gn; EBG00000016371.
DR   EnsemblGenomes-Gn; EBG00000016372.
DR   EnsemblGenomes-Gn; EBG00000016373.
DR   EnsemblGenomes-Gn; EBG00000016374.
DR   EnsemblGenomes-Gn; EBG00000016375.
DR   EnsemblGenomes-Gn; EBG00000016376.
DR   EnsemblGenomes-Gn; EBG00000016377.
DR   EnsemblGenomes-Gn; EBG00000016378.
DR   EnsemblGenomes-Gn; EBG00000016379.
DR   EnsemblGenomes-Gn; EBG00000016380.
DR   EnsemblGenomes-Gn; EBG00000016381.
DR   EnsemblGenomes-Gn; EBG00000016382.
DR   EnsemblGenomes-Gn; EBG00000016383.
DR   EnsemblGenomes-Gn; EBG00000016384.
DR   EnsemblGenomes-Gn; EBG00000016385.
DR   EnsemblGenomes-Gn; EBG00000016386.
DR   EnsemblGenomes-Gn; EBG00000016387.
DR   EnsemblGenomes-Gn; EBG00000016388.
DR   EnsemblGenomes-Gn; EBG00000016389.
DR   EnsemblGenomes-Gn; EBG00000016390.
DR   EnsemblGenomes-Gn; EBG00000016391.
DR   EnsemblGenomes-Gn; EBG00000016392.
DR   EnsemblGenomes-Gn; EBG00000016393.
DR   EnsemblGenomes-Gn; EBG00000016394.
DR   EnsemblGenomes-Gn; EBG00000016395.
DR   EnsemblGenomes-Gn; EBG00000016396.
DR   EnsemblGenomes-Gn; EBG00000016397.
DR   EnsemblGenomes-Gn; EBG00000016398.
DR   EnsemblGenomes-Gn; EBG00000016399.
DR   EnsemblGenomes-Gn; EBG00000016400.
DR   EnsemblGenomes-Gn; EBG00000016401.
DR   EnsemblGenomes-Gn; EBG00000016402.
DR   EnsemblGenomes-Gn; EBG00000016403.
DR   EnsemblGenomes-Gn; EBG00000016404.
DR   EnsemblGenomes-Gn; EBG00000016405.
DR   EnsemblGenomes-Gn; EBG00000016406.
DR   EnsemblGenomes-Gn; EBG00000016407.
DR   EnsemblGenomes-Gn; EBG00000016408.
DR   EnsemblGenomes-Gn; EBG00000016409.
DR   EnsemblGenomes-Gn; EBG00000016410.
DR   EnsemblGenomes-Gn; EBG00000016411.
DR   EnsemblGenomes-Gn; EBG00000016412.
DR   EnsemblGenomes-Gn; EBG00000016413.
DR   EnsemblGenomes-Gn; EBG00000016414.
DR   EnsemblGenomes-Gn; EBG00000016415.
DR   EnsemblGenomes-Gn; EBG00000016416.
DR   EnsemblGenomes-Gn; EBG00000016417.
DR   EnsemblGenomes-Gn; EBG00000016418.
DR   EnsemblGenomes-Gn; EBG00000016419.
DR   EnsemblGenomes-Gn; EBG00000016420.
DR   EnsemblGenomes-Gn; EBG00000016421.
DR   EnsemblGenomes-Gn; EBG00000016422.
DR   EnsemblGenomes-Gn; EBG00000016423.
DR   EnsemblGenomes-Gn; EBG00000016424.
DR   EnsemblGenomes-Gn; EBG00000016425.
DR   EnsemblGenomes-Gn; EBG00000016426.
DR   EnsemblGenomes-Gn; EBG00000016427.
DR   EnsemblGenomes-Gn; EBG00000016428.
DR   EnsemblGenomes-Gn; EBG00000016429.
DR   EnsemblGenomes-Gn; EBG00000016430.
DR   EnsemblGenomes-Gn; EBG00000016431.
DR   EnsemblGenomes-Gn; EBG00000016432.
DR   EnsemblGenomes-Gn; EBG00000016433.
DR   EnsemblGenomes-Gn; EBG00000016434.
DR   EnsemblGenomes-Gn; EBG00000016435.
DR   EnsemblGenomes-Gn; EBG00000016436.
DR   EnsemblGenomes-Gn; EBG00000016437.
DR   EnsemblGenomes-Gn; EBG00000016438.
DR   EnsemblGenomes-Gn; EBG00000016439.
DR   EnsemblGenomes-Gn; EBG00000016440.
DR   EnsemblGenomes-Gn; EBG00000016441.
DR   EnsemblGenomes-Gn; EBG00000016442.
DR   EnsemblGenomes-Gn; EBG00000016443.
DR   EnsemblGenomes-Gn; EBG00000016444.
DR   EnsemblGenomes-Gn; EBG00000016445.
DR   EnsemblGenomes-Gn; EBG00000016446.
DR   EnsemblGenomes-Gn; EBG00000016447.
DR   EnsemblGenomes-Gn; EBG00000016448.
DR   EnsemblGenomes-Gn; EBG00000016449.
DR   EnsemblGenomes-Gn; EBG00000016450.
DR   EnsemblGenomes-Gn; EBG00000016451.
DR   EnsemblGenomes-Gn; EBG00000016452.
DR   EnsemblGenomes-Gn; EBG00000016453.
DR   EnsemblGenomes-Gn; EBG00000016454.
DR   EnsemblGenomes-Gn; EBG00000016455.
DR   EnsemblGenomes-Gn; EBG00000016456.
DR   EnsemblGenomes-Gn; EBG00000016457.
DR   EnsemblGenomes-Gn; EBG00000016458.
DR   EnsemblGenomes-Gn; EBG00000016459.
DR   EnsemblGenomes-Gn; EBG00000016460.
DR   EnsemblGenomes-Gn; EBG00000016461.
DR   EnsemblGenomes-Gn; EBG00000016462.
DR   EnsemblGenomes-Gn; YE0122.
DR   EnsemblGenomes-Gn; YE0270.
DR   EnsemblGenomes-Gn; YE0313.
DR   EnsemblGenomes-Gn; YE0344.
DR   EnsemblGenomes-Gn; YE0345.
DR   EnsemblGenomes-Gn; YE0416.
DR   EnsemblGenomes-Gn; YE0505.
DR   EnsemblGenomes-Gn; YE0511.
DR   EnsemblGenomes-Gn; YE0522.
DR   EnsemblGenomes-Gn; YE0799.
DR   EnsemblGenomes-Gn; YE0915.
DR   EnsemblGenomes-Gn; YE0936.
DR   EnsemblGenomes-Gn; YE0944.
DR   EnsemblGenomes-Gn; YE0974.
DR   EnsemblGenomes-Gn; YE1101.
DR   EnsemblGenomes-Gn; YE1184.
DR   EnsemblGenomes-Gn; YE1236A.
DR   EnsemblGenomes-Gn; YE1261.
DR   EnsemblGenomes-Gn; YE1384.
DR   EnsemblGenomes-Gn; YE1400.
DR   EnsemblGenomes-Gn; YE1406.
DR   EnsemblGenomes-Gn; YE1412.
DR   EnsemblGenomes-Gn; YE1488.
DR   EnsemblGenomes-Gn; YE1598.
DR   EnsemblGenomes-Gn; YE1648.
DR   EnsemblGenomes-Gn; YE1656.
DR   EnsemblGenomes-Gn; YE1728.
DR   EnsemblGenomes-Gn; YE1729.
DR   EnsemblGenomes-Gn; YE1737.
DR   EnsemblGenomes-Gn; YE1803A.
DR   EnsemblGenomes-Gn; YE1804.
DR   EnsemblGenomes-Gn; YE1821.
DR   EnsemblGenomes-Gn; YE1823.
DR   EnsemblGenomes-Gn; YE1824.
DR   EnsemblGenomes-Gn; YE1844.
DR   EnsemblGenomes-Gn; YE1920.
DR   EnsemblGenomes-Gn; YE1925.
DR   EnsemblGenomes-Gn; YE1953.
DR   EnsemblGenomes-Gn; YE1954.
DR   EnsemblGenomes-Gn; YE2026A.
DR   EnsemblGenomes-Gn; YE2041.
DR   EnsemblGenomes-Gn; YE2094.
DR   EnsemblGenomes-Gn; YE2410.
DR   EnsemblGenomes-Gn; YE2449.
DR   EnsemblGenomes-Gn; YE2450.
DR   EnsemblGenomes-Gn; YE2535.
DR   EnsemblGenomes-Gn; YE2586A.
DR   EnsemblGenomes-Gn; YE2611.
DR   EnsemblGenomes-Gn; YE2624.
DR   EnsemblGenomes-Gn; YE2640.
DR   EnsemblGenomes-Gn; YE2706.
DR   EnsemblGenomes-Gn; YE2708.
DR   EnsemblGenomes-Gn; YE2719.
DR   EnsemblGenomes-Gn; YE3028.
DR   EnsemblGenomes-Gn; YE3037.
DR   EnsemblGenomes-Gn; YE3038.
DR   EnsemblGenomes-Gn; YE3168.
DR   EnsemblGenomes-Gn; YE3180.
DR   EnsemblGenomes-Gn; YE3328.
DR   EnsemblGenomes-Gn; YE3341.
DR   EnsemblGenomes-Gn; YE3455.
DR   EnsemblGenomes-Gn; YE3456.
DR   EnsemblGenomes-Gn; YE3516.
DR   EnsemblGenomes-Gn; YE3521.
DR   EnsemblGenomes-Gn; YE3522.
DR   EnsemblGenomes-Gn; YE3524.
DR   EnsemblGenomes-Gn; YE3524A.
DR   EnsemblGenomes-Gn; YE3580.
DR   EnsemblGenomes-Gn; YE3610A.
DR   EnsemblGenomes-Gn; YE3611.
DR   EnsemblGenomes-Gn; YE3612.
DR   EnsemblGenomes-Gn; YE3624.
DR   EnsemblGenomes-Gn; YE3825.
DR   EnsemblGenomes-Gn; YE4113.
DR   EnsemblGenomes-Gn; YE4114.
DR   EnsemblGenomes-Gn; YE4115.
DR   EnsemblGenomes-Tr; EBG00000016359.
DR   EnsemblGenomes-Tr; EBG00000016360.
DR   EnsemblGenomes-Tr; EBG00000016361.
DR   EnsemblGenomes-Tr; EBG00000016362.
DR   EnsemblGenomes-Tr; EBG00000016363.
DR   EnsemblGenomes-Tr; EBG00000016364.
DR   EnsemblGenomes-Tr; EBG00000016365.
DR   EnsemblGenomes-Tr; EBG00000016366.
DR   EnsemblGenomes-Tr; EBG00000016367.
DR   EnsemblGenomes-Tr; EBG00000016368.
DR   EnsemblGenomes-Tr; EBG00000016369.
DR   EnsemblGenomes-Tr; EBG00000016370.
DR   EnsemblGenomes-Tr; EBG00000016371.
DR   EnsemblGenomes-Tr; EBG00000016372.
DR   EnsemblGenomes-Tr; EBG00000016373.
DR   EnsemblGenomes-Tr; EBG00000016374.
DR   EnsemblGenomes-Tr; EBG00000016375.
DR   EnsemblGenomes-Tr; EBG00000016376.
DR   EnsemblGenomes-Tr; EBG00000016377.
DR   EnsemblGenomes-Tr; EBG00000016378.
DR   EnsemblGenomes-Tr; EBG00000016379.
DR   EnsemblGenomes-Tr; EBG00000016380.
DR   EnsemblGenomes-Tr; EBG00000016381.
DR   EnsemblGenomes-Tr; EBG00000016382.
DR   EnsemblGenomes-Tr; EBG00000016383.
DR   EnsemblGenomes-Tr; EBG00000016384.
DR   EnsemblGenomes-Tr; EBG00000016385.
DR   EnsemblGenomes-Tr; EBG00000016386.
DR   EnsemblGenomes-Tr; EBG00000016387.
DR   EnsemblGenomes-Tr; EBG00000016388.
DR   EnsemblGenomes-Tr; EBG00000016389.
DR   EnsemblGenomes-Tr; EBG00000016390.
DR   EnsemblGenomes-Tr; EBG00000016391.
DR   EnsemblGenomes-Tr; EBG00000016392.
DR   EnsemblGenomes-Tr; EBG00000016393.
DR   EnsemblGenomes-Tr; EBG00000016394.
DR   EnsemblGenomes-Tr; EBG00000016395.
DR   EnsemblGenomes-Tr; EBG00000016396.
DR   EnsemblGenomes-Tr; EBG00000016397.
DR   EnsemblGenomes-Tr; EBG00000016398.
DR   EnsemblGenomes-Tr; EBG00000016399.
DR   EnsemblGenomes-Tr; EBG00000016400.
DR   EnsemblGenomes-Tr; EBG00000016401.
DR   EnsemblGenomes-Tr; EBG00000016402.
DR   EnsemblGenomes-Tr; EBG00000016403.
DR   EnsemblGenomes-Tr; EBG00000016404.
DR   EnsemblGenomes-Tr; EBG00000016405.
DR   EnsemblGenomes-Tr; EBG00000016406.
DR   EnsemblGenomes-Tr; EBG00000016407.
DR   EnsemblGenomes-Tr; EBG00000016408.
DR   EnsemblGenomes-Tr; EBG00000016409.
DR   EnsemblGenomes-Tr; EBG00000016410.
DR   EnsemblGenomes-Tr; EBG00000016411.
DR   EnsemblGenomes-Tr; EBG00000016412.
DR   EnsemblGenomes-Tr; EBG00000016413.
DR   EnsemblGenomes-Tr; EBG00000016414.
DR   EnsemblGenomes-Tr; EBG00000016415.
DR   EnsemblGenomes-Tr; EBG00000016416.
DR   EnsemblGenomes-Tr; EBG00000016417.
DR   EnsemblGenomes-Tr; EBG00000016418.
DR   EnsemblGenomes-Tr; EBG00000016419.
DR   EnsemblGenomes-Tr; EBG00000016420.
DR   EnsemblGenomes-Tr; EBG00000016421.
DR   EnsemblGenomes-Tr; EBG00000016422.
DR   EnsemblGenomes-Tr; EBG00000016423.
DR   EnsemblGenomes-Tr; EBG00000016424.
DR   EnsemblGenomes-Tr; EBG00000016425.
DR   EnsemblGenomes-Tr; EBG00000016426.
DR   EnsemblGenomes-Tr; EBG00000016427.
DR   EnsemblGenomes-Tr; EBG00000016428.
DR   EnsemblGenomes-Tr; EBG00000016429.
DR   EnsemblGenomes-Tr; EBG00000016430.
DR   EnsemblGenomes-Tr; EBG00000016431.
DR   EnsemblGenomes-Tr; EBG00000016432.
DR   EnsemblGenomes-Tr; EBG00000016433.
DR   EnsemblGenomes-Tr; EBG00000016434.
DR   EnsemblGenomes-Tr; EBG00000016435.
DR   EnsemblGenomes-Tr; EBG00000016436.
DR   EnsemblGenomes-Tr; EBG00000016437.
DR   EnsemblGenomes-Tr; EBG00000016438.
DR   EnsemblGenomes-Tr; EBG00000016439.
DR   EnsemblGenomes-Tr; EBG00000016440.
DR   EnsemblGenomes-Tr; EBG00000016441.
DR   EnsemblGenomes-Tr; EBG00000016442.
DR   EnsemblGenomes-Tr; EBG00000016443.
DR   EnsemblGenomes-Tr; EBG00000016444.
DR   EnsemblGenomes-Tr; EBG00000016445.
DR   EnsemblGenomes-Tr; EBG00000016446.
DR   EnsemblGenomes-Tr; EBG00000016447.
DR   EnsemblGenomes-Tr; EBG00000016448.
DR   EnsemblGenomes-Tr; EBG00000016449.
DR   EnsemblGenomes-Tr; EBG00000016450.
DR   EnsemblGenomes-Tr; EBG00000016451.
DR   EnsemblGenomes-Tr; EBG00000016452.
DR   EnsemblGenomes-Tr; EBG00000016453.
DR   EnsemblGenomes-Tr; EBG00000016454.
DR   EnsemblGenomes-Tr; EBG00000016455.
DR   EnsemblGenomes-Tr; EBG00000016456.
DR   EnsemblGenomes-Tr; EBG00000016457.
DR   EnsemblGenomes-Tr; EBG00000016458.
DR   EnsemblGenomes-Tr; EBG00000016459.
DR   EnsemblGenomes-Tr; EBG00000016460.
DR   EnsemblGenomes-Tr; EBG00000016461.
DR   EnsemblGenomes-Tr; EBG00000016462.
DR   EnsemblGenomes-Tr; YE0122.
DR   EnsemblGenomes-Tr; YE0270.
DR   EnsemblGenomes-Tr; YE0313.
DR   EnsemblGenomes-Tr; YE0344.
DR   EnsemblGenomes-Tr; YE0345.
DR   EnsemblGenomes-Tr; YE0416.
DR   EnsemblGenomes-Tr; YE0505.
DR   EnsemblGenomes-Tr; YE0511.
DR   EnsemblGenomes-Tr; YE0522.
DR   EnsemblGenomes-Tr; YE0799.
DR   EnsemblGenomes-Tr; YE0915.
DR   EnsemblGenomes-Tr; YE0936.
DR   EnsemblGenomes-Tr; YE0944.
DR   EnsemblGenomes-Tr; YE0974.
DR   EnsemblGenomes-Tr; YE1101.
DR   EnsemblGenomes-Tr; YE1184.
DR   EnsemblGenomes-Tr; YE1236A.
DR   EnsemblGenomes-Tr; YE1261.
DR   EnsemblGenomes-Tr; YE1384.
DR   EnsemblGenomes-Tr; YE1400.
DR   EnsemblGenomes-Tr; YE1406.
DR   EnsemblGenomes-Tr; YE1412.
DR   EnsemblGenomes-Tr; YE1488.
DR   EnsemblGenomes-Tr; YE1598.
DR   EnsemblGenomes-Tr; YE1648.
DR   EnsemblGenomes-Tr; YE1656.
DR   EnsemblGenomes-Tr; YE1728.
DR   EnsemblGenomes-Tr; YE1729.
DR   EnsemblGenomes-Tr; YE1737.
DR   EnsemblGenomes-Tr; YE1803A.
DR   EnsemblGenomes-Tr; YE1804.
DR   EnsemblGenomes-Tr; YE1821.
DR   EnsemblGenomes-Tr; YE1823.
DR   EnsemblGenomes-Tr; YE1824.
DR   EnsemblGenomes-Tr; YE1844.
DR   EnsemblGenomes-Tr; YE1920.
DR   EnsemblGenomes-Tr; YE1925.
DR   EnsemblGenomes-Tr; YE1953.
DR   EnsemblGenomes-Tr; YE1954.
DR   EnsemblGenomes-Tr; YE2026A.
DR   EnsemblGenomes-Tr; YE2041.
DR   EnsemblGenomes-Tr; YE2094.
DR   EnsemblGenomes-Tr; YE2410.
DR   EnsemblGenomes-Tr; YE2449.
DR   EnsemblGenomes-Tr; YE2450.
DR   EnsemblGenomes-Tr; YE2535.
DR   EnsemblGenomes-Tr; YE2586A.
DR   EnsemblGenomes-Tr; YE2611.
DR   EnsemblGenomes-Tr; YE2624.
DR   EnsemblGenomes-Tr; YE2640.
DR   EnsemblGenomes-Tr; YE2706.
DR   EnsemblGenomes-Tr; YE2708.
DR   EnsemblGenomes-Tr; YE2719.
DR   EnsemblGenomes-Tr; YE3028.
DR   EnsemblGenomes-Tr; YE3037.
DR   EnsemblGenomes-Tr; YE3038.
DR   EnsemblGenomes-Tr; YE3168.
DR   EnsemblGenomes-Tr; YE3180.
DR   EnsemblGenomes-Tr; YE3328.
DR   EnsemblGenomes-Tr; YE3341.
DR   EnsemblGenomes-Tr; YE3455.
DR   EnsemblGenomes-Tr; YE3456.
DR   EnsemblGenomes-Tr; YE3516.
DR   EnsemblGenomes-Tr; YE3521.
DR   EnsemblGenomes-Tr; YE3522.
DR   EnsemblGenomes-Tr; YE3524.
DR   EnsemblGenomes-Tr; YE3524A.
DR   EnsemblGenomes-Tr; YE3580.
DR   EnsemblGenomes-Tr; YE3610A.
DR   EnsemblGenomes-Tr; YE3611.
DR   EnsemblGenomes-Tr; YE3612.
DR   EnsemblGenomes-Tr; YE3624.
DR   EnsemblGenomes-Tr; YE3825.
DR   EnsemblGenomes-Tr; YE4113.
DR   EnsemblGenomes-Tr; YE4114.
DR   EnsemblGenomes-Tr; YE4115.
DR   EuropePMC; PMC1698947; 17173484.
DR   EuropePMC; PMC2394748; 17547764.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC2876571; 20385763.
DR   EuropePMC; PMC2889952; 20509911.
DR   EuropePMC; PMC2935791; 19968874.
DR   EuropePMC; PMC3017858; 20964857.
DR   EuropePMC; PMC3079665; 21453472.
DR   EuropePMC; PMC3122819; 21325549.
DR   EuropePMC; PMC3233069; 21965411.
DR   EuropePMC; PMC3294861; 22247511.
DR   EuropePMC; PMC3370846; 22505678.
DR   EuropePMC; PMC3469391; 22963272.
DR   EuropePMC; PMC3512526; 22985268.
DR   EuropePMC; PMC3995578; 24628971.
DR   GOA; P0C5Z4.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; AM286415.
DR   SILVA-SSU; AM286415.
DR   StrainInfo; 719455; 0.
DR   UniProtKB/Swiss-Prot; P0C5Z4; LPT_YERE8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4615899
FT                   /organism="Yersinia enterocolitica subsp. enterocolitica
FT                   8081"
FT                   /sub_species="enterocolitica"
FT                   /strain="8081"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:393305"
FT   CDS             complement(270..710)
FT                   /transl_table=11
FT                   /locus_tag="YE0001"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10146"
FT                   /db_xref="GOA:A1JHQ8"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHQ8"
FT                   /protein_id="CAL10146.1"
FT                   /translation="MADITLISGSTLGSAEYVAEHLAEKLEEAGFTTETLHGPELDELT
FT                   LDGMWLIITSTHGAGDLPDNLQPLLEQIEQQRPDLSQVRFGAVGLGSSEYDTFCGAVRK
FT                   LDQQLIIQGAIRVGDILEIDVIKHEIPEDPAEIWVKNWINLL"
FT   misc_feature    complement(273..704)
FT                   /note="Pfam match to entry PF00258 flavodoxin, Flavodoxin,
FT                   score 117.3, E-value 1.9e-32"
FT                   /inference="protein motif:PFAM:PF00258"
FT   CDS             complement(802..1263)
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="YE0002"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10147"
FT                   /db_xref="GOA:A1JHQ9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHQ9"
FT                   /protein_id="CAL10147.1"
FT                   /translation="MSEIYQIDNLDRGILNALMENARTPYAELAKNFGVSPGTIHVRVE
FT                   KMRQAGIITAACVHVNPKQLGYDVCCFIGIILKSAKDYPSALKKLESLEEVVEAYYTTG
FT                   HYSIFIKVMCKSIDALQQVLINKIQTIDEIQSTETLISLQNPIMRTIVP"
FT   misc_feature    complement(868..1173)
FT                   /note="Pfam match to entry PF01037 ASNC_trans_reg, AsnC
FT                   family, score 61.4, E-value 1.2e-15"
FT                   /inference="protein motif:PFAM:PF01037"
FT   misc_feature    complement(1111..1191)
FT                   /note="PS00519 Bacterial regulatory proteins, asnC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00519"
FT   misc_feature    complement(1129..1194)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1765.000, SD 5.20 at aa 24-45, sequence
FT                   TPYAELAKNFGVSPGTIHVRVE"
FT   CDS             1449..2441
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="YE0003"
FT                   /product="aspartate-ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10148"
FT                   /db_xref="GOA:A1JHR0"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR0"
FT                   /protein_id="CAL10148.1"
FT                   /translation="MKKQFIQKQQQISFVKSFFSRQLEQQLGLIEVQAPILSRVGDGTQ
FT                   DNLSGSEKAVQVKVKSLPDATFEVVHSLAKWKRKTLGRFDFGADQGIYTHMKALRPDED
FT                   RLSAIHSVYVDQWDWERVMGDGERNLAYLKSTVNKIYAAIKETEAAISAEFDIKPFLPE
FT                   QIHFIHSESLRAKFPDLDAKGRERAIAKELGAVFLIGIGGKLADGKSHDVRAPDYDDWT
FT                   SPSAEGFAGLNGDIIVWNPVLEDAFEISSMGIRVDAEALKRQLALTSDEDRLKLEWHQS
FT                   LLNGEMPQTIGGGIGQSRLVMLLLQQQHIGQVQCGVWGPEISEKVEGLL"
FT   misc_feature    1455..2186
FT                   /note="Pfam match to entry PF03590 AsnA, Aspartate-ammonia
FT                   ligase, score 597.7, E-value 4.6e-177"
FT                   /inference="protein motif:PFAM:PF03590"
FT   misc_feature    2055..2078
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             2595..3266
FT                   /transl_table=11
FT                   /locus_tag="YE0004"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Ralstonia solanacearum probable
FT                   transmembrane protein RSP0410 or RS00867 SWALL:Q8XSQ7
FT                   (EMBL:AL646078) (224 aa) fasta scores: E(): 7.3e-36,46.54
FT                   38d in 217 aa, and to Deinococcus radiodurans hypothetical
FT                   protein DR0351 SWALL:Q9RXG2 (EMBL:AE001895) (227 aa) fasta
FT                   scores: E(): 3.7e-17, 31.67 38d in 221 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10149"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHR1"
FT                   /inference="similar to sequence:INSDC:AL646078"
FT                   /inference="similar to sequence:INSDC:AE001895"
FT                   /protein_id="CAL10149.1"
FT                   /translation="MARFHPLRHYSHARPRLLLSVGAGIIAYFLLPSHFTVLLRVMVSW
FT                   NIFAWLYLLFLWLQLLRNDPKKIRLIARVQDESASMVLSIVSMACLASILVILFELSTA
FT                   NQLSGSAKAFHLVLTGMTLLVSWLLLPTAFTMHYAHLFYLSRDESDAVLPLIFPKEVTE
FT                   PTYWDFLYFSFTIGVASQTADVSTGTSDIRRVVLLQSVLSFIFNMTILGLSINVGAGLL
FT                   N"
FT   misc_feature    join(2643..2711,2721..2777,2838..2906,2934..3002,
FT                   3192..3260)
FT                   /note="5 probable transmembrane helices predicted for
FT                   YE0004 by TMHMM2.0 at aa 17-39, 43-61, 82-104, 114-136 and
FT                   200-222"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(3276..4742)
FT                   /transl_table=11
FT                   /locus_tag="YE0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10150"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR023481"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR3"
FT                   /protein_id="CAL10150.1"
FT                   /translation="MLSLATLDLLLSISESELIEEMVVGLLASPQLAIFFEKFPRIKRA
FT                   LMKDIPGWKQNLQQRIREAKVPAGLANEFALYQQSQLEDSPLFYAHLPQIVVQLQQWHS
FT                   PFATQAKTLLHTADLERNPQTGDSFQTLFLQRWRVSLTLQTITIHHQLLEQEREQLLAE
FT                   LQQRLALSGALEPILATNDGAAGRLWDMSQGHLQRGDYQLLLQYGDFLQQQPELQQLAE
FT                   QLGRSRSAKAQPTPDARFEPYTVMVRQPDTVPEEVSGIHQSNDILRLLPTELVMLGMSE
FT                   LEFEFYRRLLERRLLTYRLQGDNWQEKTLQRPISLKSHDEQPRGPFIVCVDTSGSMGGF
FT                   SEQCAKAFCLALLRIALEDNRRCYIMLFATEIIHYELSSASGIEQAIRFLSQHFRGGTD
FT                   LAACLSSTLSKMEERDWYDADAVIISDFIAQRLPEELIRKIKIQQQAHQHRFHAVAMSA
FT                   YGKPGIMRIFDHIWRFDTGLKSRLIRRWKR"
FT   misc_feature    complement(4035..4100)
FT                   /note="Predicted helix-turn-helix motif with score 997.000,
FT                   SD 2.58 at aa 215-236, sequence PELQQLAEQLGRSRSAKAQPTP"
FT   CDS             complement(4746..6254)
FT                   /transl_table=11
FT                   /locus_tag="YE0006"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10151"
FT                   /db_xref="GOA:A1JHR5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR022547"
FT                   /db_xref="InterPro:IPR023671"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR5"
FT                   /protein_id="CAL10151.1"
FT                   /translation="MAQSSQLAERISRLSSALESGLYERQEAIRLCLLAALSGESVFLL
FT                   GPPGIAKSLIARRLKFAFRNARAFEYLMTRFSTPEEVFGPLSIQALKEEGRYQRMTGGY
FT                   LPEAEIVFLDEIWKAGPAILNTLLTAINERRFRNGDREDSIPMRLLVTASNELPDADSS
FT                   LEALYDRMLIRLWLDRVQEKQNFRSLLLSRQNENHNPVAENLSISDEEFYQWQPLIDKI
FT                   ALPDNCFELIFQLRQQLSAQEQAPYVSDRRWKKALRLLQASAFFSGRDEITPIDLILLK
FT                   DCLWHDLSSLKLLQQQLEQLLTEHGYQQQSLLMKLQHIHAQWLKHQQQQSDHQALTVTK
FT                   QSGMFSRKPQYSLPDHLTDSTLTLFLQKPLSLHDIQVNHLQIEKEMLVQWLNKGGVLRA
FT                   KLNGVGYAQSIDAEVDDQLHITVLDVSRQSSILSQPGASTASVPPELLVELAELENSLA
FT                   EQRRLFSQHQPCLFTPSSWLAKIEASLLNVAEQVKQLQQKLRGH"
FT   CDS             6708..8435
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /gene_synonym="trkD"
FT                   /locus_tag="YE0007"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10152"
FT                   /db_xref="GOA:A1JHR6"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR6"
FT                   /protein_id="CAL10152.1"
FT                   /translation="MVFGFLSLIFWMLILIVSVKYLTYVMRADNAGEGGILTLMSLAGR
FT                   NTSSRATSILVILGLIGGSFFYGEVVITPAISVMSAIEGLEIAAPALDPYIVPCSIAVL
FT                   TLLFVIQKHGTGSVGKLFAPVMLVWFLTLALLGLRSIIANPEVLAALNPKWAISFFTEY
FT                   KSVSFFALGAVVLAITGVEALYADMGHFGKFPIRLAWFTVVLPSLVLNYFGQGALLLKN
FT                   PEAIKNPFFLLAPDWALIPLLILATLATVIASQAVISGVFSLTRQAVRLGYLPPMRIIH
FT                   TSEMESGQIYIPVINWTLYLAVVLVIVGFERSSNLAAAYGIAVTGTMVITSVLFCTVAL
FT                   KNWHWNRFFVYFLLVALLVIDVPMFSANALKLFSGGWLPLSLGLVMFIIMTTWKSERFS
FT                   LLRRMHEHGNSLEAMIASLEKSPPVRVPGTAVYMSRAMNVIPFALLHNLKHNKVLHDRV
FT                   VLLTLRTEDAPYVHNVNRVTIEQLSPTFWRVVASYGWRETPNVEEIFHRCGLEGLPCQM
FT                   METSFFMSHESLILTKRPWYLFLRGKLFIALSRNALRAADQFEIPPNRVIELGTQVEI"
FT   misc_feature    6711..8432
FT                   /note="Pfam match to entry PF02705 K_trans, K+ potassium
FT                   transporter, score 854.9, E-value 1.7e-254"
FT                   /inference="protein motif:PFAM:PF02705"
FT   misc_feature    join(6717..6785,6870..6938,6966..7034,7068..7136,
FT                   7194..7262,7299..7367,7425..7493,7566..7634,7662..7730,
FT                   7749..7802,7830..7886)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0007 by TMHMM2.0 at aa 4-26, 55-77, 87-109,
FT                   121-143,163-185, 198-220, 240-262, 287-309, 319-341,
FT                   348-365 and 375-393"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             8606..9025
FT                   /transl_table=11
FT                   /locus_tag="YE0008"
FT                   /product="ribose permease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10153"
FT                   /db_xref="GOA:A1JHR8"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR8"
FT                   /protein_id="CAL10153.1"
FT                   /translation="MKKGALLNSDISAVISRLGHTDQIVIGDAGLPIPATTTRIDLALT
FT                   QGVPGFLQVFEVVTQEMQVESAYLAQEIVKNNPQLHETLLAQLSQLEQHQGNQIALHYI
FT                   SHEAFKEQTKQSRAVIRSGECSPFANIILCSGVTF"
FT   CDS             9033..10535
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="YE0009"
FT                   /product="putative ribose transport ATP-binding protein"
FT                   /note="Similar to Escherichia coli ribose transport
FT                   ATP-binding protein RbsA SWALL:RBSA_ECOLI (SWALL:P04983)
FT                   (501 aa) fasta scores: E(): 2.7e-148, 85.83 38d in 494
FT                   aa,and to Salmonella typhi high affinity ribose transport
FT                   protein STY896 SWALL:Q8Z2R4 (EMBL:AL627280) (501 aa) fasta
FT                   scores: E(): 1.1e-147, 85.62 38d in 494 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10154"
FT                   /db_xref="GOA:A1JHS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS1"
FT                   /inference="similar to sequence:INSDC:AL627280"
FT                   /inference="similar to sequence:UniProtKB:P04983"
FT                   /protein_id="CAL10154.1"
FT                   /translation="MQPLLQLKGIDKAFPGVKALSGAALSVYPGRVMALVGENGAGKST
FT                   MMKVLTGIYNKDAGSQHFLGKEVVFNGPKESQEAGIGIIHQELNLIPQLTIAENIFLGR
FT                   EFVNHFGGIDWKKMYAEADLLLARLNISYSSHRLVGELSIGDQQMVEIAKVLSFESKVI
FT                   IMDEPTDALTDTETASLFNVIKELKAEGRGIVYISHRLKEIFEICDDVTVFRDGQFIAE
FT                   KPVNTLTENALIEMMVGRKLEEQYPRLNLPRGEKRLQVKQLCGPGVENVNFTLYSGEIL
FT                   GVAGLMGAGRTELMKIIYGALPRKSGFVMLDGREVVTHSPQDGLANGIVYISEDRKRDG
FT                   LVLGMSVKENMSLTALRYFSRSGGSLKHADEQQAVADFIRLFNIKTPSMEQPIGLLSGG
FT                   NQQKVAIARGLMTRPKVLILDEPTRGVDVGAKKEIYQLINQFKQEGLSIILVSSEMPEV
FT                   LGMSDRIIVMHEGQLSGEFSIEQATQEVLMAAAVGKRDLLEK"
FT   misc_feature    9120..9683
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 173.1, E-value 3e-49"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    9141..9164
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    9864..10445
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 134.4, E-value 1.3e-37"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    10218..10262
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             10623..11588
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="YE0010"
FT                   /product="putative sugar transport system, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10155"
FT                   /db_xref="GOA:A1JHS2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS2"
FT                   /protein_id="CAL10155.1"
FT                   /translation="MSSQTINTKRWFSKEWLLEQKSLIALLVLIAVVSSLSPNFFTLNN
FT                   MFNILQQTSVNAIMAVGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEVNALVAVGAA
FT                   LALGAFVGGITGVIVAKGKVQAFIATLVMMLLLRGVTMVYTNGSPINTGFTDVADTFGW
FT                   FGIGRPLGIPTPIWLMAIVFIAAWYMLHHTRLGRYIYALGGNESATRLSGISVDKVKII
FT                   VYSLCGLLAALAGIIEVARLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGQIVGTLIG
FT                   ALILGFLNNGLNLLGVSSYYQMIVKAVVILLAVLVDNKKQ"
FT   sig_peptide     10623..10748
FT                   /gene="rbsC"
FT                   /locus_tag="YE0010"
FT                   /note="Signal peptide predicted for YE0010 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.969) with cleavage site
FT                   probability 0.169 between residues 42 and 43"
FT   misc_feature    join(10686..10754,10815..10883,10911..10979,10998..11066,
FT                   11124..11192,11283..11351,11445..11513)
FT                   /note="7 probable transmembrane helices predicted for
FT                   YE0010 by TMHMM2.0 at aa 22-44, 65-87, 97-119,
FT                   126-148,168-190, 221-243 and 275-297"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    10746..11582
FT                   /note="Pfam match to entry PF02653
FT                   BPD_transp_2,Branched-chain amino acid transport system /
FT                   permease component, score 3.4, E-value 7.7e-07"
FT                   /inference="protein motif:PFAM:PF02653"
FT   CDS             11760..12647
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /gene_synonym="rbsP"
FT                   /gene_synonym="prlB"
FT                   /locus_tag="YE0011"
FT                   /product="putative D-ribose-binding periplasmic protein
FT                   precursor"
FT                   /note="Similar to Escherichia coli D-ribose-binding
FT                   periplasmic protein precursor RbsB or RbsP or PrlB
FT                   SWALL:RBSB_ECOLI (SWALL:P02925) (296 aa) fasta scores: E():
FT                   1.7e-84, 84.74 38d in 295 aa, and to Salmonella
FT                   typhimurium, and Salmonella typhi D-ribose-binding
FT                   periplasmic protein precursor RbsB or RbsP or STM3884 or
FT                   STY3894 SWALL:RBSB_SALTY (SWALL:P02926) (296 aa) fasta
FT                   scores: E(): 5.6e-84, 84.06 38d in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10156"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS3"
FT                   /inference="similar to sequence:UniProtKB:P02925"
FT                   /inference="similar to sequence:UniProtKB:P02926"
FT                   /protein_id="CAL10156.1"
FT                   /translation="MKMKKLATLISVVALSATVSANALAKDTIALVVSTLNNPFFVSMK
FT                   DGAQKEADKLGYNLVILDSQNNPAKELANVQDLTVRGTKLLLINPTDSDAVGNAVKMAN
FT                   QANIPVITLDRLANAGTVVSHVASDNRFGGKMAGDYIAKKVGSDAKVIQLEGIAGASAA
FT                   RERGEGFKQSMEKNKFQLLASQPADFDRTKGLNVMQNLLTAHPDVQAVFAQNDEMALGA
FT                   LRALQTAGKTDVLVVGFDGTDDGIKAVESGKMGATIAQRPDQIGVIGVQTADKVLKGEK
FT                   VQAVIPVDLKLVTK"
FT   sig_peptide     11760..11834
FT                   /gene="rbsB"
FT                   /gene_synonym="prlB"
FT                   /gene_synonym="rbsP"
FT                   /locus_tag="YE0011"
FT                   /note="Signal peptide predicted for YE0011 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.933 between residues 25 and 26"
FT   misc_feature    11835..12641
FT                   /note="Pfam match to entry PF00532
FT                   Peripla_BP_like,Periplasmic binding proteins and sugar
FT                   binding domain of the LacI family, score 63.4, E-value
FT                   3.3e-16"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    12432..12455
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             12811..13737
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="YE0012"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10157"
FT                   /db_xref="GOA:A1JHS4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS4"
FT                   /protein_id="CAL10157.1"
FT                   /translation="METGKLVVLGSINADHILNIEQFPRPGETVVGEQYKVAFGGKGAN
FT                   QAVAAGRSGANIAFIACVGEDDIGDRVRLQLASDNIDTAPIEAVAGTTTGVALIFVNGE
FT                   GENVIGIHAGANSAVTPEYLGRYQQQVIDADALLMQLESPLGTVIAAAKLAKQHQTQVI
FT                   LNPAPARELPDELLSLVDMITPNETEAERLTGIHIEQDDDAAKAAQILHDKGIATVIIT
FT                   LGSRGVWLSEQGQGKLVAGFKVNAVDTIAAGDTFNGALLTALLEGQAMGSAVRFAHAAA
FT                   AIAVTRPGAQPSIPWRAEIDSFLQDRV"
FT   misc_feature    12817..13701
FT                   /note="Pfam match to entry PF00294 pfkB, pfkB family
FT                   carbohydrate kinase, score 298.8, E-value 4.4e-87"
FT                   /inference="protein motif:PFAM:PF00294"
FT   misc_feature    12928..13002
FT                   /note="PS00583 pfkB family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00583"
FT   misc_feature    13552..13593
FT                   /note="PS00584 pfkB family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00584"
FT   CDS             13740..14741
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="YE0012A"
FT                   /product="ribose operon repressor"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 ribose operon repressor RbsR or b3753 or z5254 or
FT                   ecs4695 SWALL:RBSR_ECOLI (SWALL:P25551) (329 aa) fasta
FT                   scores: E(): 7.1e-94, 73.17 38d in 328 aa and to Salmonella
FT                   typhimurium transcriptional repressor for rbs operon RbsR
FT                   or stm3886 SWALL:Q8ZKV7 (EMBL:AE008881) (332 aa) fasta
FT                   scores: E(): 5.3e-95, 74.09 38d in 332 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0012A"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10158"
FT                   /db_xref="GOA:A1JHS5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS5"
FT                   /inference="similar to sequence:INSDC:AE008881"
FT                   /inference="similar to sequence:UniProtKB:P25551"
FT                   /protein_id="CAL10158.1"
FT                   /translation="MATMKDVARLAGVSTSTVSHVINKNRFVSDPIRDKVLAAIKQLNY
FT                   APSALARSLKLNETRTIGMLVTASSNPFYAEVVRGVERSCYERGYSLILCNTEGDIDRM
FT                   SRSIETLMQKRVDGLLLMCTESHRPSQDILRCYPSLPIIMMDWAPFEGVNDVIQDNSLL
FT                   GGEMATSYLIARGYTRIACIAGPQDKTPAKERLQGFRQAMDRAGLPVLPDYEVASDFEF
FT                   GGGLVAMKQLLALPQPPEAVFTSNDAMAVGVYQALHQAGLSIPQDMAVIGYDDIEIAQY
FT                   MTPPLTTIHQPKDSLGELAIDTLIHRLNSPEAEPQVLILTPELIERGSVATR"
FT   CDS             complement(14738..16162)
FT                   /transl_table=11
FT                   /locus_tag="YE0013"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10159"
FT                   /db_xref="GOA:A1JHS6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS6"
FT                   /protein_id="CAL10159.1"
FT                   /translation="MIKSARSMAGLPWIAAMAFFMQALDATILNTALPSIAESLNRSPL
FT                   TMQSAIISYTLTVAMLIPVSGWLADRFGTRRIFILAVSLFTLGSLLCALSGSLPFLVAS
FT                   RVIQGVGGAMMMPVARLALIRAYPRSELLPVLNFVTIPGLIGPVMGPLLGGLLVTYATW
FT                   HWIFILNIPIGLLGIFYARKYMPDFTMPKRAFDIIGFLLFGSSLVMISVSLEIMGRPDI
FT                   ASYLPAAVLLGGLLMLLFYIFHAKGHPNPLIGLPLFKTRTFSVGIAGNVASRLGTGCVP
FT                   FLMPLMLQVGFGYSAIIAGCMMAPTAIGSMMAKSAVTQVLRSLGYRTVLVGITAIIGVL
FT                   IALFAFQSPGMSPWLMILPLFILGMAMSTQFTAMNTITLADLTDNNASSGNSVLAVTQQ
FT                   LAISFGVAISAVVLRFYDGLSFGNNIDHFHYTFITMGAVTLLSSMVFLLLKPRDGDNLI
FT                   QGRNVKKVTQPAKSEV"
FT   misc_feature    complement(join(14816..14884,14927..14995,15032..15100,
FT                   15128..15196,15233..15301,15344..15412,15431..15499,
FT                   15527..15583,15620..15679,15689..15757,15791..15859,
FT                   15869..15937,15956..16015,16058..16126))
FT                   /note="14 probable transmembrane helices predicted for
FT                   YE0013 by TMHMM2.0 at aa 13-35, 50-69, 76-98,
FT                   102-124,136-158, 162-181, 194-212, 222-244, 251-273,
FT                   288-310,323-345, 355-377, 390-412 and 427-449"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(15830..16132)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score 20.7, E-value 2.1e-06"
FT                   /inference="protein motif:PFAM:PF00083"
FT   sig_peptide     complement(16052..16162)
FT                   /locus_tag="YE0013"
FT                   /note="Signal peptide predicted for YE0013 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.740 between residues 37 and 38"
FT   CDS             complement(16237..16926)
FT                   /transl_table=11
FT                   /locus_tag="YE0014"
FT                   /product="putative GntR-famly transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YE0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10160"
FT                   /db_xref="GOA:A1JHS7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS7"
FT                   /protein_id="CAL10160.1"
FT                   /translation="MQLNTQQQAAQRNLSYLLAEKIGQRILAGEYEAGSILPGEIELGE
FT                   QFGVSRTAVREAVKMLAAKGMLLPRPRIGTRVMPQTNWNFLDQELLTWWMTRENFDQVM
FT                   QHFLILRRSLEPQACSLAAINVSGKQKALLTSLMTEMCELHAHFNRERWIQVDAQFHQL
FT                   IYEASGNPFLTSFANLFSSVYHSYFRSITGDEVIKLQHHQNIVDTILAGDSQGALVACQ
FT                   VLLKEKD"
FT   misc_feature    complement(16696..16875)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 79.0, E-value
FT                   6.6e-21"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    complement(16744..16818)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    complement(16750..16815)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1101.000, SD 2.94 at aa 38-59, sequence
FT                   PGEIELGEQFGVSRTAVREAVK"
FT   rRNA            17506..18994
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT                   /note="match to 16S_rRNA 1..1461 (Y.enterocolitica 16S)"
FT   tRNA            19220..19295
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu (TTC)"
FT   rRNA            19674..22667
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT                   /note="match to 23S_rRNA 1..2994 (Y. enterocolitica 23S
FT                   EMBL:U77925, Y.pestis KIM 98 38dentity, Citrobacter
FT                   freundii 23S EMBL:U77928 94 38dentity)"
FT   rRNA            22667..22908
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT                   /note="match to 5SrRNA 1..240 Y.enterocolitica"
FT   CDS             complement(23194..23721)
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="YE0016"
FT                   /product="probable molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YE0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10161"
FT                   /db_xref="GOA:A1JHS8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029007"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS8"
FT                   /protein_id="CAL10161.1"
FT                   /translation="MSRKTPPLLGIAAYSGTGKTTLLKSLIPLLQQRQIRVGLIKHTHH
FT                   NMEIDTPGKDSYELRKAGAYQTLVASDCRWALMTETPEQKPLDLHYLASRLDAATIDLI
FT                   LVEGFKHEPINKIALYREAVGKPYTDLIDEYVIALASDELIETAVEQLDINQPEQIADF
FT                   ICSWLQINPSQP"
FT   misc_feature    complement(23299..23703)
FT                   /note="Pfam match to entry PF03205 MobB, Molybdopterin
FT                   guanine dinucleotide synthesis protein B, score
FT                   184.3,E-value 1.3e-52"
FT                   /inference="protein motif:PFAM:PF03205"
FT   misc_feature    complement(23662..23685)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(23718..24317)
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /gene_synonym="mob"
FT                   /gene_synonym="chlB"
FT                   /gene_synonym="nar"
FT                   /locus_tag="YE0017"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10162"
FT                   /db_xref="GOA:A1JHS9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS9"
FT                   /protein_id="CAL10162.1"
FT                   /translation="MIEMQPNITGVILAGGRSSRMGGNDKGLTLLHDKPLFQYVIDRLK
FT                   PQVNDLLINANRNQELYQASGVPVVSDIITGFVGPLAGMHAGLSYSPTEWVVFAPCDVP
FT                   ALPSNLVSQLWQGKQQALAAYVHDGERAHPTLALMHVSLKSLLAEYLAKSDRKLMIFMD
FT                   SVNAQPIIFRGQKDQFSNLNTPADCDLWEQSKRGEL"
FT   CDS             24462..24731
FT                   /transl_table=11
FT                   /locus_tag="YE0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10163"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT0"
FT                   /protein_id="CAL10163.1"
FT                   /translation="MKCHRVNELIELLHPAWQQEPDLNLVQFLQKLSEEAGFEGEFAEL
FT                   TDDILIYHLKMRGSASTEVIPGLKKDYEEDFKTAILRARGIIKD"
FT   CDS             24823..25809
FT                   /transl_table=11
FT                   /locus_tag="YE0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10164"
FT                   /db_xref="GOA:A1JHT1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT1"
FT                   /protein_id="CAL10164.1"
FT                   /translation="MNSSAFNFQTLSPDLIMDALEGVGLRVDSGLTALNSYENRVYQFM
FT                   DEDRKRYVVKFYRPERWSSEQILEEHQFSLDLAESEIPVIAPLQLDGRTLHTHGGFFFT
FT                   VFPSVGGRQYEIDNLDQLEWVGRYLGRIHQVGSDALFVARSTIGIEEYLTEPRQLLASS
FT                   ELVPAKQRDKFLAATDLLISTIKQYWHTDWQPLRLHGDCHPGNILWRDGPMFVDLDDAR
FT                   NGPAVQDLWMLLHGERREQLIQLDILLEAYGEFADFDQRELALIEPLRAMRMVYYLAWV
FT                   ARRWQDPAFPKSFPWMAESDFWLQQTASFTEQVKLLQAPPLQLMPMY"
FT   CDS             25856..26479
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="YE0020"
FT                   /product="secreted thiol:disulfide interchange protein
FT                   DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:YE0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10165"
FT                   /db_xref="GOA:A1JHT2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT2"
FT                   /protein_id="CAL10165.1"
FT                   /translation="MKNVWLALVGMVMAFSASAAQFTDGTQYQTLNKPVTGEPQVLEFF
FT                   SFYCPHCYQFEEVYHVPQAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGVEE
FT                   KITPLMFEGVQKTQTVQTPDDIRNVFIKAGVSGEEFDAALNSFVVKSLVVQQQKAAEDL
FT                   ELRGVPAMFVNGKYMIKNDGMDTSSMDTYVKQYADVVKFLLTQK"
FT   sig_peptide     25856..25912
FT                   /gene="dsbA"
FT                   /locus_tag="YE0020"
FT                   /note="Signal peptide predicted for YE0020 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.992 between residues 19 and 20"
FT   misc_feature    25856..26476
FT                   /note="Pfam match to entry PF01323 DSBA, DSBA
FT                   oxidoreductase, score 486.2, E-value 1.7e-143"
FT                   /inference="protein motif:PFAM:PF01323"
FT   misc_feature    25976..26032
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS             27070..29868
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /gene_synonym="resA"
FT                   /locus_tag="YE0021"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:YE0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10166"
FT                   /db_xref="GOA:A1JHT3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT3"
FT                   /protein_id="CAL10166.1"
FT                   /translation="MAQIAENPLILVDGSSYLYRAYHAFPPLTNSKGEPTGAMYGVLNM
FT                   LRSLLLQYRPSHVAVVFDAKGKTFRDELFAEYKSHRPPMPDDLRAQIEPLHQMVKAMGL
FT                   PLLVVSGVEADDVIGTLAQEAEKAGHAVLISTGDKDMAQLVTPNITLINTMNNAILGPQ
FT                   EVCEKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDSLFNHLDKIP
FT                   TLTFRGAKTMSAKLEQNKDVAYLSYKLATIKTDVELDITCDELNVSAPDDEQLHQLFSR
FT                   YEFKRWLADVEAGKWLDGKKDRPTAQASNKAFVAPESAPVAEVTAVLSQENYQTILDEK
FT                   SLSDWIERLKKAEVFAFDTETDGLDTLSSNLIGLSFAVAPGEAAYLPLAHDYLDAPAQL
FT                   DRDWVLAQLKPLLEDDKALKVGQNLKFDQSMLARYGIDLRGIAFDTMLESYVLDSVAGR
FT                   HDMDSLAERYLNHKTITFEEIAGKGKNQLTFNQIALEQAGPYAAEDADVTLQLHLVLWP
FT                   KLQQSEGLKRVFQEIEMPLLPILSRIERTGVLIDQNILAAHSKELTIRLDELEKQAHEL
FT                   AEEPFNLASPKQLQVILYEKQKLPILKKTPGGAASTNEEVLAELALDYPLPKVILEYRG
FT                   LAKLKSTYTDKLPLMINPVSGRVHTSYHQAVTATGRLSSRDPNLQNIPVRNEEGRRIRQ
FT                   AFIAPEGYRIMAADYSQIELRIMAHLSQDKGLLAAFAAGKDIHRATAAEVFGLSLEKVT
FT                   NEQRRSAKAINFGLIYGMSAFGLARQLNIPRGEAQRYMDLYFERYPGVLEYMERTRKQA
FT                   AEQGYVTTLDGRRLYLPDIHSRNATRRKAAEREAINAPMQGTAADIIKRAMIAVDAWLQ
FT                   QQPEPLVRVIMQVHDELVFEVHESVLESAEQKIRELMEQSMQLAVPLKVDVGVGYNWDQ
FT                   AH"
FT   misc_feature    27088..27576
FT                   /note="Pfam match to entry PF02739 5_3_exonuc_N, 5'-3'
FT                   exonuclease, N-terminal resolvase-like domain, score 316.3,
FT                   E-value 2.4e-92"
FT                   /inference="protein motif:PFAM:PF02739"
FT   misc_feature    27580..27900
FT                   /note="Pfam match to entry PF01367 5_3_exonuclease, 5'-3'
FT                   exonuclease, C-terminal SAM fold, score 194.5, E-value
FT                   1.1e-55"
FT                   /inference="protein motif:PFAM:PF01367"
FT   misc_feature    28048..28629
FT                   /note="Pfam match to entry PF01612 3_5_exonuclease, 3'-5'
FT                   exonuclease, score 229.0, E-value 4.4e-66"
FT                   /inference="protein motif:PFAM:PF01612"
FT   misc_feature    28717..29862
FT                   /note="Pfam match to entry PF00476 DNA_pol_A, DNA
FT                   polymerase family A, score 698.2, E-value 2.6e-207"
FT                   /inference="protein motif:PFAM:PF00476"
FT   misc_feature    29338..29397
FT                   /note="PS00447 DNA polymerase family A signature."
FT                   /inference="protein motif:Prosite:PS00447"
FT   misc_RNA        30017..30134
FT                   /note="Spot 42 RNA (RF00021) as predicted by Rfam, score
FT                   91.54, positions 1 to 118"
FT   CDS             complement(30302..30955)
FT                   /transl_table=11
FT                   /locus_tag="YE0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10167"
FT                   /db_xref="GOA:A1JHT4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHT4"
FT                   /protein_id="CAL10167.1"
FT                   /translation="MTIRNFNYHMTHFVISAPDIRHLPRDEGIEVAFAGRSNAGKSSAL
FT                   NTLTGQKSLARTSKTPGRTQLINLFEVVEGVRLVDLPGYGYAEVPEEMKLKWQRALGEY
FT                   LQKRNCLKGLVVLMDIRHPLKDLDQQMITWAVAVGTPVMLLLTKADKLASGARKAQLNM
FT                   VREAIIPFMGDIQVEAFSSLKKIGVDKLREKLDTWFSEIPPEVMIDEYDDEEGK"
FT   misc_feature    complement(30830..30853)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_RNA        31382..31582
FT                   /note="CsrC family RNA (RF00084) as predicted by Rfam,score
FT                   35.38, positions 1 to 254"
FT   CDS             31718..32284
FT                   /transl_table=11
FT                   /locus_tag="YE0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10168"
FT                   /db_xref="GOA:A1JHT5"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHT5"
FT                   /protein_id="CAL10168.1"
FT                   /translation="MKQPNKAPRADRAAPKGTATPKRHKKTRVELDIEARERKRQKRHS
FT                   GNRSGARTNIEGSNKTGSTQAQEKDPRIGSKVPVPLVVESKAKAKLTTKPVAKVEAKPR
FT                   LTPEEELTKLENDERLDALLDRLDNDEVLSKEDQAYVDLTLDRIDALMEQLGIELGDDE
FT                   DDEEREEKPEDILKLLKSGNPKDTF"
FT   CDS             32467..33840
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="YE0024"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10169"
FT                   /db_xref="GOA:A1JHT6"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT6"
FT                   /protein_id="CAL10169.1"
FT                   /translation="MSENAVVWDLSLIQKYNYSGPRYTSYPTALEFSEEYDESAFQQAV
FT                   KRYPQRPLSLYVHIPFCHKLCYFCGCNKLVTRQQHKADEYLAVLEKEIRQRAALFAGRQ
FT                   VSQMHWGGGTPTYLNKTQITHLMNLLRENFDFLPGAEQSIEVDPREIELDVLDHLRAEG
FT                   FNRLSMGVQDFNKEVQRLVNREQDEDFIFALIARAKALGFNSTNIDLIYGLPKQTPESF
FT                   AFTLKRVAELNPDRLSVFNYAHLPSLFAAQRKIKDADLPTAEQRLDILQHTISFLTESG
FT                   YQFIGMDHFARPDDELAIAQREGKLHRNFQGYTTQGESDLLGLGVSAISMLGDSYAQNE
FT                   KDLKTYYAVVEQRGNALWRGLTMTEDDCLRRDVIKTLICNFQISYQPIEQHYGIRFADY
FT                   FAEDFELLTPFEHDGLVERDDKSIRVTPRGRLLIRNICMCFDIYLRKQARKQQFSRVI"
FT   misc_feature    32761..33522
FT                   /note="Pfam match to entry PF02473
FT                   Coprogen_an_ox,Oxygen-independent Coproporphyrinogen III
FT                   oxidase, score 555.2, E-value 2.8e-164"
FT                   /inference="protein motif:PFAM:PF02473"
FT   CDS             complement(33989..35401)
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /gene_synonym="glnG"
FT                   /gene_synonym="glnT"
FT                   /locus_tag="YE0025"
FT                   /product="nitrogen regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10170"
FT                   /db_xref="GOA:A1JHT7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT7"
FT                   /protein_id="CAL10170.1"
FT                   /translation="MQRGIVWIVDDDSSIRWVLERALTGAGLNCATFDTGNQVLDALAT
FT                   QTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPK
FT                   PFDIDEAVALVERAISHYQEQQQPARTQPASGPTADIIGEAPAMQDVFRIIGRLSRSSI
FT                   SVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGAN
FT                   QVRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAAT
FT                   HQNLELRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARYFLQVAAKELGVEAKN
FT                   LHPETEVALTRLPWPGNVRQLENTCRWLTVMAAGQEVLVQDLPSELFETNTPDASGQRM
FT                   PDNWSTLLAQWADRALRSGHQDLLSEAQPEMERTLLTTALRHTQGHKQEAARLLGWGRN
FT                   TLTRKLKELGME"
FT   misc_feature    complement(34001..34123)
FT                   /note="Pfam match to entry PF02954 HTH_8, Bacterial
FT                   regulatory protein, Fis family, score 64.1, E-value 2e-16"
FT                   /inference="protein motif:PFAM:PF02954"
FT   misc_feature    complement(34007..34072)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1763.000, SD 5.19 at aa 444-465, sequence
FT                   GHKQEAARLLGWGRNTLTRKLK"
FT   misc_feature    complement(34313..34342)
FT                   /note="PS00688 Sigma-54 interaction domain C-terminal part
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00688"
FT   misc_feature    complement(34316..34981)
FT                   /note="Pfam match to entry PF00158 Sigma54_activat,Sigma-54
FT                   interaction domain, score 496.8, E-value 1.1e-146"
FT                   /inference="protein motif:PFAM:PF00158"
FT   misc_feature    complement(34676..34723)
FT                   /note="PS00676 Sigma-54 interaction domain ATP-binding
FT                   region B signature."
FT                   /inference="protein motif:Prosite:PS00676"
FT   misc_feature    complement(34868..34909)
FT                   /note="PS00675 Sigma-54 interaction domain ATP-binding
FT                   region A signature."
FT                   /inference="protein motif:Prosite:PS00675"
FT   misc_feature    complement(35033..35392)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 148.5, E-value 7.8e-42"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS             complement(35409..36458)
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /gene_synonym="glnl"
FT                   /gene_synonym="glnR"
FT                   /locus_tag="YE0026"
FT                   /product="Two component regulatory protein involved in
FT                   nitrogen assimilation"
FT                   /db_xref="EnsemblGenomes-Gn:YE0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10171"
FT                   /db_xref="GOA:A1JHT8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT8"
FT                   /protein_id="CAL10171.1"
FT                   /translation="MATGTLPDAGQILNSLINSILLLDDSLAIHYANPAAQQLLAQSSR
FT                   KLFGTPLPELLGYFSLNMELMRESLASGQSFTDNEVTLVVDGRAHILSLTAQSLAEGFI
FT                   LLEMAPMDNQRRLSQEQLQHAQQIAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPA
FT                   LLEYTKVIIEQADRLRNLVDRLLGPQRPGQHVTQSIHQVAERVCQLVSLEKPDNVTLIR
FT                   DYDPSLPELAHDPDQIEQVLLNITRNALQALGEAGGTITLRTRTAFQITLHGVRYRLAA
FT                   RIDIEDDGPGVPTQLQDTLFYPMVSGREGGTGLGLSIARSLIDQHSGKIEFNSWPGHTE
FT                   FSVYLPIRQ"
FT   misc_feature    complement(35415..35762)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 104.0,
FT                   E-value 1.9e-28"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(35877..36074)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 64.0, E-value 2.1e-16"
FT                   /inference="protein motif:PFAM:PF00512"
FT   CDS             complement(36607..38016)
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="YE0027"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10172"
FT                   /db_xref="GOA:A1JHT9"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHT9"
FT                   /protein_id="CAL10172.1"
FT                   /translation="MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHITIPAHQVNADFFE
FT                   EGKMFDGSSIGGWKGINESDMVLMPDASTAVMDPFFEDSTLIIRCDILEPGTLQGYDRD
FT                   PRSISKRAEEFLKSSGIADTVLFGPEPEFFLFDDVRFGSSIRGSHVAIDDIEGAWNSST
FT                   KYEGGNKGHRPAVKGGYFPVPPVDSSQDLRSTMCLTMEEMGLVVEAHHHEVATAGQNEV
FT                   ATRFNTMTKKADEIQIYKYVVHNVAHAFGKTATFMPKPMFGDNGSGMHCHMSLSKNGTN
FT                   LFAGDKYAGLSEMALFYIGGIIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNR
FT                   SASIRIPVVASPKARRIEARFPDPAANPYLCFAALLMAGLDGIINKIHPGDAMDKNLYD
FT                   LPPEEEAEIPKVAGSLDEAMAALNEDREFLTRGGVFTDDAIDAYIELRKEEMDRVRMTP
FT                   HPVEFELYYSV"
FT   misc_feature    complement(36823..36861)
FT                   /note="PS00182 Glutamine synthetase class-I adenylation
FT                   site."
FT                   /inference="protein motif:Prosite:PS00182"
FT   misc_feature    complement(36868..37713)
FT                   /note="Pfam match to entry PF00120 gln-synt, Glutamine
FT                   synthetase, catalytic domain, score 563.6, E-value
FT                   8.6e-167"
FT                   /inference="protein motif:PFAM:PF00120"
FT   misc_feature    complement(37195..37242)
FT                   /note="PS00181 Glutamine synthetase putative ATP-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00181"
FT   misc_feature    complement(37729..37977)
FT                   /note="Pfam match to entry PF03951 gln-synt_N, Glutamine
FT                   synthetase, beta-Grasp domain, score 169.3, E-value
FT                   4.1e-48"
FT                   /inference="protein motif:PFAM:PF03951"
FT   misc_feature    complement(37813..37869)
FT                   /note="PS00180 Glutamine synthetase signature 1."
FT                   /inference="protein motif:Prosite:PS00180"
FT   CDS             complement(38201..38311)
FT                   /transl_table=11
FT                   /locus_tag="YE0028"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches. Similar to the N-terminal
FT                   region of Yersinia pestis possible membrane protein YPO0025
FT                   SWALL:Q8ZJR4 (EMBL:AJ414141) (52 aa) fasta scores: E():
FT                   1.8e-12, 80.55 38d in 36 aa. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:YE0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10173"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU0"
FT                   /inference="similar to sequence:INSDC:AJ414141"
FT                   /protein_id="CAL10173.1"
FT                   /translation="MHTDYQQTPMIWHKWGVWKVGIDFAIDFMTQFSMNN"
FT   CDS             38529..40352
FT                   /transl_table=11
FT                   /gene="bipA"
FT                   /gene_synonym="typA"
FT                   /locus_tag="YE0029"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10174"
FT                   /db_xref="GOA:A1JHU1"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU1"
FT                   /protein_id="CAL10174.1"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERAEATERVMDS
FT                   NDLEKERGITILAKNTAIKWKDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAMDG
FT                   PMPQTRFVTKKAFANGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPII
FT                   YASALMGIAGNDHNDMAADMTPLYQAIVDHVSPPQVEPDAPFQMQISQLDYNNYVGVIG
FT                   IGRIKRGKVKPNQQVTIVDSEGKTRNGKVGKVLTHMGLERIEATEAEAGDIVAITGLGE
FT                   LNISDTICDVNAVEALPALSVDEPTVSMYFCVNTSPFCGKEGKYVTSRQILERLNKELI
FT                   HNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIVREIDGRKQEP
FT                   FENVTLDIEEQHQGSVMQAMGERKADLKNMDPDGKGRVRLDYLIPARGLIGFRTEFMTM
FT                   TSGTGLLYSTFSHYDDVRPGEIGQRQNGVLISNGQGKAVAFALFKLQDRGKLFIGHGTE
FT                   VYEGQIIGIHSRSNDLTVNCLTGKQLTNMRASGTDEATTLVPFLKKTLEQALEFIDDDE
FT                   LVEVTPQSIRIRKRHLTENDRKRAGRGPKED"
FT   misc_feature    38535..39122
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 258.2, E-value 7.1e-75"
FT                   /inference="protein motif:PFAM:PF00009"
FT   misc_feature    38562..38585
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    38658..38705
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    39147..39395
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 71.9, E-value 8.8e-19"
FT                   /inference="protein motif:PFAM:PF03144"
FT   misc_feature    39711..39977
FT                   /note="Pfam match to entry PF00679 EFG_C, Elongation factor
FT                   G C-terminus, score 112.3, E-value 6e-31"
FT                   /inference="protein motif:PFAM:PF00679"
FT   CDS             40648..41235
FT                   /transl_table=11
FT                   /locus_tag="YE0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10175"
FT                   /db_xref="GOA:A1JHU2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU2"
FT                   /protein_id="CAL10175.1"
FT                   /translation="MLYIFDLGNVIVDIDFKRVLGVWSKLSSVPLATLSERFTMGEVFQ
FT                   QHERGEISDEDFARQLSDEMGLSLSFEQFAEGWQAVFVALRPEVISIMQKLRAEGHRVV
FT                   VLSNTNRLHCNYWPQHYPEVAAAADHMYLSQDLGMRKPEARIYQHVLSAENIPAEQAVF
FT                   FDDVEANIVAARIEGITGIHVTDRKVIPAYFS"
FT   misc_feature    40648..41208
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 61.6, E-value 1.1e-15"
FT                   /inference="protein motif:PFAM:PF00702"
FT   CDS             41328..42218
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="YE0031"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:YE0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10176"
FT                   /db_xref="GOA:A1JHU3"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHU3"
FT                   /protein_id="CAL10176.1"
FT                   /translation="MASFLRFRLSASLKPYITFGRMLYTRIDKDGLTMLAGHLAYVSLL
FT                   SLVPLVTVIFALFAAFPMFADISIKLKAFIFTNFMPATGDIIQNYLEQFVANSNRMTVV
FT                   GTCGLIVTALLLIYSVDSVLNIIWRSKVHRSLVFSFAVYWMVLTLGPILVGASMVISSY
FT                   LLSLQWLANARVDSMIDETLRLFPLLISWVSFWLLYSVVPTVRVPAQDALIGALVAALF
FT                   FELGKKGFTMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAQR
FT                   HQAITEKSPSQSQEI"
FT   misc_feature    41409..42161
FT                   /note="Pfam match to entry PF03631
FT                   Ribonuclease_BN,Ribonuclease BN-like family, score 289.2,
FT                   E-value 3.5e-84"
FT                   /inference="protein motif:PFAM:PF03631"
FT   misc_feature    join(41442..41510,41628..41687,41748..41816,41874..41933,
FT                   41967..42035,42063..42131)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0031 by TMHMM2.0 at aa 39-61, 101-120, 141-163,
FT                   183-202,214-236 and 246-268"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             42225..42662
FT                   /transl_table=11
FT                   /locus_tag="YE0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10177"
FT                   /db_xref="GOA:A1JHU4"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHU4"
FT                   /protein_id="CAL10177.1"
FT                   /translation="MIALIQRALSANVVVDGEVVGEIGPGLLILLGVEQQDTEQKAQRL
FT                   CEKVLGYRIFGDENDKMNLNVKQAGGSVLVVSQFTLVADTQKGMRPSFSRGASPAEADR
FT                   LYQYFVAQCREHGVKTETGLFAADMKVSLVNDGPVTFWLQI"
FT   misc_feature    42306..42659
FT                   /note="Pfam match to entry PF02580 DUF154, Uncharacterized
FT                   ACR, COG1490, score 261.8, E-value 6e-76"
FT                   /inference="protein motif:PFAM:PF02580"
FT   CDS             42914..43837
FT                   /transl_table=11
FT                   /locus_tag="YE0033"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10178"
FT                   /db_xref="GOA:A1JHU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU5"
FT                   /protein_id="CAL10178.1"
FT                   /translation="MYHLRVPTTEQELKDYYQFRWEMLRKPLHQPIGSEKDAYDAMAHH
FT                   QMVVDEQGKPVAIGRLYINADNEAAIRFLAVDPSVRSKGLGTLVAMTLESVARQEGVKR
FT                   VVCSAREDAVDFFSKLGFVSQGEITAPQTTPVRHFLMIKPVVTMDDILHRPDWCGQLQQ
FT                   AWYDHIPLSEKMGVRISQYTGQRFVTTMPEAGNQNPHHTLFAGSLFSLATLTGWGLIWL
FT                   LLRERHLGGTIILADAHIRYSAPVTGRPRAVAELSSLSGDLDRLARGRRARVQLDVNLF
FT                   GNEEAGAVFSGTYMVLPVDAEGDGVN"
FT   misc_feature    43052..43282
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 63.3,
FT                   E-value 3.3e-16"
FT                   /inference="protein motif:PFAM:PF00583"
FT   misc_feature    43184..43249
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1005.000, SD 2.61 at aa 91-112, sequence
FT                   MTLESVARQEGVKRVVCSARED"
FT   misc_feature    43517..43585
FT                   /note="1 probable transmembrane helix predicted for YE0033
FT                   by TMHMM2.0 at aa 202-224"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             44173..44418
FT                   /transl_table=11
FT                   /locus_tag="YE0034"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0034"
FT                   /db_xref="EnsemblGenomes-Tr:CCP19173"
FT                   /db_xref="GOA:K8FK39"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:K8FK39"
FT                   /protein_id="CCP19173.1"
FT                   /translation="MNKDWHRQEILAAIRKRKGSLSALSRDSGLSSGTLANALTRPWPK
FT                   GEMIIAEAIGITPQEIWPSRFIDYRGCSIIRRIRKN"
FT   repeat_region   44408..45116
FT                   /note="repeat unit encoding a LuxR-family transcriptional
FT                   regulator"
FT   CDS             44431..45117
FT                   /transl_table=11
FT                   /locus_tag="YE0035"
FT                   /product="LuxR family transcription regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA1347 SWALL:Q9I3Z7
FT                   (EMBL:AE004564) (230 aa) fasta scores: E(): 3e-09, 30.43 id
FT                   in 207 aa, and to the C-terminal region of Vibrio cholerae
FT                   LuxR family transcriptional regulator VCA1078 SWALL:Q9KKM5
FT                   (EMBL:AE004433) (319 aa) fasta scores: E(): 2.2e-10, 27.53
FT                   38d in 207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10179"
FT                   /db_xref="GOA:A1JHU6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU6"
FT                   /inference="similar to sequence:INSDC:AE004564"
FT                   /inference="similar to sequence:INSDC:AE004433"
FT                   /protein_id="CAL10179.1"
FT                   /translation="MEASLFNSLKMLIKFWECSSEPWGVKDNQSRYVYANNRLHKLFAL
FT                   PDKFSMEGRTDGELPTPISEFELEFQEHDCKVKLLQDRVTSVEIHAWNGHSYYQPYFFD
FT                   KYPLIDEHGVSQGIISHSRPVEDVILTHLNKIKVPISLILTPPSDLFSKREWEVLFYIL
FT                   HSFSSMEIATKLHLSSITVDNIIQKIYKKIGISGRQQLVDYCYENKINNYVPQSFFEYS
FT                   GSFPLV"
FT   misc_feature    44872..45069
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 41.3, E-value
FT                   1.4e-09"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    44926..44991
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1060.000, SD 2.80 at aa 166-187, sequence
FT                   FSSMEIATKLHLSSITVDNIIQ"
FT   repeat_region   45117..45833
FT                   /note="repeat unit encoding a LuxR-family transcriptional
FT                   regulator"
FT   CDS             45147..45833
FT                   /transl_table=11
FT                   /locus_tag="YE0036"
FT                   /product="LuxR family transcription regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA1347 SWALL:Q9I3Z7
FT                   (EMBL:AE004564) (230 aa) fasta scores: E(): 2.2e-09,30.37
FT                   38d in 214 aa, and to the C-terminal region of Vibrio
FT                   cholerae LuxR family transcriptional regulator VCA1078
FT                   SWALL:Q9KKM5 (EMBL:AE004433) (319 aa) fasta scores: E():
FT                   6.6e-13, 30.43 38d in 207 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10180"
FT                   /db_xref="GOA:A1JHU7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU7"
FT                   /inference="similar to sequence:INSDC:AE004564"
FT                   /inference="similar to sequence:INSDC:AE004433"
FT                   /protein_id="CAL10180.1"
FT                   /translation="MDKPLKNQLEILIRFWERSSEPWGARDNQSRFIYSNDRHHKLLGL
FT                   SDKYNLEGRLDSELPSPTAAFQMEFQAHDRKVELSQERITSVEIHEWDGLSYLKPNFCD
FT                   KYPLIDESGVSQGIIFHVRPVEDIILSRLTKIKAPTSLTFTPPSKLFTKREWEVLFYIL
FT                   HSYSSKDIAKKLHISPRTVSNITQSVYRKVGVSNKRQIVDYCYENKINNYVPQSFFEYS
FT                   GSFPLM"
FT   misc_feature    45588..45785
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 49.3, E-value
FT                   5.5e-12"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    45642..45707
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2073.000, SD 6.25 at aa 166-187, sequence
FT                   YSSKDIAKKLHISPRTVSNITQ"
FT   repeat_region   45834..46549
FT                   /note="repeat unit encoding a LuxR-family transcriptional
FT                   regulator"
FT   CDS             45863..46549
FT                   /transl_table=11
FT                   /locus_tag="YE0037"
FT                   /product="LuxR family transcription regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA347 SWALL:Q9I3Z7
FT                   (EMBL:AE004564) (230 aa) fasta scores: E(): 3.6e-10,30.47
FT                   38d in 210 aa, and to the C-terminal region of Vibrio
FT                   cholerae LuxR family transcriptional regulator VCA1078
FT                   SWALL:Q9KKM5 (EMBL:AE004433) (319 aa) fasta scores: E():
FT                   4.2e-10, 27.94 38d in 229 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10181"
FT                   /db_xref="GOA:A1JHU8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU8"
FT                   /inference="similar to sequence:INSDC:AE004564"
FT                   /inference="similar to sequence:INSDC:AE004433"
FT                   /protein_id="CAL10181.1"
FT                   /translation="MGETLKNQLEILIRFWEHSSEPWQIKDSQSRYIYANPRSHKLLSL
FT                   PAKYNMEGRLDGELPSPISEFQAEFQRQDRQVELLQDRITSAEIHIVDGKSYLTPFFCD
FT                   KYPLIDENGISQGVICHARPVHNLMLTRLNKIKAPTSLTFTPPSKLFTKREWEVLFYIL
FT                   HSYSSKDIAKKLHLSARTVSNITQSVYRKVGVSNKRQIVDYCYENKINNYVPQSFFEYS
FT                   GSFPLM"
FT   misc_feature    46304..46501
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 46.4, E-value
FT                   4.3e-11"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    46358..46423
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1813.000, SD 5.36 at aa 166-187, sequence
FT                   YSSKDIAKKLHLSARTVSNITQ"
FT   repeat_region   46550..47265
FT                   /note="repeat unit encoding a LuxR-family transcriptional
FT                   regulator"
FT   CDS             46579..47265
FT                   /transl_table=11
FT                   /locus_tag="YE0038"
FT                   /product="LuxR family transcription regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA1347 SWALL:Q9I3Z7
FT                   (EMBL:AE004564) (230 aa) fasta scores: E(): 1e-09, 31.28 id
FT                   in 211 aa, and to the C-terminal region of Vibrio cholerae
FT                   LuxR family transcriptional regulator VCA1078 SWALL:Q9KKM5
FT                   (EMBL:AE004433) (319 aa) fasta scores: E(): 4.1e-10, 27.94
FT                   38d in 229 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10182"
FT                   /db_xref="GOA:A1JHU9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHU9"
FT                   /inference="similar to sequence:INSDC:AE004564"
FT                   /inference="similar to sequence:INSDC:AE004433"
FT                   /protein_id="CAL10182.1"
FT                   /translation="MGETLKNQLEILIRFWEHSSEPWQIKDSQSRYIYANPRTHKLLSL
FT                   PAKYNMEGRLDGELPSPISEFQAEFQRQDRQVELLQDRITSAEIHIVDGKSYLTLFFCD
FT                   KYPLIDEYGISQGVICHDRPVHNLMLTRLNKIKAPTSLTFTPPSKLFTKREWEVLFYIL
FT                   HSYSSKDIAKKLHLSARTVSNITQSVYRKVGVSNKRQIVDYCYENKINNYVPQSFFEYS
FT                   GSFPLM"
FT   misc_feature    47020..47217
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 46.4, E-value
FT                   4.3e-11"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    47074..47139
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1813.000, SD 5.36 at aa 166-187, sequence
FT                   YSSKDIAKKLHLSARTVSNITQ"
FT   repeat_region   47266..47965
FT                   /note="repeat unit encoding a LuxR-family transcriptional
FT                   regulator"
FT   CDS             47294..47980
FT                   /transl_table=11
FT                   /locus_tag="YE0039"
FT                   /product="LuxR family transcription regulatory protein"
FT                   /note="Similar to Pseudomonas aeruginosa probable
FT                   transcriptional regulator PA1347 SWALL:Q9I3Z7
FT                   (EMBL:AE004564) (230 aa) fasta scores: E(): 3.8e-08,29.04
FT                   38d in 210 aa, and to Vibrio cholerae LuxR family
FT                   transcriptional regulator VCA1078 SWALL:Q9KKM5
FT                   (EMBL:AE004433) (319 aa) fasta scores: E(): 2.9e-10, 28.5
FT                   id in 214 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10183"
FT                   /db_xref="GOA:A1JHV0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV0"
FT                   /inference="similar to sequence:INSDC:AE004564"
FT                   /inference="similar to sequence:INSDC:AE004433"
FT                   /protein_id="CAL10183.1"
FT                   /translation="MDKPLKNQLEILIRFWERSSEPWAIKDNQSKFIYANRRVYKLFNL
FT                   PNKYTLEGRLDGEIPTPSADFQDEFQQQDRQVELSQDRVTSVDIQLYDGFSYFTPYFSD
FT                   KYPLIDENGVSQGVICHARPVQDIMLTHLNKIKVPTSLIFTPPSKLFTKREWEVLFYIL
FT                   HSYSSKDLAEKLHLSPRTVSNIIQSVYRKAGVSNKRQIVDYCYENKINNYVPQSFFEYS
FT                   KSFPLM"
FT   misc_feature    47735..47932
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 43.2, E-value
FT                   3.9e-10"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    47789..47854
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2197.000, SD 6.67 at aa 166-187, sequence
FT                   YSSKDLAEKLHLSPRTVSNIIQ"
FT   CDS             complement(48077..49786)
FT                   /transl_table=11
FT                   /locus_tag="YE0040"
FT                   /product="possible exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10184"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV1"
FT                   /protein_id="CAL10184.1"
FT                   /translation="MKFLGKVLLTLLLLLVLSIVLCYVLLQTSWAAGWLSRWVSDNSEY
FT                   RLSLGKIDHSWSQPGQVSFTDVTLGRAKQPVFLIAQQAVLGLSWRQLTEPRHFRSLNLQ
FT                   NGSLTLNNSTSPLPLQADTLRLTNMALNTTIEPQNKAGQWKVTGQQVTGGLIPWQPLPG
FT                   NSLGENAQFQFSAGSLTINGITAEKLYLQGSIQKNALTLSNFGADIAQGELTGNASQSA
FT                   DGSWLVDRLRLSNIRLQTPATLEDVWNTFLQLPPITLKRFDLIDARVEGKNWAFNDLDL
FT                   TLKNITFKQGDWQSDEGELSLNAGDIIKGNIHLIDPIATFTLSPAGVAINQFSTRWQDG
FT                   LLRAQGNWLRDSHRLQLDELTLVALVYTLPTDWKQQWQQTLPNWLSEVYISKLNANRNL
FT                   LIDISPDFPFQITSLDAAGTNLLLAKNHQWGVWSGSLMLNAGNATFNKNDVRRPSLALS
FT                   ANEQQITVSDLSTFTKEGLLEATATIDQTSGRALSLALTGRSVDLNILQNWGWPALPLQ
FT                   GLGNLKLRISGNLTADKPLKPTINGSLQATDNHGQQVNQTMQNGEVHGVAGQ"
FT   sig_peptide     complement(49694..49786)
FT                   /locus_tag="YE0040"
FT                   /note="Signal peptide predicted for YE0040 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.986 between residues 31 and 32"
FT   misc_feature    complement(49700..49768)
FT                   /note="1 probable transmembrane helix predicted for YE0040
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(49933..51318)
FT                   /transl_table=11
FT                   /locus_tag="YE0041"
FT                   /product="putative membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10185"
FT                   /db_xref="GOA:A1JHV2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029934"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV2"
FT                   /protein_id="CAL10185.1"
FT                   /translation="MSTQSAELNTPQQATTHPSELIYRLEDRPPLAQTLFAACQHLLAM
FT                   FVAVITPGLLICQALGLPAEDTQRIISMSLFASGLASLLQIKTWGPVGSGLLSIQGTSF
FT                   NFVSPLIMGGLALKNGGADIPTMMAALFGTLMVASCTEIILSRFLHLARRIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYGAMSDHTFGSPKNLMLAGAVLVVIILLNRQRNPYLRVA
FT                   SLVIAMAVGYLLAWTLGMLPESRPVVDTALITIPTPLYYGLSFDWNLLVPLMLIFMVTS
FT                   LETIGDITATSDVSEQPVHGPLYMKRLKGGVLANGLNSMLSAVFNTFPNSCFGQNNGVI
FT                   QLTGVASRYVGFVVALMLIVLGLFPAVAGFVQHIPEPVLGGATLVMFGTIAASGVRIVS
FT                   RETLNRRAIMIMALSLAVGMGVAQQPLILQFAPDWIKTLLSSGIAAGGITAIVLNLIFP
FT                   QEK"
FT   misc_feature    complement(join(49948..50007,50035..50103,50122..50190,
FT                   50203..50271,50473..50541,50599..50667,50686..50745,
FT                   50788..50856,50875..50943,50971..51039,51127..51195))
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0041 by TMHMM2.0 at aa 42-64, 94-116, 126-148,
FT                   155-177,192-211, 218-240, 260-282, 350-372, 377-399,
FT                   406-428 and 438-457"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(50038..51225)
FT                   /note="Pfam match to entry PF00860 xan_ur_permease,Permease
FT                   family, score 528.7, E-value 2.8e-156"
FT                   /inference="protein motif:PFAM:PF00860"
FT   misc_feature    complement(50137..50199)
FT                   /note="PS01116 Xanthine/uracil permeases family signature."
FT                   /inference="protein motif:Prosite:PS01116"
FT   misc_feature    complement(50689..50736)
FT                   /note="PS00038 Myc-type, 'helix-loop-helix' dimerization
FT                   domain signature."
FT                   /inference="protein motif:Prosite:PS00038"
FT   misc_feature    complement(50899..50931)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(51202..51234)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             51557..52771
FT                   /transl_table=11
FT                   /gene="gltS"
FT                   /gene_synonym="gltC"
FT                   /locus_tag="YE0042"
FT                   /product="sodium/glutamate symport carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10186"
FT                   /db_xref="GOA:A1JHV3"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV3"
FT                   /protein_id="CAL10186.1"
FT                   /translation="MFHLDTYGTLVAACLVLLLGRKLVQTVPFLKKYTIPEPVAGGLLV
FT                   AFMMLLMQKTLGWEISFDMSLKDPLMLAFFATIGLNANLASLRAGGKALSVFVFVVVGL
FT                   LLMQNAIGIALAKLMGLDPLMGLLAGSITLSGGHGTGAAWSKVFVERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSSTPDGTPEDSEIPSAFEKPSAGRMITSLVLTETIA
FT                   MIAICLMVGQVISAGLQGTMFELPTFVCVLFVGVILSNTLSAIGFYKVFDRAVSVLGNV
FT                   SLSLFLAMALMSLKLWELASLALPMLVILSVQALAMALYAIFVTYRLMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITDRFGPSHLAFLVVPMVGAFFIDIVNVIVIKLYLLLPIF
FT                   PAVVG"
FT   misc_feature    51560..52654
FT                   /note="Pfam match to entry PF03616
FT                   Glt_symporter,Sodium/glutamate symporter, score 808.3,
FT                   E-value 1.8e-240"
FT                   /inference="protein motif:PFAM:PF03616"
FT   misc_feature    join(51566..51619,51653..51706,51764..51817,51836..51904,
FT                   52025..52093,52193..52261,52289..52357,52376..52432,
FT                   52460..52528,52562..52630,52658..52726)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0042 by TMHMM2.0 at aa 4-21, 33-50, 70-87,
FT                   94-116,157-179, 213-235, 245-267, 274-292, 302-324, 336-358
FT                   and 368-390"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(52840..54921)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="YE0043"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10187"
FT                   /db_xref="GOA:A1JHV4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV4"
FT                   /protein_id="CAL10187.1"
FT                   /translation="MKGRLLDAVPLSTLSGVGASQAGKLAKMGLETIQDLLLHLPLRYE
FT                   DRTRLYRIGDLLPGLSVTVEGEVLRSDISFGRRRMMTCQISDGSGVLTLRFFNFNAAMK
FT                   NSLSPGKHVIAYGEAKRGNTGPEIIHPEYRVHGENIGVELQESLTPVYPTTEGIRQATL
FT                   RKLIDQALAMLDSSVIAELLPIELSRSLISLPEAIHILHRPPADIQLADLEQGKHPAQR
FT                   RLIMEELLAHNLSMLAVRAGAQSYRALPLLPEEQLKRRFLAALPFTPTHAQQRVVAEIE
FT                   QDMTHSYPMMRLIQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHANTFRQW
FT                   LEPLGLEVGWLAGKQKGKARLAQQEAVASGQVSMVVGTHAMFQEQVQFSGLALVIIDEQ
FT                   HRFGVHQRLALWEKGEEQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDELPPGRTPV
FT                   TTVAIPDTRRSDVIQRVKNACLEEGRQAYWVCTLIEESELLEAQAAEVTCEELKIALPE
FT                   IKVGLVHGRMKGPEKQAVMLAFKQGELQLLVATTVIEVGVDVPNASLMIIDNPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKTPLSKTAQMRLQVLRDSNDGFVIAQRDLEIRGPGEL
FT                   LGTRQTGSAEFKVADLLRDQAMIPEVQRVARHLHQQYPEHAQALIERWLPERTRYTNA"
FT   misc_feature    complement(53155..53373)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 79.9, E-value 3.4e-21"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    complement(53545..54147)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 123.2, E-value 3.1e-34"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    complement(54013..54036)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(54514..54738)
FT                   /note="Pfam match to entry PF01336 tRNA_anti, OB-fold
FT                   nucleic acid binding domain, score 34.6, E-value 1.5e-07"
FT                   /inference="protein motif:PFAM:PF01336"
FT   sig_peptide     complement(54856..54921)
FT                   /gene="recG"
FT                   /locus_tag="YE0043"
FT                   /note="Signal peptide predicted for YE0043 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.878) with cleavage site
FT                   probability 0.798 between residues 22 and 23"
FT   CDS             complement(54922..55614)
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /gene_synonym="spoU"
FT                   /locus_tag="YE0044"
FT                   /product="tRNA (guanosine-2'-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10188"
FT                   /db_xref="GOA:A1JHV5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV5"
FT                   /protein_id="CAL10188.1"
FT                   /translation="MNPQRYARICEMLATRQPDLTVCLEEVHKPHNVSAIIRTADAVGI
FT                   HQIHAIWPTPAMYTRLSSAAGSNSWVQVKTHSHITDAITHLKSQGMQILATHLSDKAVD
FT                   FREIDYTRPTCILMGQEKTGISKEALAMADKDIIIPMIGMVQSLNVSVASALILYEAQR
FT                   QRQNAGMYQRTQSVLSEDEQQRLLFEGGYPVLAQVAKRKGLPQPYIDEQGQVIADAQWW
FT                   SAMQSTES"
FT   misc_feature    complement(55138..55560)
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 188.6, E-value 6.6e-54"
FT                   /inference="protein motif:PFAM:PF00588"
FT   CDS             complement(55620..57722)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="YE0045"
FT                   /product="guanosine-3',5'-bisbis(diphosphate)
FT                   3'-pyrophosphydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10189"
FT                   /db_xref="GOA:A1JHV6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV6"
FT                   /protein_id="CAL10189.1"
FT                   /translation="MYLFESLNLLIQRYLPEEQIKRLKQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMRLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHLKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILAEIEG
FT                   RLTEAGIPCRVSGREKHLYSIYCKMNLKEQRFHSIMDIYAFRVIVKEVDTCYRVLGQAH
FT                   SLYKPRPGRVKDYIAIPKANGYQSLHTSLIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEQGESGTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIVE
FT                   LPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQPLSSGQTVEIITAPGARPNAAWL
FT                   NFVVSSKARAKIRQLLKNLKRDESVSLGRRLLNHALGNGRKLSDIPEENIKHELDRMKL
FT                   ATLDDLLAEIGLGNAMSVVVAKNLLGDPSTLATSGTRNLAIKGADGVLITFAKCCRPIP
FT                   GDPIIAHISPGKGLVIHHESCRNIRGYQKEPEKFMAVEWDQETEQEFIAEIKVDMFNQQ
FT                   GALANLTAAINAAESNIQSLNTEEKDGRVYSAFIRLTTRDRVHLANIMRKIRIMPDVVK
FT                   VSRNRN"
FT   misc_feature    complement(55629..55850)
FT                   /note="Pfam match to entry PF01842 ACT, ACT domain, score
FT                   15.3, E-value 0.097"
FT                   /inference="protein motif:PFAM:PF01842"
FT   misc_feature    complement(56382..56573)
FT                   /note="Pfam match to entry PF02824 TGS, TGS domain, score
FT                   110.2, E-value 2.6e-30"
FT                   /inference="protein motif:PFAM:PF02824"
FT   misc_feature    complement(57291..57590)
FT                   /note="Pfam match to entry PF01966 HD, HD domain, score
FT                   74.5, E-value 1.4e-19"
FT                   /inference="protein motif:PFAM:PF01966"
FT   misc_feature    complement(57561..57593)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(57741..58016)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="YE0046"
FT                   /product="DNA-directed RNA polymerase, omega chain"
FT                   /db_xref="EnsemblGenomes-Gn:YE0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10190"
FT                   /db_xref="GOA:A1JHV7"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHV7"
FT                   /protein_id="CAL10190.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQIQSGGKDALVPEENDK
FT                   VTVIALREIEEGLITNQILDVRERQEQQEQEAAEIQAVTAIAEGRR"
FT   misc_feature    complement(57822..57983)
FT                   /note="Pfam match to entry PF01192 RNA_pol_Rpb6, RNA
FT                   polymerase Rpb6, score 78.8, E-value 7.6e-21"
FT                   /inference="protein motif:PFAM:PF01192"
FT   CDS             complement(58071..58694)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /gene_synonym="spoR"
FT                   /locus_tag="YE0047"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10191"
FT                   /db_xref="GOA:A1JHV8"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHV8"
FT                   /protein_id="CAL10191.1"
FT                   /translation="MVQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAKR
FT                   PGENHGEHYFFVSKEEFCQMIDDDAFLEHAKVFENYYGTSRLAIEQVLATGVDVFLDID
FT                   WQGAQQIRAKMPTARSIFILPPSKEELDRRLRGRGQDSEEVIAKRMAQAVAEMTHYAEY
FT                   DYLIVNDDFNLALSDLKTIIRAERLRLGRQKQRHDALITKLLAD"
FT   misc_feature    complement(58260..58574)
FT                   /note="Pfam match to entry PF00625 Guanylate_kin,Guanylate
FT                   kinase, score 198.3, E-value 7.9e-57"
FT                   /inference="protein motif:PFAM:PF00625"
FT   misc_feature    complement(58524..58577)
FT                   /note="PS00856 Guanylate kinase signature."
FT                   /inference="protein motif:Prosite:PS00856"
FT   misc_feature    complement(58641..58664)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             58977..60674
FT                   /transl_table=11
FT                   /locus_tag="YE0048"
FT                   /product="putative DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10192"
FT                   /db_xref="GOA:A1JHV9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHV9"
FT                   /protein_id="CAL10192.1"
FT                   /translation="MNVHKMKILSLLMVSFISWQARAESVCPEWSEERMSGEMHLLEKQ
FT                   LDQWNIAYHQQGISPIADDIYDQLQDKLHRWRLCLGLPDKTDNRPIPGNGKMLHPVAHT
FT                   GLKKLKDEAALISWMTGRKNLWVQPKIDGVAVTLVYQAGKLTQVLSRGNGLKGQNWADK
FT                   APFISAIPQYIASAPPLLTLQGEVFLQMEGHQQAQSGGANARASVAGALMRKSVSPLLA
FT                   KLGIFIWAWPDGPKSMVEKSRLLQEMGFPLTAHYSEPVISSSDVALWRDRWFKMPLPFV
FT                   TDGVVIRQENVPAGRYWQATPGNWSVAWKYPPPQQITEIKDIHFTVGRTGKITAILQVI
FT                   PVKIDDKWIRRVNIGSIARWKQWDIVPGDQVTISLAGQGIPRLDKVIWRVSQRQEIVPP
FT                   DADKFHQLTCFRRLPFECEPQFLSRLAWLSGTNGLDMQSVGNGLWRELIHHGFINGLLD
FT                   WLSLSVEQIAAVPGIGQGRAEKIYQQFQRARQQPFSQWLQALGFPQGIPLDTSWHSLRQ
FT                   RSIAEWRLMPGIGQVRAKQINHFLHHPEVQMMADFLSQQGIAGFSPEE"
FT   sig_peptide     58977..59045
FT                   /locus_tag="YE0048"
FT                   /note="Signal peptide predicted for YE0048 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.991) with cleavage site
FT                   probability 0.950 between residues 23 and 24"
FT   misc_feature    59073..59918
FT                   /note="Pfam match to entry PF01653
FT                   DNA_ligase_N,NAD-dependent DNA ligase adenylation domain,
FT                   score 109.4,E-value 4.4e-30"
FT                   /inference="protein motif:PFAM:PF01653"
FT   misc_feature    59922..60176
FT                   /note="Pfam match to entry PF03120
FT                   DNA_ligase_OB,NAD-dependent DNA ligase OB-fold domain,
FT                   score 73.6,E-value 2.7e-19"
FT                   /inference="protein motif:PFAM:PF03120"
FT   CDS             complement(60692..61309)
FT                   /transl_table=11
FT                   /locus_tag="YE0049"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10193"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW0"
FT                   /protein_id="CAL10193.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRQMDMFGVIIIASATAIGGGS
FT                   VRDMLLGHYPLGWVKHPEYIVIVAVAAIVTTWMAPLMKHLRHLFLVLDAIGLIVFSIIG
FT                   AQIALDMGHSTIIAAIAAVITGVFGGVLRDMFCNCIPLVFQKEIYAGISFAAAWIYIAL
FT                   QYTPLSHNWVVVITLVTGLSARLLALRFRLGLPVFKYEHSEH"
FT   misc_feature    complement(join(60743..60796,60824..60892,60911..60979,
FT                   60989..61048,61067..61120,61157..61225,61244..61297))
FT                   /note="7 probable transmembrane helices predicted for
FT                   YE0049 by TMHMM2.0 at aa 5-22, 29-51, 64-81,
FT                   88-107,111-133, 140-162 and 172-189"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(60791..61045)
FT                   /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain,
FT                   score 130.6, E-value 1.9e-36"
FT                   /inference="protein motif:PFAM:PF03458"
FT   misc_feature    complement(61046..61303)
FT                   /note="Pfam match to entry PF03458 UPF0126, UPF0126 domain,
FT                   score 138.7, E-value 6.7e-39"
FT                   /inference="protein motif:PFAM:PF03458"
FT   CDS             61529..62080
FT                   /transl_table=11
FT                   /locus_tag="YE0050"
FT                   /product="putative membrane protein"
FT                   /note="Poor database matches. Similar to an internal region
FT                   of Halobacterium sp. hypothetical protein VNG2239c
FT                   SWALL:Q9HN60 (EMBL:AE005109) (308 aa) fasta scores: E():
FT                   2.7, 29.37 38d in 143 aa. Possible alternative
FT                   translational start sites"
FT                   /db_xref="EnsemblGenomes-Gn:YE0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10194"
FT                   /db_xref="InterPro:IPR021957"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW1"
FT                   /inference="similar to sequence:INSDC:AE005109"
FT                   /protein_id="CAL10194.1"
FT                   /translation="MMIILPDCRVTHPMVAFISISSFISVGFFMSQCIQSFQYRAVLLA
FT                   GIAAVGVLLSGCVDRTGQANTATIKASPSTCIKGEPMTQTTLYFGLNRPHGPVISATEW
FT                   QSFVDNDVTSRFKDGLTVIDAKGQWLGNDGTVAKENSKALVLIHKADKETAIETLRARY
FT                   KQQFAQESVMRVDAAVCVDF"
FT   misc_feature    join(61565..61624,61634..61702)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0050 by TMHMM2.0 at aa 13-32 and 36-58"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(62176..63360)
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /gene_synonym="cru"
FT                   /locus_tag="YE0051"
FT                   /product="nucleoside permease"
FT                   /note="Similar to Escherichia coli nucleoside permease NupC
FT                   or Cru SWALL:NUPC_ECOLI (SWALL:P33031) (400 aa) fasta
FT                   scores: E(): 4.2e-106, 71.75 38d in 400 aa, and to
FT                   Salmonella typhi nucleoside permease STY2650 SWALL:Q8Z4X4
FT                   (EMBL:AL627274) (400 aa) fasta scores: E(): 7.5e-106,71.75
FT                   38d in 400 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10195"
FT                   /db_xref="GOA:A1JHW2"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW2"
FT                   /inference="similar to sequence:INSDC:AL627274"
FT                   /inference="similar to sequence:UniProtKB:P33031"
FT                   /protein_id="CAL10195.1"
FT                   /translation="MLQILHFLLALIAIAVLALLASHDRKNIKLRYIFQLLIIEIALAY
FT                   FFLHSESGLGAIKYFAGLFESLMKFASIGTSFVFGGMNEQGLAFIFLNVLCPIIFVSAL
FT                   IGILQHFRILPLIIRVIGTLLSKVNGMGKLESFNAVSTLILGQSENFIAYKGIIADISP
FT                   RRMYTMAATAMSTVSMSIVSAYMTMLEPKFVVTALILNMFSTFIVLSIINPYPVTEEPE
FT                   LKLNNLHEDQSFFEMLGEYILAGFKIAMIIAAMLIGFIAIISAINALFSTLFHISFQGV
FT                   LGYLFYPLALLIGIPTQDALHAGSIMATKLVANEFVAMIELKKVAAEISPRGLGILSVF
FT                   LVSFANFASIGIVAGAIKGLNEQQGNVVSRFGLKLVYGSTLVSLLSATIAGLVL"
FT   misc_feature    complement(62179..63357)
FT                   /note="Pfam match to entry PF01773 Nucleoside_tra2, Na+
FT                   dependent nucleoside transporter, score 597.4, E-value
FT                   5.8e-177"
FT                   /inference="protein motif:PFAM:PF01773"
FT   misc_feature    complement(join(62182..62250,62293..62361,62476..62544,
FT                   62572..62640,62716..62784,62794..62862,63037..63105,
FT                   63214..63273,63292..63351))
FT                   /note="9 probable transmembrane helices predicted for
FT                   YE0051 by TMHMM2.0 at aa 4-23, 30-49, 86-108,
FT                   167-189,193-215, 241-263, 273-295, 334-356 and 371-393"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             63619..64512
FT                   /transl_table=11
FT                   /locus_tag="YE0052"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="Similar to Escherichia coli probable enoyl-CoA
FT                   hydratase PaaF SWALL:PAAF_ECOLI (SWALL:P76082) (255 aa)
FT                   fasta scores: E(): 2.5e-06, 27.66 38d in 253 aa, and to
FT                   Xanthomonas campestris RpfF protein, mutants of which are
FT                   unable to produce a diffusible extracellular factor which
FT                   regulates synthesis of extracellular enzymes and modulates
FT                   virulence SWALL:O05175 (EMBL:Y09701) (289 aa) fasta scores:
FT                   E(): 1.2e-27, 34.02 38d in 288 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10196"
FT                   /db_xref="GOA:A1JHW3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW3"
FT                   /inference="similar to sequence:INSDC:Y09701"
FT                   /inference="similar to sequence:UniProtKB:P76082"
FT                   /protein_id="CAL10196.1"
FT                   /translation="MFNSLIGWNMNMINLPSCRSFTEAGHLSQISAYYEEGRNTLWMLL
FT                   RAHPRPCFNLELIENIMTLAQAAKESKLPIDFWVTGSVVPNMFNVGGDLNFFAQMIKNR
FT                   KREALMAYARACVDCVHAASRGFDTGAISIAMIEGSALGGGFEAALAHHFVLAQTTARM
FT                   GFPEIAFNLFPGMGGYSLVARKAGMRVAEQLIWTGESHAAEWYESRGLVDKLFQPGDAY
FT                   IATRTFIDTIRPKLNGMRAMVRVRQRVLQLTRSELMDITEDWVDSAFSIEPKDIAYIER
FT                   LVMLQDRHTSGMPKAI"
FT   misc_feature    63745..64269
FT                   /note="Pfam match to entry PF00378 ECH, Enoyl-CoA
FT                   hydratase/isomerase family, score 25.7, E-value 2.7e-10"
FT                   /inference="protein motif:PFAM:PF00378"
FT   CDS             complement(64538..66532)
FT                   /transl_table=11
FT                   /locus_tag="YE0053"
FT                   /product="putative signalling protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YciR SWALL:YCIR_ECOLI (SWALL:P77334) (661 aa) fasta scores:
FT                   E(): 3.9e-156, 60.61 38d in 650 aa, and to Salmonella typhi
FT                   hypothetical protein STY1349 SWALL:Q8Z7D0 (EMBL:AL627270)
FT                   (660 aa) fasta scores: E(): 1.3e-152,60.24 38d in 654 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10197"
FT                   /db_xref="GOA:A1JHW4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW4"
FT                   /inference="similar to sequence:INSDC:AL627270"
FT                   /inference="similar to sequence:UniProtKB:P77334"
FT                   /protein_id="CAL10197.1"
FT                   /translation="MFQDQDTSILNTYFGTHRPFWRLAFDSQALELSAIKEIANIAIPL
FT                   NSVQTMKIRSLTGITASLDIEIEIYGHPLHLHLVGRKINDKEWGGTASAYADTESVARD
FT                   LVMGLSFAEQVVSEANSVIVILDKDGCVQRFNHLSEEYTGKKEQDVIGKNVYDLFMTAK
FT                   EGASSRKNIEGFFQRGASYEAERWVNTVKGKRLFLFRNKFVHSGSGKNERYLICSGTDI
FT                   TKERRAQERLRILANTDMITGLPNRHAIHERINSAIQTRGDSSVGIIYLDLDNFKKVND
FT                   HYGHMFGDRLLKDVSLAILSCLGDNEMLARLGGDEFIVLVENATLDLLEITTQRILNRM
FT                   KLPFRIGLIEVYTGCSIGIALCPEHGDTLENIIRSADTAMYTAKEHGKQTYSIFSQQMN
FT                   KKVSEYVWLDTNLRKAIEQHQLQIFYQPKISTKTGKVLGVEALVRWLSPERGLIAPQEF
FT                   ISYAEESGLIRPLGKWVLQTSMQQAVDWKKRGINLRIAVNVSARQLIDEAIVTSFIESL
FT                   EACELESSLVDVELTESCLIDNEDAAINIMKQLRHLGAQVHLDDFGTGYSSLSQLARIP
FT                   IDAIKLDQSFVRHIDTNPISQSLVRAIIVVAEALKMQVIAEGVETKEEEEFLDSIGVDE
FT                   KQGFLYAKPMPADKLEHWLVTQHPHLLLD"
FT   misc_feature    complement(64586..65323)
FT                   /note="Pfam match to entry PF00563 EAL, EAL domain, score
FT                   401.0, E-value 7.4e-118"
FT                   /inference="protein motif:PFAM:PF00563"
FT   misc_feature    complement(65363..65839)
FT                   /note="Pfam match to entry PF00990 GGDEF, GGDEF domain
FT                   ,score 195.5, E-value 5.2e-56"
FT                   /inference="protein motif:PFAM:PF00990"
FT   misc_feature    complement(66056..66205)
FT                   /note="Pfam match to entry PF00989 PAS, PAS domain, score
FT                   22.5, E-value 8.3e-06"
FT                   /inference="protein motif:PFAM:PF00989"
FT   CDS             complement(67055..67885)
FT                   /transl_table=11
FT                   /locus_tag="YE0055"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="Similar to Methanosarcina acetivorans
FT                   metallo-beta-lactamase superfamily protein MA1962
FT                   SWALL:AAM05365 (EMBL:AE010879) (280 aa) fasta scores: E():
FT                   3e-44, 44.84 38d in 281 aa, and to Clostridium
FT                   acetobutylicum metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II CAC0535 SWALL:Q97LM2
FT                   (EMBL:AE007569) (268 aa) fasta scores: E(): 2.8e-41,41.66
FT                   38d in 276 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10198"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW5"
FT                   /inference="similar to sequence:INSDC:AE010879"
FT                   /inference="similar to sequence:INSDC:AE007569"
FT                   /protein_id="CAL10198.1"
FT                   /translation="MQLTVLVDNNTLIDKYLTAEPGVCYHLKIDGKTYLFDTGYSDVFL
FT                   RNAAILGIDISDIDSVIISHGHNDHSWGLIHLAQYLDRTNYPSVKKIKLVAHPNAFVPK
FT                   YHEDKSIGANLPADSYPSFFERINQTGVYYLTDNLLFLGEIVRSNDFEGLHPIGKTINC
FT                   CGHEVDDFVIDDSAIVYTSPEGIVIITGCSHSGICNIIDYAIKVTGDKRIRAVIGGFHL
FT                   LNAETSTLTRTSDYFKQLNAQALYPCHCTDLKAKIALAGAVDIEEVGVGMVLNF"
FT   misc_feature    complement(67139..67837)
FT                   /note="Pfam match to entry PF00753
FT                   lactamase_B,Metallo-beta-lactamase superfamily, score 11.7,
FT                   E-value 0.00023"
FT                   /inference="protein motif:PFAM:PF00753"
FT   misc_feature    complement(67406..67429)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(68287..69150)
FT                   /transl_table=11
FT                   /locus_tag="YE0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10199"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHW6"
FT                   /protein_id="CAL10199.1"
FT                   /translation="MIRSMTAYARRDIKGEWGSAAWELRSVNQRYLETYIRLPEQFRSL
FT                   EPVIRERIRGRLTRGKIECNLRFELDANAQSSLILNEKLAKQLVEAGNWVKMQSDEGEI
FT                   NPVDILRWPGVMAAEEQDLDAISTELMQALDIVLDDFIISRETEGAALKALIEQRLDGV
FT                   SAEIVKVRAHMPNILQWQRERLLNKLEEAQVQLENTRLEQELVLMAQRVDVAEELDRLE
FT                   AHVKETHNILKKKEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   misc_feature    complement(68686..69147)
FT                   /note="Pfam match to entry PF03755 YicC_N-term, YicC-like
FT                   family, N-terminal region, score 272.9, E-value 2.8e-79"
FT                   /inference="protein motif:PFAM:PF03755"
FT   CDS             69277..69993
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="YE0058"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:YE0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10200"
FT                   /db_xref="GOA:A1JHW7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHW7"
FT                   /protein_id="CAL10200.1"
FT                   /translation="MRPADRAAQQVRPLTLTRNYTKHAEGSVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRSTHSRNAREAAKGKQGGRTLEIQRLIARSLRAAVDL
FT                   KKLGEFTITLDCDVLQADGGTRTASISGACVALADALNKLVASGKLKANPMKGLVAAVS
FT                   VGIVKGEALCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLALAR
FT                   GGIETIFQAQKAALEQ"
FT   misc_feature    69304..69705
FT                   /note="Pfam match to entry PF01138 RNase_PH, 3'
FT                   exoribonuclease family, domain 1, score 196.1, E-value
FT                   3.5e-56"
FT                   /inference="protein motif:PFAM:PF01138"
FT   misc_feature    69622..69660
FT                   /note="PS01277 Ribonuclease PH signature."
FT                   /inference="protein motif:Prosite:PS01277"
FT   misc_feature    69745..69948
FT                   /note="Pfam match to entry PF03725 RNase_PH_C, 3'
FT                   exoribonuclease family, domain 2, score 73.9, E-value
FT                   2.2e-19"
FT                   /inference="protein motif:PFAM:PF03725"
FT   CDS             70145..70786
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="YE0059"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10201"
FT                   /db_xref="GOA:A1JHW8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHW8"
FT                   /protein_id="CAL10201.1"
FT                   /translation="MKAYQREFIEFALNKQVLKFGEFTLKSGRISPYFFNAGLFNTGLE
FT                   LAKLGRFYAAALMDCGVEFDLLFGPAYKGIPIATTTAVALAEHHNRDLPYCFNRKEAKD
FT                   HGEGGSLVGSPLEGRVMLVDDVITAGTAIRESMEIINAQGATLAGVMISLDRQERGRGE
FT                   ISAIQEVERDYHCKVIAIVTLNDVISYLEEKPEMADHLAAVRHYREQYGV"
FT   misc_feature    70238..70699
FT                   /note="Pfam match to entry PF00156
FT                   Pribosyltran,Phosphoribosyl transferase domain, score
FT                   103.2, E-value 3.2e-28"
FT                   /inference="protein motif:PFAM:PF00156"
FT   misc_feature    70502..70540
FT                   /note="PS00103 Purine/pyrimidine phosphoribosyl
FT                   transferases signature."
FT                   /inference="protein motif:Prosite:PS00103"
FT   CDS             complement(70864..71460)
FT                   /transl_table=11
FT                   /gene="ttk"
FT                   /locus_tag="YE0060"
FT                   /product="TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10202"
FT                   /db_xref="GOA:A1JHW9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHW9"
FT                   /protein_id="CAL10202.1"
FT                   /translation="MAEKENTKRNRREEILQALAQMLESSDGSQRITTAKLAANVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLMSRINLILQDEKETFNRLRLILLLVLGFAERNPG
FT                   LTRIMTGHALMFEQDRLQGRINQLFERIEVQLRQVLREKKLRDGQGFIHDEALLATQLL
FT                   AFCEGMLSRFVRSEFRYRPTQEFDARWPLIVAQLQ"
FT   misc_feature    complement(71275..71418)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 41.0, E-value
FT                   1.7e-09"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    complement(71287..71379)
FT                   /note="PS01081 Bacterial regulatory proteins, tetR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01081"
FT   misc_feature    complement(71302..71367)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1905.000, SD 5.68 at aa 32-53, sequence
FT                   ITTAKLAANVGVSEAALYRHFP"
FT   CDS             complement(71581..72036)
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /gene_synonym="dnaS"
FT                   /gene_synonym="sof"
FT                   /locus_tag="YE0061"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0061"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10203"
FT                   /db_xref="GOA:A1JHX0"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHX0"
FT                   /protein_id="CAL10203.1"
FT                   /translation="MKKIDIKILDPRVGNEFPLPTYATEGSAGLDLRACLSEAVDLLPG
FT                   QTTLLPTGLAIHIGDSSLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   QQPFTIEPGERIAQMVFVPVIQAEFNLVEDFDLSERGTGGFGHSGRQ"
FT   misc_feature    complement(71590..71994)
FT                   /note="Pfam match to entry PF00692 dUTPase, dUTPase ,score
FT                   180.9, E-value 1.3e-51"
FT                   /inference="protein motif:PFAM:PF00692"
FT   CDS             complement(72017..73204)
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="YE0062"
FT                   /product="DNA/pantothenate metabolism flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10204"
FT                   /db_xref="GOA:A1JHX1"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX1"
FT                   /protein_id="CAL10204.1"
FT                   /translation="MLGISGGIAAYKSPELVRRLRDRGAEVRVVMTHAAKAFITPLTLQ
FT                   AVSGYPVSDDLLDPAAEAAMGHIELGKWADLVIMAPATADLLARVATGMANDLLTTVCL
FT                   ATAAPIAAVPAMNQQMYRAAATQANLQTLASRGMLLWGPDSGSQACGDVGPGRMLDPLD
FT                   IVALAHDHFSVKQDLQHLSVMITAGPTREALDPVRFISNQSSGKMGFAIAQAAAARGAK
FT                   VTLVAGPVMLPTPAGVNRIDVVSALEMQQTVQNLAAQQNIFISCAAVADYRAEQVSDEK
FT                   IKKQGDEITLKLVKNPDIVAGVASMTKKRPFVVGFAAETQNVEEYARQKLARKNLDLIC
FT                   ANDVSLAEHGFNSDTNALHLFWPTGEKRLPLSDKHLLSQHLIDEIVSRYDEKNRH"
FT   misc_feature    complement(72407..72439)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(72860..73201)
FT                   /note="Pfam match to entry PF02441
FT                   Flavoprotein,Flavoprotein, score 147.6, E-value 1.5e-41"
FT                   /inference="protein motif:PFAM:PF02441"
FT   CDS             73442..74110
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="YE0063"
FT                   /product="putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10205"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHX2"
FT                   /protein_id="CAL10205.1"
FT                   /translation="MEEWYGQVAPREKLLKYGAAVLTDAELLAIFLRTGIPGMHVMQMA
FT                   EYLIEEFGSLYGLISADYQALCAQKGIGVSKYSQIQAIAELAGRCFSSHLMQESVLQNP
FT                   EITQKFLQNILSHREREIFLVMFLDNQHRVIRHEEMFTGTISSVEIHPREIVREALKVN
FT                   AAALILAHNHPSGKAEPSQADRLMTTQVIKACSLLDIRVLDHLVVGRGECVSFAERGWL
FT                   "
FT   misc_feature    73733..74107
FT                   /note="Pfam match to entry PF04002 RadC, RadC, DNA repair
FT                   protein, score 263.4, E-value 2e-76"
FT                   /inference="protein motif:PFAM:PF04002"
FT   misc_feature    73952..73969
FT                   /note="PS01302 DNA repair protein radC family signature."
FT                   /inference="protein motif:Prosite:PS01302"
FT   CDS             74374..74610
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="YE0064"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:YE0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10206"
FT                   /db_xref="GOA:A1JHR2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR2"
FT                   /protein_id="CAL10206.1"
FT                   /translation="MSRVCQVTGKRPVSGNNRSHAMNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIETVLAEIRARGEKY"
FT   misc_feature    74380..74562
FT                   /note="Pfam match to entry PF00830 Ribosomal_L28,Ribosomal
FT                   L28 family, score 133.2, E-value 3.1e-37"
FT                   /inference="protein motif:PFAM:PF00830"
FT   CDS             74622..74789
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="YE0065"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:YE0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10207"
FT                   /db_xref="GOA:A1JHR4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR4"
FT                   /protein_id="CAL10207.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVIYKEAKIK"
FT   misc_feature    74637..74780
FT                   /note="Pfam match to entry PF00471 Ribosomal_L33,Ribosomal
FT                   protein L33, score 94.5, E-value 1.3e-25"
FT                   /inference="protein motif:PFAM:PF00471"
FT   misc_feature    74682..74741
FT                   /note="PS00582 Ribosomal protein L33 signature."
FT                   /inference="protein motif:Prosite:PS00582"
FT   CDS             74876..75685
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /gene_synonym="fpg"
FT                   /locus_tag="YE0066"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10208"
FT                   /db_xref="GOA:A1JHR7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR7"
FT                   /protein_id="CAL10208.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGQTILYAVVRNARLRWPVSDEILALS
FT                   DQPVLSVQRRAKYLLIELKTGWIIVHLGMSGSLRILPEETEAEKHDHVDLVISNGKILR
FT                   YTDPRRFGAWLWAKDLETSNVLAHLGPEPLSDEFTAEYLFEKSRNKRTVVKQWLMDNKV
FT                   VVGVGNIYASESLFTAGILPERAAGSLTETEITQLVATIKAVLLHSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQELQVYGRAGELCRRCGNVIEIAKHGQRSTFFCRHCQH"
FT   misc_feature    74876..75679
FT                   /note="Pfam match to entry PF01149
FT                   Fapy_DNA_glyco,Formamidopyrimidine-DNA glycosylase, score
FT                   483.1, E-value 1.4e-142"
FT                   /inference="protein motif:PFAM:PF01149"
FT   CDS             complement(75792..76271)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /gene_synonym="kdtB"
FT                   /locus_tag="YE0067"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10209"
FT                   /db_xref="GOA:A1JHR9"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHR9"
FT                   /protein_id="CAL10209.1"
FT                   /translation="MITKAIYPGTFDPITNGHLDLVTRASEMFSHVILAIADSSSKKPM
FT                   FTLAERVILAKQVTAPLKNVEVLGFSELMAEFAKKHNANILVRGLRSVSDFEYEWQLAN
FT                   MNRHLMPKLESVFLMPSEKWSFISSSLVKEVARHGGDITPFLPAPVTKALMTKLA"
FT   misc_feature    complement(75870..76268)
FT                   /note="Pfam match to entry PF01467
FT                   CTP_transf_2,Cytidylyltransferase, score 151.3, E-value
FT                   1.1e-42"
FT                   /inference="protein motif:PFAM:PF01467"
FT   CDS             complement(76268..77050)
FT                   /transl_table=11
FT                   /gene="kdtX"
FT                   /gene_synonym="waaE"
FT                   /locus_tag="YE0068"
FT                   /product="lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10210"
FT                   /db_xref="GOA:A1JHS0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHS0"
FT                   /protein_id="CAL10210.1"
FT                   /translation="MSAKKRLSVVMIVKNEASLLADCLASVTWADEIVVLDSGSEDETV
FT                   ALAEQYGAKVYSNTEWPGYGKQRQLAQQYATGDYILMLDADERVTPELKSAIETVLLAP
FT                   EEGAVYSCARRNLFLGRFMRHSGWYPDRVTRLYPREQYRYNDDLVHESLDSGSAKVILL
FT                   AGDLLHLTCRDFFAFQRKQLNYAQAWANQRHQQGKSCRYFAIISHTLGAFCKTWLLRAG
FT                   FLDGKQGLLLAVVNAQYTFNKYAALWALSHQYQKSENS"
FT   misc_feature    complement(76565..77029)
FT                   /note="Pfam match to entry PF00535 Glycos_transf_2,Glycosyl
FT                   transferase, score 88.5, E-value 8.8e-24"
FT                   /inference="protein motif:PFAM:PF00535"
FT   sig_peptide     complement(76961..77050)
FT                   /gene="kdtX"
FT                   /gene_synonym="waaE"
FT                   /locus_tag="YE0068"
FT                   /note="Signal peptide predicted for YE0068 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.844) with cleavage site
FT                   probability 0.843 between residues 30 and 31"
FT   CDS             complement(77051..78328)
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /gene_synonym="waaA"
FT                   /locus_tag="YE0069"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10211"
FT                   /db_xref="GOA:A1JHX3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX3"
FT                   /protein_id="CAL10211.1"
FT                   /translation="MLLRLYQVLLYLIQPLIWLRLLLRSRKAPAYRKRWGERYGFCAGK
FT                   VVAGGIMLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVQSAFGKDVHHV
FT                   YLPYDLPGSVNRFLDQVNPKLVIIMETELWPNLINALHRRKIPLVIANARLSARSAAGY
FT                   KKIGSFIRNMLQRITLIAAQNQEDGDRFIELGLRRSQLTVTGSLKFDISVTPELAARAV
FT                   TLRRQWAPHRPVWIATSTHDGEETILLEAHRQLLQQFPTLLLILVPRHPERFPKAIELT
FT                   QKAGLSYTLRSKGEVPSSSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEAA
FT                   AHAIPVLMGPHTFNFKDICAKLEQAEGLITVTDTLSLVKEITQLLTDEDCRLYYGRHAV
FT                   DVLHENQGALQRLLHLLEPYLPQRSH"
FT   misc_feature    complement(77126..77638)
FT                   /note="Pfam match to entry PF00534 Glycos_transf_1,Glycosyl
FT                   transferases group 1, score 20.0, E-value 1.6e-06"
FT                   /inference="protein motif:PFAM:PF00534"
FT   CDS             complement(78869..79834)
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /gene_synonym="waaC"
FT                   /gene_synonym="rfa-2"
FT                   /locus_tag="YE0070"
FT                   /product="lipopolysaccharide heptosyltransferase-1"
FT                   /db_xref="EnsemblGenomes-Gn:YE0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10212"
FT                   /db_xref="GOA:A1JHX4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX4"
FT                   /protein_id="CAL10212.1"
FT                   /translation="MHVLIVKTSSMGDVLHTLPALTDAMNAIPGIRFDWVVEEGFSQIP
FT                   GWHPAVDKVIPVAIRRWRKNWFGSDTRQERCDFKRVVQQRSYDVVIDAQGLIKSAALIT
FT                   RIAKGVRHGPDCKSAREPFASWFYNCRHEIDTKQHAVERIRQLFAKSLGYDKPESVGDY
FT                   AIAQRFLNELPNDTGQYLVFLHATTRDSKHWPESHWRKLIELVAPTGLKIKLPWGAEHE
FT                   YQRALRLAEHFPHVEVLPKLSLQQVAEVLAGAKAVVSVDTGLSHLTAALDRPNITLFGP
FT                   TDPGLIGGYGKNQIAVISEQKSMDTITAETIMARLETLIS"
FT   misc_feature    complement(78884..79612)
FT                   /note="Pfam match to entry PF01075
FT                   Glyco_transf_9,Glycosyltransferase family 9
FT                   (heptosyltransferase), score 316.4, E-value 2.1e-92"
FT                   /inference="protein motif:PFAM:PF01075"
FT   CDS             complement(79834..80898)
FT                   /transl_table=11
FT                   /gene="rfaF"
FT                   /gene_synonym="waaF"
FT                   /locus_tag="YE0071"
FT                   /product="ADP-heptose--LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:YE0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10213"
FT                   /db_xref="GOA:A1JHX5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX5"
FT                   /protein_id="CAL10213.1"
FT                   /translation="MKILVIGPSWVGDMMMSQSLYRTLKAEYPAADIDVMAPAWCRPLL
FT                   ARMPEVRHAVPMPLGHGVFAFEERRRLGLALRETGYDRAYVLPNSFKSALIPYFSGIKQ
FT                   RTGWRGEMRYFLLNDMRILDKQAFPMMVQRYVALAYDKERIHSADDLPQPLLWPQLQVQ
FT                   DEEIAEITASFNLTNNRPIIGFCPGAEFGPAKRWPHYHYAALAQKLIDTGYQVILLGSA
FT                   KDNEAGEEIRQALDESAREYCLNLAGQTSLDQAVVMIAACNAVVSNDSGLMHVAAALNK
FT                   PLVALYGPSSPDFTPPLSDKATVIRLITGYHKVRKGDSAQGYHQSLIDIQPEQVMAALE
FT                   KQLSAQTSSVKEGD"
FT   misc_feature    complement(79927..80694)
FT                   /note="Pfam match to entry PF01075
FT                   Glyco_transf_9,Glycosyltransferase family 9
FT                   (heptosyltransferase), score 372.2, E-value 3.5e-109"
FT                   /inference="protein motif:PFAM:PF01075"
FT   CDS             complement(80929..81861)
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /gene_synonym="htrM"
FT                   /locus_tag="YE0072"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10214"
FT                   /db_xref="GOA:A1JHX6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHX6"
FT                   /protein_id="CAL10214.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNNIGYKDILVVDNLKDGTKFVNLVDL
FT                   DIADYMDKEDFVASIVAGDDMGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKDILHFC
FT                   LDRGIPFLYASSAATYGGRTDNFIEDRQYEQPLNVYGYSKFLFDQYVREILPQADSQIC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINAGENPKLFSGSENFKRDFIYVGDVADVNL
FT                   WFWQNGVSGIFNCGTGRAESFQAVADAVVDFHQSGPVEYIEFPEKLKGRYQAYTQADLT
FT                   NLRAAGYDKPFKTVAEGVKEYLTWLNRSV"
FT   misc_feature    complement(80932..81858)
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family, score -1.0,E-value 2.2e-13"
FT                   /inference="protein motif:PFAM:PF01370"
FT   CDS             82105..83316
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="YE0073"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10215"
FT                   /db_xref="GOA:A1JHX7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX7"
FT                   /protein_id="CAL10215.1"
FT                   /translation="MSLPFDRNAFYQQLEQQLKTTRAEGLYKNERIITSAQQADIAVAD
FT                   GRHVINFCANNYLGLANHPRLIAAAKKGMDTHGFGMASVRFICGTQDTHKELEQKLASF
FT                   LGMEDAILYSSCFDANGGLFETLLGPEDAIISDALNHASIIDGVRLCKAKRYRYANNDM
FT                   SELKAQLEQAKADGARHIMIATDGVFSMDGVIANLKGVCDLADEYQALVMVDDSHAVGF
FT                   VGANGRGTHEYCEVMDRVDIITGTLGKALGGASGGYTAGRKEVVEWLRQRSRPYLFSNS
FT                   LAPAIVAASIEVLSLLEDGAELRDRLWSNARLFREKMSAAGFTLAGADHAIIPVMLGDA
FT                   TLAQEFANALLKEGIYVTGFFYPVVPKGQARIRTQMSADHTPEQVERAVEAFIRIGKQL
FT                   NVIA"
FT   misc_feature    82339..83283
FT                   /note="Pfam match to entry PF00155
FT                   aminotran_1_2,Aminotransferase class I and II, score 260.1,
FT                   E-value 1.9e-75"
FT                   /inference="protein motif:PFAM:PF00155"
FT   misc_feature    82840..82869
FT                   /note="PS00599 Aminotransferases class-II
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00599"
FT   CDS             83341..84366
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="YE0074"
FT                   /product="threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10216"
FT                   /db_xref="GOA:A1JHX8"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHX8"
FT                   /protein_id="CAL10216.1"
FT                   /translation="MKALAKLKAEEGIWMTNVPQPELGHNDIMIKIRKTAICGTDVHIY
FT                   NWDEWSQKTIPVPMVVGHEYVGEVVAIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTVGVGVNRPGSFAEYLVIPAFNAFKIPDNISDELAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVCKHVGARHVVITDVNEYRLDLARKMGVTRAVNVNKENLND
FT                   VMAELGMTEGFDVGLEMSGAPPAFRALLNSMNHGGRIAMLGIPPSDMSIDWNQVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLTPIITHRFSIDEFQQGFDAMRSGKSGKVILNW
FT                   D"
FT   misc_feature    83359..84360
FT                   /note="Pfam match to entry PF00107 adh_zinc, Zinc-binding
FT                   dehydrogenase, score 375.2, E-value 4.2e-110"
FT                   /inference="protein motif:PFAM:PF00107"
FT   misc_feature    83524..83568
FT                   /note="PS00059 Zinc-containing alcohol dehydrogenases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00059"
FT   CDS             complement(84557..85582)
FT                   /transl_table=11
FT                   /locus_tag="YE0075"
FT                   /product="putative exported protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YibQ SWALL:YIBQ_ECOLI (SWALL:P37691) (319 aa) fasta scores:
FT                   E(): 4e-63, 63.4 38d in 317 aa, and to Salmonella typhi
FT                   putative exported protein STY4089 SWALL:Q8Z2F2
FT                   (EMBL:AL627280) (320 aa) fasta scores: E(): 1.3e-64,62.46
FT                   38d in 325 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10217"
FT                   /db_xref="GOA:A1JHX9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHX9"
FT                   /inference="similar to sequence:INSDC:AL627280"
FT                   /inference="similar to sequence:UniProtKB:P37691"
FT                   /protein_id="CAL10217.1"
FT                   /translation="MRYFNTHRLIIVSTLLIANTSLAGKLSIVIDDFGYRPQNENKVLQ
FT                   MPLPISVAILPNAPYAKEMAIKAHNQGREILIHLPMAPLSKQPLERDTLQPLMSSEEIQ
FT                   RIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVMQVLEHYQLYFLDSVTIGNSQASRA
FT                   AEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELARRNGSAIAIGHPHPATIKVLQQML
FT                   PQLPADIVLVKASALLNEPVHNITGHNNSGSGTVSPGKSKPRDPAKGQRLKAIKQCNAK
FT                   ASYAPEKIYADKMFIILGESLMQSPAVTFVQKHWQQYFPPAVPVTPVEKSTIEKPKAEN
FT                   P"
FT   misc_feature    complement(84800..84823)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(85514..85582)
FT                   /locus_tag="YE0075"
FT                   /note="Signal peptide predicted for YE0075 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.995) with cleavage site
FT                   probability 0.979 between residues 23 and 24"
FT   CDS             complement(85606..86760)
FT                   /transl_table=11
FT                   /locus_tag="YE0076"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10218"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY0"
FT                   /protein_id="CAL10218.1"
FT                   /translation="MKTIQQDIAEKEKSVQQQKQQRSALLDQLKQQENTIAQASRSLRE
FT                   TQGTLTELDKDISSLTASIGKLQTQQSQQQNLLSKQLDAAFKQGQHSGLQLILSGEESQ
FT                   RSERILAYFSYLNEARQKSIEELKQTRTDLSAEKKTLEQKKNQQKVLLDEQKAQQQKLE
FT                   EARTARKKTLTSLEVSLEKDQQGLAELKLNESRLRDQIAKAEREAKARAEREAKEAARV
FT                   REQVKAKEQQAKKTGSSYKPSESERSLMARTGGLGRPGGQAVWPVRGNVTHRFGEALQG
FT                   ELRWKGMVISAPEGSEVKAIADGRVLLADWLQGYGLVVVVEHGKGDMSLYGYNQSALVN
FT                   VGAQVKAGQPIALVGTSGGQGEPSLYFEIRRQGQAVNPQPWLGR"
FT   misc_feature    complement(85618..85866)
FT                   /note="Pfam match to entry PF01551 Peptidase_M37,Peptidase
FT                   family M23/M37, score 118.8, E-value 6.8e-33"
FT                   /inference="protein motif:PFAM:PF01551"
FT   CDS             complement(86983..88530)
FT                   /transl_table=11
FT                   /locus_tag="YE0077"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10219"
FT                   /db_xref="GOA:A1JHY1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHY1"
FT                   /protein_id="CAL10219.1"
FT                   /translation="MSSTKKPLVLTILDGYGHREEQQDNAILNAKTPVMDRLWQQQPHT
FT                   LIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKDGDFFTNPTLTAAVD
FT                   KAVKAGKAVHIMGLLSAGGVHSHEDHILAMVELAAKRGATAIYLHAFLDGRDTPPRSAE
FT                   PSLKRFTEKFAALGKGRIASIIGRYYAMDRDNRWDRVQLAYDLLTQAKGEFTADNAVVG
FT                   LQAAYARNENDEFVKPTVIQAAGEPDAAMNDGDALIFMNFRADRARQITRTFVNADFDG
FT                   FKRDKVVNFGDFIMLTEYAADIKVACAYPPASLENTFGEWLMKHDKTQLRISETEKYAH
FT                   VTFFYNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVGAIASGKYDVIICN
FT                   YPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVQAVDGQLLITADHGNAEQMRDPATG
FT                   QAHTAHTSLPVPLIYVGNKEVKAVEGGKLSDIAPTMLSLMEMEIPQEMTGKPLFIVE"
FT   misc_feature    complement(87058..87411)
FT                   /note="Pfam match to entry PF01676
FT                   Metalloenzyme,Metalloenzyme superfamily, score 186.2,
FT                   E-value 3.5e-53"
FT                   /inference="protein motif:PFAM:PF01676"
FT   CDS             88772..89206
FT                   /transl_table=11
FT                   /locus_tag="YE0078"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10220"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY2"
FT                   /protein_id="CAL10220.1"
FT                   /translation="MLQEIMQFISQHPVLSLAWVALFVAVIFTSFKTTLSKVKEITRGE
FT                   ATRLINKEDAVVVDIRTRDDYRKGHIASSINLLPSDIKNGNLAELEKHKAQPVIVVCAT
FT                   GTTSRASAELLNKAGFERVFTLKEGISGWSGENLPLARGK"
FT   misc_feature    88808..88864
FT                   /note="1 probable transmembrane helix predicted for YE0078
FT                   by TMHMM2.0 at aa 13-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    88895..89179
FT                   /note="Pfam match to entry PF00581 Rhodanese,Rhodanese-like
FT                   domain, score 76.3, E-value 4.1e-20"
FT                   /inference="protein motif:PFAM:PF00581"
FT   CDS             89256..89504
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="YE0079"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YE0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10221"
FT                   /db_xref="GOA:A1JHY3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY3"
FT                   /protein_id="CAL10221.1"
FT                   /translation="MAKIEIYTKATCPFCHRAKALLNSKGAAFHEIAIDNDPAKREEMI
FT                   ARSGRTTVPQVFIDGQHIGGCDDLHALDARGGLDPLL"
FT   misc_feature    89262..89435
FT                   /note="Pfam match to entry PF00462
FT                   glutaredoxin,Glutaredoxin, score 85.5, E-value 7.3e-23"
FT                   /inference="protein motif:PFAM:PF00462"
FT   misc_feature    89271..89321
FT                   /note="PS00195 Glutaredoxin active site."
FT                   /inference="protein motif:Prosite:PS00195"
FT   CDS             89596..90066
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="YE0080"
FT                   /product="protein-export protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10222"
FT                   /db_xref="GOA:A1JHY4"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHY4"
FT                   /protein_id="CAL10222.1"
FT                   /translation="MSEQNNTEMAFQIQRIYTKDISFEAPNAPQVFQQDWQPEVKLDLD
FT                   TASSQLAEDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIDGTQLAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAEGEGAEQRQDA"
FT   misc_feature    89596..90033
FT                   /note="Pfam match to entry PF02556 SecB, Preprotein
FT                   translocase subunit SecB, score 338.5, E-value 4.8e-99"
FT                   /inference="protein motif:PFAM:PF02556"
FT   CDS             90066..91085
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="YE0081"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10223"
FT                   /db_xref="GOA:A1JHY5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHY5"
FT                   /protein_id="CAL10223.1"
FT                   /translation="MNTTHASMTVIGAGSYGTALAITLARNGHQVVLWGHDPKHIQTLQ
FT                   QDRCNQAFLPDVPFPDTLLLETDLARALAASRDVLVVVPSHVFGAVLNQLKPHLRPDAR
FT                   IVWATKGLEAETGRLLADVAREVLGESIPLAVVSGPTFAKELAAGLPTAIALASTDVQF
FT                   SEDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LAEMTRLGSALGADPSTFMGMAGLGDLVLTCTDNQSRNRRFGIMLGQGLGVQEAQDKIG
FT                   QVVEGYRNTKEVLALAQRNGVEMPITEQIYQVLYSHKNAREAALTLLGRTKKDEKSGI"
FT   sig_peptide     90066..90128
FT                   /gene="gpsA"
FT                   /locus_tag="YE0081"
FT                   /note="Signal peptide predicted for YE0081 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.931) with cleavage site
FT                   probability 0.910 between residues 21 and 22"
FT   misc_feature    90078..91046
FT                   /note="Pfam match to entry PF01210
FT                   NAD_Gly3P_dh,NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase, score 543.4, E-value 1e-160"
FT                   /inference="protein motif:PFAM:PF01210"
FT   misc_feature    90639..90704
FT                   /note="PS00957 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase signature."
FT                   /inference="protein motif:Prosite:PS00957"
FT   CDS             91211..92032
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="YE0082"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10224"
FT                   /db_xref="GOA:A1JHY6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY6"
FT                   /protein_id="CAL10224.1"
FT                   /translation="MSSEELELVWSSIKSEARALAECEPMLASFFHATLLKHENLGSAL
FT                   SYILANKLANPIMPAIAIREVVEDAYRADAQMIVSAARDILAVRLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGA
FT                   GSVVLQAVPPHTTAAGVPARIVGKPESDKPSLDMDQHFNGVSHGFEYGDGI"
FT   misc_feature    91613..91666
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 4.6,E-value
FT                   12"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    91709..91762
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 10.4,E-value
FT                   2.2"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    91787..91840
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 9.3,E-value
FT                   3"
FT                   /inference="protein motif:PFAM:PF00132"
FT   misc_feature    91814..91900
FT                   /note="PS00101 Hexapeptide-repeat containing-transferases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00101"
FT   misc_feature    91841..91894
FT                   /note="Pfam match to entry PF00132 hexapep, Bacterial
FT                   transferase hexapeptide (four repeats), score 11.9,E-value
FT                   1"
FT                   /inference="protein motif:PFAM:PF00132"
FT   CDS             complement(92213..92716)
FT                   /transl_table=11
FT                   /locus_tag="YE0083"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10225"
FT                   /db_xref="GOA:A1JHY7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY7"
FT                   /protein_id="CAL10225.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGCQLHLIKPLGFTWDDKRLR
FT                   RAGLDYHEFANIKHHHDYQAFLDSENLDGAQSAGTNPARLFALTTKGTPAHSAVNYQVN
FT                   DYLLFGPETRGLPSNVLDALPAQQKIRIPMLAASRSMNLSNAVSVVVYEAWRQLGYPGA
FT                   LLKE"
FT   misc_feature    complement(92261..92716)
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 180.0, E-value 2.6e-51"
FT                   /inference="protein motif:PFAM:PF00588"
FT   CDS             92988..93986
FT                   /transl_table=11
FT                   /locus_tag="YE0084"
FT                   /product="bifunctional regulatory protein/DNA repair
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10226"
FT                   /db_xref="GOA:A1JHY8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY8"
FT                   /protein_id="CAL10226.1"
FT                   /translation="MKTTGVYCRPSCSSRQAKVENIEFYADNDAAELAGYRPCKRCRPT
FT                   QLSQAQQHAEKISQACRLIEQAETPFTLDALAAELNLSTFHFHRLFKSITGLTPKAYAS
FT                   ATRSARIRQQLVEKGSVTEAIFEAGYNSNGRFYEQSNQLLGMTPTRYRQGGRDTALRFA
FT                   VGESSIGAILMAQSELGICAILLGDDPALLVKQLQDKFPQAELIGGDAEFEQWFAQVVG
FT                   LVEAPQLGLDLPLDIRGTAFQQRVWQALREIPAGDTASYADIAAKIGAPKAVRAVAGAC
FT                   AANMLAVAIPCHRVIRQDGALSGYRWGIERKKRLLEKEQQEVGTRDQPDPA"
FT   misc_feature    92991..93122
FT                   /note="Pfam match to entry PF02805 Ada_Zn_binding, Metal
FT                   binding domain of Ada, score 56.3, E-value 4.3e-14"
FT                   /inference="protein motif:PFAM:PF02805"
FT   misc_feature    93153..93284
FT                   /note="PS00041 Bacterial regulatory proteins, araC family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00041"
FT   misc_feature    93165..93299
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   47.7, E-value 1.7e-11"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    93198..93263
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1245.000, SD 3.43 at aa 71-92, sequence
FT                   FTLDALAAELNLSTFHFHRLFK"
FT   misc_feature    93309..93446
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   15.0, E-value 0.062"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    93462..93698
FT                   /note="Pfam match to entry PF02870
FT                   Methyltransf_1N,6-O-methylguanine DNA methyltransferase,
FT                   ribonuclease-like domain, score 25.9, E-value 6.2e-05"
FT                   /inference="protein motif:PFAM:PF02870"
FT   misc_feature    93702..93968
FT                   /note="Pfam match to entry PF01035
FT                   Methyltransf_1,6-O-methylguanine DNA methyltransferase, DNA
FT                   binding domain, score 172.2, E-value 5.7e-49"
FT                   /inference="protein motif:PFAM:PF01035"
FT   misc_feature    93855..93875
FT                   /note="PS00374 Methylated-DNA--protein-cysteine
FT                   methyltransferase active site."
FT                   /inference="protein motif:Prosite:PS00374"
FT   CDS             complement(94056..95432)
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="YE0085"
FT                   /product="two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10227"
FT                   /db_xref="GOA:A1JHY9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHY9"
FT                   /protein_id="CAL10227.1"
FT                   /translation="MINSLTARIFAIFWFTLALVLMLVLMVPKLDSRQMTTLLDSEQRQ
FT                   GTMLEQHIEAELASDPANDLMWWRRLYRAIEKWAPPGQHLVLVTTEGRVIGAQRHEMQM
FT                   VRNFIGQSDNSDQPKKKKYGRVEMVGPFSIRDGEDNYQLYLLRPASSPQSDFINLMFDR
FT                   PLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELESGPQEFLATG
FT                   ASFNQMISALDRMVVAQQRLISDISHELRTPLTRLQLATALMRRRHGEGKELERIEMEA
FT                   QRLDSMINDLLVLSRSQHKNELHREPIKANELWSEVLENAQFEADQMGKTLEVTAPPGP
FT                   WTLFGNPAALDSALENIVRNALRYSHHHIAVAFSSDNQGITITVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRESGGTGLGLAIVETAVNQHRGWVRAEDSPLGGLRLIIWLPLHPLKV
FT                   "
FT   misc_feature    complement(94071..94400)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 133.2,
FT                   E-value 3.1e-37"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(94533..94721)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 65.3, E-value 8.7e-17"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    complement(94731..94943)
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,score
FT                   52.4, E-value 6.6e-13"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    complement(join(94872..94940,95352..95420))
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0085 by TMHMM2.0 at aa 5-27 and 165-187"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(95355..95432)
FT                   /gene="cpxA"
FT                   /locus_tag="YE0085"
FT                   /note="Signal peptide predicted for YE0085 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.757) with cleavage site
FT                   probability 0.304 between residues 26 and 27"
FT   CDS             complement(95429..96127)
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="YE0086"
FT                   /product="two component system response regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10228"
FT                   /db_xref="GOA:A1JHZ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ0"
FT                   /protein_id="CAL10228.1"
FT                   /translation="MHKILLVDDDRELTSLLKELLEMEGFNVVVAHDGEQALNLLDSSI
FT                   DLLLLDIMMPRKNGIETLKELRQHHQTPVIMLTARGSDLDRVLGLELGADDYLAKPFND
FT                   RELVARIRAILRRSNWSEQQQNVDQGAPTLEVDCLQLNPGRQEASFEGQSLELTGTEFT
FT                   LLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPDRKDGLPWFKTLR
FT                   GRGYLMVSET"
FT   misc_feature    complement(95453..95671)
FT                   /note="Pfam match to entry PF00486
FT                   trans_reg_C,Transcriptional regulatory protein, C terminal,
FT                   score 110.2, E-value 2.5e-30"
FT                   /inference="protein motif:PFAM:PF00486"
FT   misc_feature    complement(95771..96124)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 152.2, E-value 5.9e-43"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS             96348..96812
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="YE0087"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10229"
FT                   /db_xref="GOA:A1JHZ1"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ1"
FT                   /protein_id="CAL10229.1"
FT                   /translation="MASMLVIGSQAAFAADKTGATDGWCHGDGAMMNKKDGRGHHNMFD
FT                   GLNLTEQQRQQMRDLMRQSRQDQPRVDLADREAMHKLITADKFDEAAVRAQAEKMSKDQ
FT                   IDRQVEMAKVRNQMFNLLTPEQKAALNQKHQQRIEKMQQAPAAQPSSAQK"
FT   sig_peptide     96348..96389
FT                   /gene="cpxP"
FT                   /locus_tag="YE0087"
FT                   /note="Signal peptide predicted for YE0087 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.647) with cleavage site
FT                   probability 0.643 between residues 14 and 15"
FT   CDS             96944..97846
FT                   /transl_table=11
FT                   /locus_tag="YE0088"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10230"
FT                   /db_xref="GOA:A1JHZ2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHZ2"
FT                   /protein_id="CAL10230.1"
FT                   /translation="MDPQYARLVKAAALSATVLASILLIIKIFAWWHTGSVSLLAALVD
FT                   SLVDLAASLTNLFVVRYSLQPADEEHTFGHGKAESLAALAQSMFISGSALFLFLTGFQH
FT                   LASPEPLQDPGLGIWVTLIALFSTLILVTFQRWVVRKTQSQAIRADMLHYQSDVMMNGA
FT                   ILIALALSWYGFHRADALFALGIGAYILYSALRMGYEAVQALLDRALPDDERQEIINIV
FT                   TSWPGVIGAHDLRTRQSGPTRFIQLHLEMEDMLPLMEAHILADQVERALLHRFPGADIL
FT                   IHQDPTAVVPKERHAHWEL"
FT   sig_peptide     96944..97066
FT                   /locus_tag="YE0088"
FT                   /note="Signal peptide predicted for YE0088 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.831) with cleavage site
FT                   probability 0.693 between residues 41 and 42"
FT   misc_feature    join(96977..97045,97055..97123,97181..97249,97292..97360,
FT                   97415..97468,97481..97540)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0088 by TMHMM2.0 at aa 12-34, 38-60, 80-102,
FT                   117-139,158-175 and 180-199"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    96980..97816
FT                   /note="Pfam match to entry PF01545 Cation_efflux, Cation
FT                   efflux family, score 354.0, E-value 1e-103"
FT                   /inference="protein motif:PFAM:PF01545"
FT   CDS             98096..99091
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="YE0089"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10231"
FT                   /db_xref="GOA:A1JHZ3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHZ3"
FT                   /protein_id="CAL10231.1"
FT                   /translation="MVKKIGVLTSGGDAPGMNAAIRGVVRAALSEGLEVYGIEDGYLGL
FT                   YHNRMKQLDRYSVSDMINRGGTFLGSARFPEFRDPEIRKIALQNMKERGIDGLVVIGGD
FT                   GSYAGADLLTKEGGIHCVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQ
FT                   RISIVEVMGRFCGDLTLAAAIAGGCEFIAIPEVEFKREDLVKEIKAGIAKGKKHAIVAI
FT                   TEKLDNIDELAKYIEKETDRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLVNKI
FT                   SPPLNFSSGGFCVGIQNEKMVHELISVCIAPENKKSKFKEDWYDTAKKLF"
FT   misc_feature    98102..98932
FT                   /note="Pfam match to entry PF00365 PFK,Phosphofructokinase,
FT                   score 607.0, E-value 7.1e-180"
FT                   /inference="protein motif:PFAM:PF00365"
FT   misc_feature    98627..98659
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    98828..98884
FT                   /note="PS00433 Phosphofructokinase signature."
FT                   /inference="protein motif:Prosite:PS00433"
FT   repeat_region   99130..99145
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1660"
FT   repeat_region   complement(99130..100556)
FT                   /note="IS4-like insertion sequence element IS1660"
FT   stem_loop       complement(99131..99162)
FT   CDS             complement(99139..100473)
FT                   /transl_table=11
FT                   /locus_tag="YE0090"
FT                   /product="transposase for insertion sequence element
FT                   IS1660"
FT                   /note="Highly similar to many transposases from the IS
FT                   element IS4 including: Escherichia coli transposase InsG
FT                   for insertion sequence element IS4 SWALL:INSG_ECOLI
FT                   (SWALL:P03835) (442 aa) fasta scores: E(): 9.8e-166,89.54
FT                   38d in 440 aa and to Pantoea agglomerans insertion element
FT                   protein SWALL:P71168 (EMBL:X81894) (440 aa) fasta scores:
FT                   E(): 1.7e-86, 52.42 38d in 433 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10232"
FT                   /db_xref="GOA:A1JHZ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ4"
FT                   /inference="similar to sequence:INSDC:X81894"
FT                   /inference="similar to sequence:UniProtKB:P03835"
FT                   /protein_id="CAL10232.1"
FT                   /translation="MHIGQALDLVSRYDSLRNPLTTLGDYLDPQLISRCLAESGTVTLR
FT                   KRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGDRPFVAPSAVIQARQRLGSEAV
FT                   RRVFSQTAQLWHGSVTHPHWCGLTLLAVDGVVWRTPDTPENDTAFPRQTYAGQPGLYPQ
FT                   VKMVCQMELTSHLLTAAAFGTMKESEYTLAEQLIDQTADNTLTLMDKGYYSLGLLNAWS
FT                   QAGEHRHWMIPLKKGAQYEEIRKLGKGDHLVKLKTSPQARKKWPELGAEMTARLLTITR
FT                   KGKVYHLLTSMTDTMRYPGGEMADLYGHRWEIELGYREIKQTMQLSRLTLRSKKPELVE
FT                   QELWGVLLAYNLVRYQMIKMAGALKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPEL
FT                   MRDMESMAQMVKLPIRRERAFPRVVKERPYKYGKARNKNASQLLN"
FT   misc_feature    complement(99418..100095)
FT                   /note="Pfam match to entry PF01609
FT                   Transposase_11,Transposase DDE domain, score 160.8, E-value
FT                   1.5e-45"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(100541..100556)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1660"
FT   CDS             100712..101701
FT                   /transl_table=11
FT                   /gene="sbp1"
FT                   /locus_tag="YE0091"
FT                   /product="exported sulfate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10233"
FT                   /db_xref="GOA:A1JHZ5"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ5"
FT                   /protein_id="CAL10233.1"
FT                   /translation="MRKWGVGLSLLLLASGAMAKDIQLLNVSYDPTREFYQEYNQAFSK
FT                   HWQEQTGDKVTVRQSHGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKDWIKR
FT                   LPDNSAPYTSTIVFLVRKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAWAYA
FT                   LEHNNNDQAKAQEFVKQLYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLAVNEV
FT                   GKDQFDIITPSISILAEPTVSVVDKVVDKRGTREVADAYLKYLYSPEGQTIAAKNYYRP
FT                   RDPAVAAKFAKEFPQLKLITIDDVFGGWTKAQQVHFATGGVFDEISKR"
FT   sig_peptide     100712..100768
FT                   /gene="sbp1"
FT                   /locus_tag="YE0091"
FT                   /note="Signal peptide predicted for YE0091 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 19 and 20"
FT   misc_feature    100712..101698
FT                   /note="Pfam match to entry PF01100
FT                   Sulphate_bind,Prokaryotic sulphate- and
FT                   thiosulphate-binding protein ,score 761.1, E-value
FT                   2.9e-226"
FT                   /inference="protein motif:PFAM:PF01100"
FT   misc_feature    101144..101170
FT                   /note="PS00757 Prokaryotic sulfate-binding proteins
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00757"
FT   CDS             101902..102093
FT                   /transl_table=11
FT                   /locus_tag="YE0092"
FT                   /product="hypothetical protein"
FT                   /note="Poor database matches. Weakly similar to the
FT                   N-terminal region of Agrobacterium tumefaciens hypothetical
FT                   protein AttU SWALL:Q9WWC8 (EMBL:U59485) (78 aa) fasta
FT                   scores: E(): 9.2, 32.55 38d in 43 aa. Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:YE0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10234"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ6"
FT                   /inference="similar to sequence:INSDC:U59485"
FT                   /protein_id="CAL10234.1"
FT                   /translation="MANYAEKIIDIHGVSSAILIDNPGLDSPSPSLSGLARSGSIESLH
FT                   SNSSICEPIWHCHIKGGG"
FT   CDS             complement(102318..103085)
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /gene_synonym="tpi"
FT                   /locus_tag="YE0093"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10235"
FT                   /db_xref="GOA:A1JHZ7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JHZ7"
FT                   /protein_id="CAL10235.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIANLRKELSTVEGCGVAIAPPAI
FT                   YLNQAKHELSGSRIALGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKE
FT                   SDEFIAKKFGVLKEVGLTPVLCIGETEAENEAGQTEAVCAKQLDAVLNTLGAKAFEGAV
FT                   IAYEPIWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAIAAQVIIQYGGSVNDKNAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAAAKKA"
FT   misc_feature    complement(102330..103082)
FT                   /note="Pfam match to entry PF00121 TIM, Triosephosphate
FT                   isomerase, score 523.6, E-value 9.4e-155"
FT                   /inference="protein motif:PFAM:PF00121"
FT   misc_feature    complement(102561..102593)
FT                   /note="PS00171 Triosephosphate isomerase active site."
FT                   /inference="protein motif:Prosite:PS00171"
FT   CDS             complement(103214..103798)
FT                   /transl_table=11
FT                   /locus_tag="YE0094"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10236"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ8"
FT                   /protein_id="CAL10236.1"
FT                   /translation="MLTILLLIATVSRAHADPDAGSYQQAEETQPTAPYLLSGAPTFDL
FT                   TLVKFRERYNHANPTLPISEFHAITVKDDAPPLTRAASKINENLYASTALERGTGKIKT
FT                   IQITYLPIKGSEEKAARLVAVNYMAALMRQFEPTLTLEQSISNVQQLLTQGKGSPFFAH
FT                   PVGAIRYVVADNGEKGLTFAVEPIKLSLSEA"
FT   sig_peptide     complement(103751..103798)
FT                   /locus_tag="YE0094"
FT                   /note="Signal peptide predicted for YE0094 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.988) with cleavage site
FT                   probability 0.985 between residues 16 and 17"
FT   CDS             104103..104537
FT                   /transl_table=11
FT                   /locus_tag="YE0095"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10237"
FT                   /db_xref="GOA:A1JHZ9"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A1JHZ9"
FT                   /protein_id="CAL10237.1"
FT                   /translation="MTIQQWCFSLKGRIGRRDFWIWIGLWLLAMLIIFTLAGQNWLSTQ
FT                   TAAFAIVFLLWPTAAVMVKRLHDRNKAGWWALLVVLAWMLMAGNWQMLAPIWQWGVGRF
FT                   IPTLIMVMMLIDCGAFLGTEGENRFGPEAVPVKFLAEKSQ"
FT   sig_peptide     104103..104252
FT                   /locus_tag="YE0095"
FT                   /note="Signal peptide predicted for YE0095 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.698) with cleavage site
FT                   probability 0.268 between residues 50 and 51"
FT   misc_feature    join(104160..104213,104223..104291,104316..104384,
FT                   104397..104465)
FT                   /note="4 probable transmembrane helices predicted for
FT                   YE0095 by TMHMM2.0 at aa 20-37, 41-63, 72-94 and 99-121"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(104780..105526)
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /gene_synonym="mvrA"
FT                   /locus_tag="YE0096"
FT                   /product="ferredoxin--NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10238"
FT                   /db_xref="GOA:A1JI00"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI00"
FT                   /protein_id="CAL10238.1"
FT                   /translation="MAEWVSGKITHIEHWTDTLFSIRVNAPIDPFTAGQFAKLALDIDG
FT                   ERVQRAYSYVNAPSDNNLEFYLVTVPEGKLSPRLDQLAVGGEVMVTKQAAGFFVLEEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGRDLERFKNLVLVHAARFARDLSYLPLMQQLEQRYN
FT                   GKLRIQTVVSREQSPGSLTGRVPALIENGSLEAAVGLKIDAEDSHVMLCGNPQMVRDTQ
FT                   QMLKEQRGMRKHLRRKPGHMTSEQYW"
FT   misc_feature    complement(104855..105211)
FT                   /note="Pfam match to entry PF00175
FT                   NAD_binding_1,Oxidoreductase NAD-binding domain, score
FT                   82.4, E-value 6.1e-22"
FT                   /inference="protein motif:PFAM:PF00175"
FT   misc_feature    complement(105227..105511)
FT                   /note="Pfam match to entry PF00970
FT                   FAD_binding_6,Oxidoreductase FAD-binding domain, score
FT                   25.6, E-value 3.3e-06"
FT                   /inference="protein motif:PFAM:PF00970"
FT   CDS             105845..107029
FT                   /transl_table=11
FT                   /gene="emrD"
FT                   /locus_tag="YE0097"
FT                   /product="multidrug resistance protein D"
FT                   /note="Similar to Escherichia coli multidrug resistance
FT                   protein D EmrD SWALL:EMRD_ECOLI (SWALL:P31442) (394 aa)
FT                   fasta scores: E(): 6.1e-104, 71.28 38d in 390 aa, and to
FT                   Salmonella typhi multidrug resistance protein D STY3981
FT                   SWALL:Q8Z2L0 (EMBL:AL627280) (394 aa) fasta scores: E():
FT                   2.3e-106, 72.33 38d in 394 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10239"
FT                   /db_xref="GOA:A1JI01"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI01"
FT                   /inference="similar to sequence:INSDC:AL627280"
FT                   /inference="similar to sequence:UniProtKB:P31442"
FT                   /protein_id="CAL10239.1"
FT                   /translation="MRKIENFHLLVMLILLVAVGQMAQTIYVPVVADIARDLSVRSGTV
FT                   QRVMAAYLLTYGFSQLIYGPLSDRVGRRPVILAGMMIFMLGALGAWLANSLSLLVAASA
FT                   LQGMGTGVAGVMARTMPRDLYAGTALRYANSMLNMGILVSPLMAPVIGGVLASLFGWRA
FT                   CYAFLLFLCGGVAFCMFRWLPETRPQQTEKRRMLASFRLLLSDRAFSCYLVMLIGALAG
FT                   IAVFEASAGVLMGGVLGLSGVTVSILFILPIPAAFFGAWYAGRDGKTFHNLMWHSVISC
FT                   LLAGLMMWIPGWFGVMNIWTLVIPAALFFFGAGMLFPLATTGAMEPFPYLAGAAGALVG
FT                   GLQNVGSGLATWLSAMLPQTGQFSLGLLMFAMAVLILLCWWPLSHRMQPQEHRV"
FT   sig_peptide     105845..105913
FT                   /gene="emrD"
FT                   /locus_tag="YE0097"
FT                   /note="Signal peptide predicted for YE0097 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.934 between residues 23 and 24"
FT   misc_feature    105881..107017
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -92.8, E-value 0.00014"
FT                   /inference="protein motif:PFAM:PF00083"
FT   misc_feature    join(105986..106045,106064..106123,106136..106195,
FT                   106253..106321,106334..106393,106451..106519,
FT                   106562..106630,106667..106735,106745..106813,
FT                   106832..106900,106928..106996)
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0097 by TMHMM2.0 at aa 7-28, 48-67, 74-93,
FT                   98-117,137-159, 164-183, 203-225, 240-262, 275-297,
FT                   301-323,330-352 and 362-384"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(107115..108125)
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="YE0098"
FT                   /product="putative fructose 1, 6-bisphosphatase"
FT                   /note="Similar to Escherichia coli putative fructose
FT                   1,6-bisphosphatase GlpX SWALL:GLPX_ECOLI (SWALL:P28860)
FT                   (336 aa) fasta scores: E(): 6.2e-107, 86.01 38d in 336 aa,
FT                   and to Shigella flexneri putative fructose 1,
FT                   6-bisphosphatase GlpX SWALL:GLPX_SHIFL (SWALL:P28900) (336
FT                   aa) fasta scores: E(): 2.2e-106, 85.71 38d in 336 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10240"
FT                   /db_xref="GOA:A1JI02"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI02"
FT                   /inference="similar to sequence:UniProtKB:P28860"
FT                   /inference="similar to sequence:UniProtKB:P28900"
FT                   /protein_id="CAL10240.1"
FT                   /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVKAMRIMLN
FT                   QVNIDGQIVIGEGEIDEAPMLYIGENVGTGQGDAVDIAVDPIEGTRMTAMGQANALAVL
FT                   AVGDKGTFLHAPDMYMEKLVVGPGAKGAIDLNLPLELNLRNVAIKLNKPLTDLTVITLA
FT                   KPRHDGIIAEMQQLGVKVFAIPDGDVAASILTCMPESEVDVMYCIGGAPEGVISAAVIR
FT                   ALDGDMQGRLLPRHQVKGDNEDNRRIGEEELVRCKSMGIEAGKVLLLGDMARNDNVIFS
FT                   ATGITKGDLLEGIYRKGNMATTETLLIRGKSRTIRRIRSTHFLDRKDPALHEFLL"
FT   misc_feature    complement(107160..108122)
FT                   /note="Pfam match to entry PF03320 FBPase_glpX, Bacterial
FT                   fructose-1,6-bisphosphatase, glpX-encoded, score
FT                   788.7,E-value 1.4e-234"
FT                   /inference="protein motif:PFAM:PF03320"
FT   CDS             complement(108307..109830)
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="YE0099"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="Similar to Escherichia coli glycerol kinase GlpK
FT                   SWALL:GLPK_ECOLI (SWALL:P08859) (501 aa) fasta scores: E():
FT                   2e-178, 85.23 38d in 501 aa, and to Salmonella typhi
FT                   glycerol kinase STY3784 SWALL:Q8Z2Y6 (EMBL:AL627279) (501
FT                   aa) fasta scores: E(): 1.6e-177, 85.17 38d in 499 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10241"
FT                   /db_xref="GOA:A1JI03"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI03"
FT                   /inference="similar to sequence:INSDC:AL627279"
FT                   /inference="similar to sequence:UniProtKB:P08859"
FT                   /protein_id="CAL10241.1"
FT                   /translation="MTTENTTQKKYIVALDQGTTSSRAVVLDHDANIVSISQREFEQIY
FT                   PKAGWVEHDPMEIWATQSSTLVEVLAKAGISSDEIAGIGITNQRETTIVWDKTTGKPVY
FT                   NAIVWQCRRTADICEKLKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARDRAER
FT                   GELLFGTVDTWLVWNMTQGRVHVTDYTNASRTMMFNIRTKEWDERMLKALNIPRSMLPE
FT                   VRPSSEVYGQTNIGGKGGTRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNT
FT                   GTEAVQSNHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLISDADDSEYFAT
FT                   KVKDSNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLD
FT                   AMQADSGERLKSLRVDGGAVANNFLMQFQADILGTRVERPEVRESTALGAAFLAGLATG
FT                   FWNDLDEVKSKATIEREFRPGIETTERDFRYKGWKKAVARAQAWEEHEE"
FT   misc_feature    complement(108373..109050)
FT                   /note="Pfam match to entry PF02782 FGGY_C, FGGY family of
FT                   carbohydrate kinases, C-terminal domain, score
FT                   353.3,E-value 1.7e-103"
FT                   /inference="protein motif:PFAM:PF02782"
FT   misc_feature    complement(108667..108729)
FT                   /note="PS00445 FGGY family of carbohydrate kinases
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00445"
FT   misc_feature    complement(109057..109800)
FT                   /note="Pfam match to entry PF00370 FGGY, FGGY family of
FT                   carbohydrate kinases, N-terminal domain, score
FT                   452.8,E-value 1.9e-133"
FT                   /inference="protein motif:PFAM:PF00370"
FT   misc_feature    complement(109372..109410)
FT                   /note="PS00933 FGGY family of carbohydrate kinases
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00933"
FT   CDS             complement(109907..110755)
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="YE0100"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10242"
FT                   /db_xref="GOA:A1JI04"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI04"
FT                   /protein_id="CAL10242.1"
FT                   /translation="MSQTASSTLKGQCIAEFLGTALLIFFGVGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDRRKVLPYIVAQVAGAFCAAA
FT                   LVFGLYYNLFIDFEQTHQIARGSVESLNLAGIFSTYPNPHISVFQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGGSMGPLTGFALNPARDFGPKLFAYFAGWG
FT                   EVAFTGGRDIPYFLVPIFGPIVGALVGAFGYRALIGRHLPCDVCVADDEETTVTTTERK
FT                   A"
FT   misc_feature    complement(join(109985..110053,110150..110218,
FT                   110255..110323,110423..110491,110549..110617,
FT                   110660..110719))
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0100 by TMHMM2.0 at aa 13-32, 47-69, 89-111,
FT                   145-167,180-202 and 235-257"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(109997..110755)
FT                   /note="Pfam match to entry PF00230 MIP, Major intrinsic
FT                   protein, score 420.9, E-value 7.8e-124"
FT                   /inference="protein motif:PFAM:PF00230"
FT   misc_feature    complement(110510..110542)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(110528..110554)
FT                   /note="PS00221 MIP family signature."
FT                   /inference="protein motif:Prosite:PS00221"
FT   misc_feature    complement(110666..110698)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             111350..111589
FT                   /transl_table=11
FT                   /locus_tag="YE0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10243"
FT                   /db_xref="GOA:A1JI05"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI05"
FT                   /protein_id="CAL10243.1"
FT                   /translation="MSFEVFEKLEVKVQQAIDTITLLQMEIEELKEKNNTLSQEVQEAA
FT                   GGREALVRENEQLKQEQHVWQDRLRALLGKMEEV"
FT   CDS             complement(111726..112211)
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="YE0102"
FT                   /product="S-adenosylmethionine:2-demethylmenaquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10244"
FT                   /db_xref="GOA:A1JI06"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI06"
FT                   /protein_id="CAL10244.1"
FT                   /translation="MKYDTSDLCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLVVDGGGSVRRALINAELADLALKNEWEGIVVYGAVRQVDELAE
FT                   LDIGIQAMAAIPVGAADEGIGESDIRVNFGGVTFFSGDHLYADNTGIILSEEPLDIE"
FT   misc_feature    complement(111753..112211)
FT                   /note="Pfam match to entry PF03737
FT                   Methyltransf_6,Dimethylmenaquinone methyltransferase, score
FT                   262.7,E-value 3.2e-76"
FT                   /inference="protein motif:PFAM:PF03737"
FT   CDS             complement(112342..113196)
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="YE0103"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10245"
FT                   /db_xref="GOA:A1JI07"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI07"
FT                   /protein_id="CAL10245.1"
FT                   /translation="MPLAFASIVTGSALAVWLDSFKPAVALLALLTAGLLQILSNLAND
FT                   YGDAIKGSDTEERIGPLRGMQKGIITRHQMKVALIITVSLTVISGIALIAVACEKPSDV
FT                   LGFLLLGLMAIVAAITYTVGSKPYGYMGLGDISVLVFFGWLSVAGTYYLQAGHFDSIVM
FT                   LPATACGLLATAVLNINNLRDIENDKANGKNTLAVRLGPAVARYYHALLIVAAIFCLTL
FT                   FNILYLHSWAGWIFVLAIPLLARHALFVLREPTAAGMRPMLEHMVKAALLTNILFAIGL
FT                   VLS"
FT   misc_feature    complement(112345..113196)
FT                   /note="Pfam match to entry PF01040 UbiA, UbiA
FT                   prenyltransferase family, score 121.0, E-value 1.5e-33"
FT                   /inference="protein motif:PFAM:PF01040"
FT   misc_feature    complement(join(112348..112416,112450..112509,
FT                   112522..112590,112651..112719,112732..112791,
FT                   112828..112887,112900..112968,113068..113127))
FT                   /note="8 probable transmembrane helices predicted for
FT                   YE0103 by TMHMM2.0 at aa 24-43, 77-99, 104-123,
FT                   136-155,160-182, 203-225, 230-249 and 261-283"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(112903..112935)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(113152..113196)
FT                   /gene="menA"
FT                   /locus_tag="YE0103"
FT                   /note="Signal peptide predicted for YE0103 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.814) with cleavage site
FT                   probability 0.628 between residues 15 and 16"
FT   CDS             complement(113424..114755)
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="YE0104"
FT                   /product="ATP-binding heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10246"
FT                   /db_xref="GOA:A1JI08"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI08"
FT                   /protein_id="CAL10246.1"
FT                   /translation="MSEMTPREIVSELDSYIIGQDKAKRAVAIALRNRWRRMQLNEELR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DAAVKMVRHQSIEKMRYRAEELAEERILDVLIPPAKNNWGQPEETQEPSPTRQAFRKKL
FT                   REGQLDDKEIEIDLAAAPVGVEIMAPPGMEEMTNQLQSMFQNIAGQKQKPRKIKIKEAF
FT                   KLLIEEEAAKLVNPEELKQQAIDAVEQHGIVFIDEIDKICKRGQTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVSSPSDLIPELQGRLPIRVELQALTTDDF
FT                   ERILTEPSASLTEQYKALMATEGVTVEFTREGIRKIAEAAWQVNERTENIGARRLHTVL
FT                   ERLMEDISYDASESNGQSITIDAAYVGKHLDELVADEDLSRFIL"
FT   misc_feature    complement(113607..114602)
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   27.3, E-value 5.6e-07"
FT                   /inference="protein motif:PFAM:PF00004"
FT   misc_feature    complement(114564..114587)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(114810..115334)
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="YE0105"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10247"
FT                   /db_xref="GOA:A1JI09"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI09"
FT                   /protein_id="CAL10247.1"
FT                   /translation="MTTIVSVRRNGHVVIGGDGQVTLGNTVMKGNAKKVRRLYNNKVIA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLTKAAVELAKDWRTDRMLRKLEALLAVADETAS
FT                   LIITGNGDVVQPEDDLIAIGSGGPYAQSAARALLENTELGARDIVEKSLSIAGDICIYT
FT                   NRFQTIEELTY"
FT   misc_feature    complement(115164..115223)
FT                   /note="1 probable transmembrane helix predicted for YE0105
FT                   by TMHMM2.0 at aa 38-57"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(115434..116297)
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /gene_synonym="msgA"
FT                   /locus_tag="YE0106"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10248"
FT                   /db_xref="GOA:A1JI10"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI10"
FT                   /protein_id="CAL10248.1"
FT                   /translation="MAQRDYVSRGRSGARRKSTSRKKRSAPAVSKTVMALAVALLVVFV
FT                   GGLYFITHNKPGELPLLPSHDPRTGNGLPPKPEERWRYIKELENRQIGVPTPTEPSAGG
FT                   EVNSKTQLTNEQRQLLEQMQADMRQQPTQLSEVPYNEGMPVPRSAVTIKPPVTNMQQPL
FT                   TPPRQTVAPVPAPQTQVQPPVTTPPRTQQPTAPVTQAATPPKPEKEKEKAQRWMVQCGS
FT                   FKAVDQAESIRAQLAFEGIESRITAGGGWNRVVLGPYSTKAAADKALQRLKGAGQSGCI
FT                   PLAVGG"
FT   sig_peptide     complement(116136..116297)
FT                   /gene="ftsN"
FT                   /gene_synonym="msgA"
FT                   /locus_tag="YE0106"
FT                   /note="Signal peptide predicted for YE0106 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.661) with cleavage site
FT                   probability 0.196 between residues 54 and 55"
FT   misc_feature    complement(116145..116213)
FT                   /note="1 probable transmembrane helix predicted for YE0106
FT                   by TMHMM2.0 at aa 29-51"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(116363..117391)
FT                   /transl_table=11
FT                   /gene="cytR"
FT                   /locus_tag="YE0107"
FT                   /product="transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10249"
FT                   /db_xref="GOA:A1JI11"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI11"
FT                   /protein_id="CAL10249.1"
FT                   /translation="MEHKKEFTMATMKDVAEMAGVSTATVSRALMNPEKVSTVTRQKVE
FT                   QAVLAVGYSPHALSRNIKRNESRTILVIVPDISDPFFADIIQGIEHAAAQQGYLILIGD
FT                   CAQQPQQERSFVNLIITKQIDGMLLLGSNLPFDASKEEQRNLPPMVMANEFAPELELPT
FT                   VHIDNLTAAYEAVEYLIRLGHQRIACVAGPENFPLCQYRLQGYIQALRRNGIEVDSNYI
FT                   IRGDFSYEAGVDTFIKLMDLPEPPTAIFCHNDVMAIGAMWQAKKMGLRIPQDVSVVGFD
FT                   DLKLSQYCDPPLTTVAQPRYEIGRQAMLLLLEQLQGHPVQSGSRLLNTELIVRESTAAP
FT                   KR"
FT   misc_feature    complement(116387..117193)
FT                   /note="Pfam match to entry PF00532
FT                   Peripla_BP_like,Periplasmic binding proteins and sugar
FT                   binding domain of the LacI family, score 116.6, E-value
FT                   3.1e-32"
FT                   /inference="protein motif:PFAM:PF00532"
FT   misc_feature    complement(117287..117370)
FT                   /note="Pfam match to entry PF00356 lacI, Bacterial
FT                   regulatory proteins, lacI family, score 53.4, E-value
FT                   3.2e-13"
FT                   /inference="protein motif:PFAM:PF00356"
FT   misc_feature    complement(117299..117364)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1874.000, SD 5.57 at aa 10-31, sequence
FT                   ATMKDVAEMAGVSTATVSRALM"
FT   misc_feature    complement(117302..117358)
FT                   /note="PS00356 Bacterial regulatory proteins, lacI family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00356"
FT   CDS             complement(117622..119820)
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="YE0108"
FT                   /product="primosomal protein n'"
FT                   /db_xref="EnsemblGenomes-Gn:YE0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10250"
FT                   /db_xref="GOA:A1JI12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI12"
FT                   /protein_id="CAL10250.1"
FT                   /translation="MSVVQVALPVPLTRTFDYRLDSATACPVVGARVSVPFGKRNAIGI
FT                   VVGISETSTFPLEQLKAIDAVLDGDSLFPPSLWRILCWATEYYHYPIGEVLFHALPILL
FT                   RQGKPAKSAPLWQWFATEQGRATPPESLKRAPKQQQALAALLQKPVYRHQVNEMALTES
FT                   ALQTLRSKGLIDLRAQEVAATDWRNGFSVLGERLRLNTEQATAVGAIRSEDTQFAAWLL
FT                   AGVTGSGKTEVYLSVLENILAQGRQALVLVPEIGLTPQTIARFRERFNAPVEVLHSGLN
FT                   DSERLSVWLRARNGEAAIVIGTRSALFTPFSRLGVIIIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEGIPIVMGTATPALETLHNVQMGKYRQLTLSKRAGNAKPAVQHLLDLKGLPL
FT                   KVGLSQPLLKRMKAHLQADNQVILFLNRRGYAPALLCHECGWIAECQRCDHYYTLHQNH
FT                   RQLRCHHCDSQRPVPQQCPKCGSTHMVSVGVGTEQLENELAPLFPDTPITRIDRDTTSR
FT                   KGSLEQHLADVHQGGARILIGTQMLAKGHHFPDVTLVALLDVDGALFSADFRSAERFAQ
FT                   LYTQVSGRAGRAGKQGEVILQTHHPEHPLLQILLQQGYDAFAKQALAERKSVFLPPYTS
FT                   HIIVRSEDHDNQQSALFLQQLRNLLEASPLKDEALWIMGPVPALQAKRGGRFRWQLLLQ
FT                   HPSRQLLQRLIKTSQPLINTLPQARKVKWTLDVDPIDS"
FT   misc_feature    complement(118054..118311)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 27.9, E-value 1.6e-05"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    complement(119128..119151)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             120213..120431
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="YE0109"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:YE0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10251"
FT                   /db_xref="GOA:A1JI13"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI13"
FT                   /protein_id="CAL10251.1"
FT                   /translation="MKQGIHPKYDLVTASCSCGNVIKINSTVGHDLNLDVCGECHPFYT
FT                   GKQRDVATGGRVDRFNKRFSVPGTTKA"
FT   misc_feature    120213..120413
FT                   /note="Pfam match to entry PF01197 Ribosomal_L31,Ribosomal
FT                   protein L31, score 144.6, E-value 1.1e-40"
FT                   /inference="protein motif:PFAM:PF01197"
FT   misc_feature    120321..120338
FT                   /note="PS00190 Cytochrome c family heme-binding site
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00190"
FT   misc_feature    120333..120389
FT                   /note="PS01143 Ribosomal protein L31 signature."
FT                   /inference="protein motif:Prosite:PS01143"
FT   CDS             complement(120521..120838)
FT                   /transl_table=11
FT                   /gene="metJ"
FT                   /locus_tag="YE0110"
FT                   /product="transcriptional repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10252"
FT                   /db_xref="GOA:A1JI14"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI14"
FT                   /protein_id="CAL10252.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKILMRELGVDPDTWE
FT                   Y"
FT   misc_feature    complement(120524..120835)
FT                   /note="Pfam match to entry PF01340 MetJ, Met Apo-repressor,
FT                   MetJ, score 292.2, E-value 4.2e-85"
FT                   /inference="protein motif:PFAM:PF01340"
FT   CDS             121214..122371
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="YE0111"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10253"
FT                   /db_xref="GOA:A1JI15"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI15"
FT                   /protein_id="CAL10253.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFIDFNQPRAHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIHLVCTTFLKPDDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAYRVLFVDQGDEVALSQALAKKPKLVLIETPSNPLLRVVDIAAICKDA
FT                   HAVGALTVCDNTFLSPALQQPLALGADLVVHSCTKYLNGHSDVVAGAVIAKDPELAVEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAQQQRNADDIVRYLQQQPLVKKLYHPSLL
FT                   QHPGHEIACRQQSGFGAMLSFELDGDEQVLRRFLSALELFTLAESLGGVESLISHAATM
FT                   THAGMAPEARTAAGITDSLLRISVGIEDSEDLIADLDNAFRLARD"
FT   misc_feature    121229..122356
FT                   /note="Pfam match to entry PF01053 Cys_Met_Meta_PP,Cys/Met
FT                   metabolism PLP-dependent enzyme, score 708.0,E-value
FT                   2.9e-210"
FT                   /inference="protein motif:PFAM:PF01053"
FT   misc_feature    121781..121825
FT                   /note="PS00868 Cys/Met metabolism enzymes
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00868"
FT   CDS             122379..124814
FT                   /transl_table=11
FT                   /gene="metL"
FT                   /gene_synonym="metM"
FT                   /locus_tag="YE0112"
FT                   /product="bifunctional aspartokinase/homoserine
FT                   dehydrogenase II"
FT                   /db_xref="EnsemblGenomes-Gn:YE0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10254"
FT                   /db_xref="GOA:A1JI16"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI16"
FT                   /protein_id="CAL10254.1"
FT                   /translation="MNATAVAAAVTGRQLHKFGGSSLADVKCYLRVANIMANYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQTDRLSAHQVQQNLRRYQHDLISGLLSPEMAEPLISEFI
FT                   HDLERLAGLLDNKVDDAIYAEVVGHGEIWSARLMSAVLNKLDMAADWLDARSFLRAERA
FT                   AQPQIDEGRSYPLLQQLMAQHPHQRLVVTGFISRNNAGETVLLGRNGSDYSATLVGALA
FT                   GVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGSGAKIVTSHDDVCLIELQIAGHHDFSLAQKEIDL
FT                   LLKRAQIKPLATGIHPDRNLLQLCYTSEVVNSALRVLEDATLPGKLSLREGLALVALVG
FT                   AGVSKNPLHSHRFYQQLKDQPVEFIWQAEDGISLVAVLRLGPTEHLIQGLHQSLFRAEK
FT                   RIGLMLFGKGNIGARWLELFAREQKNISARSGFEFVLAGVVDSRRSLLSYDGLDASRTL
FT                   AFYDDEAKEQDEESLFLWMRAHPFDDLVVLDVTASESLAEQYLDFASYGFHVISANKLA
FT                   GASSSNNYRQIRDAFAKTGRHWLYNATVGAGLPVNHTVRDLRDSGDSILAISGIFSGTL
FT                   SWLFLQFDGTVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPNQV
FT                   RVESLVPAGADIGSVDQFFENGEALNQQMIQRLEAANEMGLVLRYVARFDANGKARVGV
FT                   EAVRADHPLASLLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLAQLL"
FT   misc_feature    122412..123242
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 162.5, E-value 4.7e-46"
FT                   /inference="protein motif:PFAM:PF00696"
FT   misc_feature    122421..122447
FT                   /note="PS00324 Aspartokinase signature."
FT                   /inference="protein motif:Prosite:PS00324"
FT   misc_feature    123795..124199
FT                   /note="Pfam match to entry PF03447 NAD_binding_3,Homoserine
FT                   dehydrogenase, NAD binding domain, score 167.0, E-value
FT                   2.1e-47"
FT                   /inference="protein motif:PFAM:PF03447"
FT   misc_feature    124203..124793
FT                   /note="Pfam match to entry PF00742 Homoserine_dh,Homoserine
FT                   dehydrogenase, score 344.9, E-value 5.8e-101"
FT                   /inference="protein motif:PFAM:PF00742"
FT   misc_feature    124341..124409
FT                   /note="PS01042 Homoserine dehydrogenase signature."
FT                   /inference="protein motif:Prosite:PS01042"
FT   CDS             complement(124892..127000)
FT                   /transl_table=11
FT                   /locus_tag="YE0113"
FT                   /product="hypothetical protein"
FT                   /note="Similar to several including: Clostridium
FT                   acetobutylicum predicted permease Cac2003 SWALL:Q97HK8
FT                   (EMBL:AE007704) (832 aa) fasta scores: E(): 0.072, 24.67 id
FT                   in 535 aa and Buchnera aphidicola OmpA-like protein
FT                   precursor or bu332 SWALL:OMPA_BUCAI (SWALL:P57414) (349 aa)
FT                   fasta scores: E(): 6.6, 24.17 38d in 273 aa. Note that this
FT                   CDS lies within a localised low G+C region."
FT                   /db_xref="EnsemblGenomes-Gn:YE0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10255"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI17"
FT                   /inference="similar to sequence:INSDC:AE007704"
FT                   /inference="similar to sequence:UniProtKB:P57414"
FT                   /protein_id="CAL10255.1"
FT                   /translation="MNIKERINFYNSLATSSPVIYQKNKVPDTRFRLSEGIIKICGKYN
FT                   IKPIILNNNSEDTNRNAAENTAYDDKNINFIDVDDRVSDNARGKDPKVKFTLHGAPKTF
FT                   TSAYITNDLKDKIYNNGFRLSNNENIVNYLKSADEYALLLTIIATTTTSKVLRDNIINS
FT                   VDSDISTDGSSSAGMSYSENRDELTTWINKHVKPEHKSKVDLLLSAPDRHAELKDKVYL
FT                   SDMLLFSGKKTIPFKLKEIILNNTVVVKFNNTSLRLSHSRIDKINNASDKKTALQMGFL
FT                   KKIQYICMNKGKRLSDLYDFTHDHKNGEKLFIQSNGRIQEKLTSVINKKMPRLKTVEID
FT                   NSETVAKELQKILKEKAINLQDNIFTKIVYFEDKEDTTGKTYYISKNFPPVYKPNIPYV
FT                   HPENEQGASKYVVSKDDNFVALAPTKKEKFSTKNNFHDLKGLNSIKTGLVVAPDLMISH
FT                   NAGICLIDHLNNNAPLPQSVFKIAVNELKKLHEIQGYLRDIKPANMAYDGKQVNFIDVD
FT                   DRIKAHEITKISAPVFKIYGKEVIYTPKYITQGLVNNIYESNPGNPGKKTLKQTDITHD
FT                   LQIADEYAFLMTMITATTKDNALKSSIKNAKVDIIGVRIINRIKNEIDQCSDRQKKDKL
FT                   TDKLIETQKEYNNTGIMNKSNKTYFTPWLKENIKPKHHKSVKLLLTDPAKYADTAPKTH
FT                   LADMLLFK"
FT   CDS             127374..128258
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="YE0114"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10256"
FT                   /db_xref="GOA:A1JI18"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI18"
FT                   /protein_id="CAL10256.1"
FT                   /translation="MSFFHANQREALNQSLAELQGQINVSFEFFPPRTSEMEDTLWSSI
FT                   DRLSTLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCVDASPTQLREIAT
FT                   DYWNSGIRHIVALRGDLPPDSGKPEMYASDLVGLLKDVGDFDISVAAYPEVHPEAKSAQ
FT                   ADLINLKRKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTRIFEGLDDDPETRKMVGASVAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRP"
FT   misc_feature    127404..128246
FT                   /note="Pfam match to entry PF02219
FT                   MTHFR,Methylenetetrahydrofolate reductase, score 555.3,
FT                   E-value 2.6e-164"
FT                   /inference="protein motif:PFAM:PF02219"
FT   CDS             128578..129780
FT                   /transl_table=11
FT                   /locus_tag="YE0115"
FT                   /product="hypothetical protein"
FT                   /note="Similar in parts to Campylobacter jejuni
FT                   hypothetical protein Cj0849C SWALL:Q9PP74 (EMBL:AL139076)
FT                   (719 aa) fasta scores: E(): 0.19, 22.86 38d in 258 aa and
FT                   to Chlamydia pneumoniae phosphoenolpyruvate-protein
FT                   phosphotransferase PtsI or Cpn0038 SWALL:PT1_CHLPN
FT                   (SWALL:Q9Z9E3) (571 aa) fasta scores: E(): 3.5, 19.57 38d
FT                   in 332 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10257"
FT                   /db_xref="GOA:A1JI19"
FT                   /db_xref="InterPro:IPR000768"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI19"
FT                   /inference="similar to sequence:INSDC:AL139076"
FT                   /inference="similar to sequence:UniProtKB:Q9Z9E3"
FT                   /protein_id="CAL10257.1"
FT                   /translation="MSRISQSSSPVTTAKLAGKNTLHQEKNTLCANIQKVENVLTNVNR
FT                   EIKAKTNDLNKNNALLTSLTSIASKHGDDANIRLKNDHFKLGQGSNFLKNLINGGRYKL
FT                   EQQAATSKLVVKGSEVSARTGIAKLTQQIKTIQDSLDSSNKELKNNKTEYDSLNFKLGA
FT                   VDQQIETFNKAKIAADKADNNNKALCNNFSMIYQSNAGCKAINAEARHQFGNANQSAKL
FT                   NGNQVIAEYVKTHGDNVFSGGNAPVKSAIQSHCSNLPTLVKDVAKAWYSPTDTTTTSHR
FT                   GQGMTQDGIDKLMSQFKSDRAGSVYKLGQFFSTSKEVNVAKAFADRTGDSVKIMFEVKG
FT                   NSGRGIVVSGGLKFDNNEREVLYSPLAKFAVTDIKGSNAKGYTIKLNEVEQDTKAKLLP
FT                   Y"
FT   CDS             complement(129861..132500)
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /gene_synonym="glu"
FT                   /locus_tag="YE0116"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10258"
FT                   /db_xref="GOA:A1JI20"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI20"
FT                   /protein_id="CAL10258.1"
FT                   /translation="MNEQYSAMRSNVSMLGTLLGDTIKEALGEHILEKVETIRKLSKSS
FT                   RAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEAL
FT                   AQLFTRLKDKKLSEQDMRSAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHN
FT                   DLADYERNKIMRRLRQLVAQSWHTDEIRKIRPSPVDEAKWGFAVVENSLWEGVPAFLRE
FT                   FNEQLQNSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLRD
FT                   IQVLVSELSMSECTPELRELAGGEEVLEPYRELMKRVRTQLTNTQAYLEARLKGERVLP
FT                   PTDLLVSNDQLWDPLYACYQSLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQEST
FT                   RHTDAIAELTRYLGLGDYESWSEADKQAFLIRELNSKRPLVPLKWEPSADTQEVLETCR
FT                   VIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVM
FT                   TQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTCEKAGISLTL
FT                   FHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAS
FT                   AVLEANLLPPPEPKKEWNEVMDILSDASCEMYRGYVRENPQFVPYFRAATPELELGKLP
FT                   LGSRPAKRRPNGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQKAIDAGKKEVLATMC
FT                   RDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLRDQLEADIKVVLAIA
FT                   NDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQENAADACVEQALMVTIAGV
FT                   AAGMRNTG"
FT   misc_feature    complement(129864..132500)
FT                   /note="Pfam match to entry PF00311
FT                   PEPcase,Phosphoenolpyruvate carboxylase, score 763.6,
FT                   E-value 5.3e-227"
FT                   /inference="protein motif:PFAM:PF00311"
FT   misc_feature    complement(130857..130895)
FT                   /note="PS00393 Phosphoenolpyruvate carboxylase active site
FT                   2."
FT                   /inference="protein motif:Prosite:PS00393"
FT   misc_feature    complement(132069..132104)
FT                   /note="PS00781 Phosphoenolpyruvate carboxylase active site
FT                   1."
FT                   /inference="protein motif:Prosite:PS00781"
FT   CDS             complement(132848..134032)
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="YE0117"
FT                   /product="acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10259"
FT                   /db_xref="GOA:A1JI21"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI21"
FT                   /protein_id="CAL10259.1"
FT                   /translation="MKMKLPPFIELYRALIATPSISATDSALDQSNEALINLLAGWFAD
FT                   LGFRVEIQPVPDTRHKFNLLASIGENSVGKKSSGEGSGGLLLAGHTDTVPYDEGRWTRD
FT                   PFTLTEHDNKLYGLGTADMKGFFAFILDAVRDIDASTLSKPLYILATADEETTMAGARY
FT                   FAASTQLRPDFAIIGEPTSLQPVRAHKGHISNAIRITGQSGHSSDPARGVNAIDLMHES
FT                   ITELMKLRTTLQERYNNPAFAIPYPTMNFGHINGGDAANRICACCELHMDIRPLPGLTL
FT                   SDLDELMTEALAPVSARWPGRLSIDQLHPPIPGYECPTDHHMVGVIEELLGERTAVVNY
FT                   CTEAPFIQQICPTLVLGPGSINQAHQPDEFIDMAFIEPTRELIGQLVDHFCQQK"
FT   misc_feature    complement(133004..133999)
FT                   /note="Pfam match to entry PF01546 Peptidase_M20,Peptidase
FT                   family M20/M25/M40, score 236.5, E-value 2.5e-68"
FT                   /inference="protein motif:PFAM:PF01546"
FT   misc_feature    complement(133562..133675)
FT                   /note="PS00759 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00759"
FT   misc_feature    complement(133751..133780)
FT                   /note="PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00758"
FT   CDS             134395..135399
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="YE0119"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10260"
FT                   /db_xref="GOA:A1JI22"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI22"
FT                   /protein_id="CAL10260.1"
FT                   /translation="MLNTLIVGASGYAGAELTAYLNRHPHMNITALAVSAQSADAGKLL
FT                   SDLHPQLKGIIDLPLQPLLDVAQAAKGVDVVFLATAHEVSHDLAPQFLAAGCVVFDLSG
FT                   AYRVQNAEFYRQYYGFEHQHADWLDKAVYGLAEWQAEKIKQAQLIAVPGCYPTASQLAL
FT                   KPLVDGGLLNNAQWPVINAVSGVSGAGRKASIGNSFCEVSLQPYGLFNHRHQPEIVAHL
FT                   GTPVIFTPHLGNFARGILATITCRLKVGVTAQDIAEAYHNAYQDKPLIRLYKQGVPALK
FT                   AVVGLPFCDIGFSVQGEHLIIVATEDNLLKGAAAQAVQCMNIRFGFAETQALL"
FT   misc_feature    134395..134844
FT                   /note="Pfam match to entry PF01118
FT                   Semialdhyde_dh,Semialdehyde dehydrogenase, NAD binding
FT                   domain, score 174.7, E-value 1e-49"
FT                   /inference="protein motif:PFAM:PF01118"
FT   misc_feature    134629..134658
FT                   /note="PS00142 Neutral zinc metallopeptidases,zinc-binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00142"
FT   misc_feature    134839..134889
FT                   /note="PS01224 N-acetyl-gamma-glutamyl-phosphate reductase
FT                   active site."
FT                   /inference="protein motif:Prosite:PS01224"
FT   misc_feature    134869..135327
FT                   /note="Pfam match to entry PF02774
FT                   Semialdhyde_dhC,Semialdehyde dehydrogenase, dimerisation
FT                   domain, score 103.9, E-value 2e-28"
FT                   /inference="protein motif:PFAM:PF02774"
FT   CDS             135487..136251
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="YE0120"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10261"
FT                   /db_xref="GOA:A1JI23"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI23"
FT                   /protein_id="CAL10261.1"
FT                   /translation="MVIKLGGVLLDSEEALERLFTALVTYREKHERPLVIMHGGGCLVD
FT                   DLMKKLALPVVKKNGLRVTPADQIDIITGALAGTANKTLLAWAVKHDINAVGLCLGDGN
FT                   TVSVTPLDAALGHVGKAEAGSPALVQTLLAANYMPIISSIGITKDGSLMNVNADQAATA
FT                   LAATLGADLILLSDVSGILDGKGQRIAEMTAQKAEQLIAQGIITDGMVVKVNAALDAAR
FT                   SLGRPVDIASWRHADQLPALFNGVPIGTRILA"
FT   misc_feature    135487..136182
FT                   /note="Pfam match to entry PF00696 aakinase, Amino acid
FT                   kinase family, score 120.0, E-value 2.8e-33"
FT                   /inference="protein motif:PFAM:PF00696"
FT   CDS             136489..137862
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="YE0121"
FT                   /product="putative argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10262"
FT                   /db_xref="GOA:A1JI24"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI24"
FT                   /protein_id="CAL10262.1"
FT                   /translation="MALWGGRFSQAADQRFKQFNDSLRFDYRLAEQDIIGSVAWSKALV
FT                   TVGVLTTAEQQQLEQALSVLLEEVQADPQAILASDAEDIHSWVETKLIDKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKFQITELKTAVQQLQQALVITAEANQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYAEMLARDESRLQDTLKRLDVSPLGSGALAGTAYAIDREQLAGWLGFASAT
FT                   RNSLDSVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGEAAFVDLSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALTGMMMTLKGLPLAYNKDMQEDKEGLFDALDTWLDCLH
FT                   MAALVLDGIQVKRPRCKEAAEQGYANATELADYLVAKGVPFREAHHIVGEAVVEAIRQG
FT                   KALEALSLSDLQKFSAVIGDDVYPILALQSCLDKRVAKGGVSPQQVASAIAEAKARLF"
FT   misc_feature    136504..137784
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase, score
FT                   606.8, E-value 8.1e-180"
FT                   /inference="protein motif:PFAM:PF00206"
FT   misc_feature    137314..137343
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS             138428..140911
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0122"
FT                   /product="putative TonB dependent receptor protein
FT                   (pseudogene)"
FT                   /db_xref="PSEUDO:CAL10263.2"
FT   misc_feature    140567..140908
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 31.5, E-value
FT                   1.3e-06"
FT                   /inference="protein motif:PFAM:PF00593"
FT   CDS             141014..141649
FT                   /transl_table=11
FT                   /locus_tag="YE0123"
FT                   /product="hemophore HasA"
FT                   /db_xref="EnsemblGenomes-Gn:YE0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10264"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI26"
FT                   /protein_id="CAL10264.1"
FT                   /translation="MLLTIRKFIMTVTIKYQGQFSNDTLTSYTKQWATTHGDIKDTEAE
FT                   GYSKDFGQFAGGGWFDGTQYSIGSSHSGSSTGMIIEGDLTYNFAQHTLHGKVDSLELGK
FT                   NLSINSNGIGKQLDQLQLKMSDLDITGEFDPGKTMAENHQGDMHKSIYGLMRGNADPLL
FT                   EVLTAKGIDVNTPLKDMAIASQFEAMVSDMPMIDTVGVVESSDMLLAA"
FT   misc_feature    141404..141427
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             141797..142450
FT                   /transl_table=11
FT                   /locus_tag="YE0124"
FT                   /product="probable hemophore"
FT                   /note="Similar to Yersinia pestis hemophore HasA or Ypo3922
FT                   SWALL:Q8ZA90 (EMBL:AJ414159) (205 aa) fasta scores: E():
FT                   1.5e-05, 28.05 38d in 221 aa. Note the product of this CDS
FT                   is also significantly similar to the CDS directly upstream
FT                   and downstream, YE0123, YE0125 and YE0126."
FT                   /db_xref="EnsemblGenomes-Gn:YE0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10265"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI27"
FT                   /inference="similar to sequence:INSDC:AJ414159"
FT                   /protein_id="CAL10265.1"
FT                   /translation="MTITIKYHEKIANETITSYSQQWATNFGNMLWTMGVDYTLNASGY
FT                   PIPPADSIKYVAASTHHNQSESNAAIVIALKKVAGIENDQSITDLRVSLEFGEALVPIA
FT                   NDGTSKHPHQLLLQQVQLDISGLDIRADVESSMPTLDYALWQDIYYQGGQNLGIYNLLK
FT                   GNANPLLDILKAQGIDVNTPVKDMTIASQFEVPTDELLIETVGITDGGNTLLAA"
FT   CDS             142509..143150
FT                   /transl_table=11
FT                   /locus_tag="YE0125"
FT                   /product="probable hemophore"
FT                   /note="Similar to Yersinia pestis hemophore HasA or Ypo3922
FT                   SWALL:Q8ZA90 (EMBL:AJ414159) (205 aa) fasta scores: E():
FT                   1.8e-08, 33.48 38d in 218 aa and Serratia marcescens
FT                   hemophore HasA SWALL:HASA_SERMA (SWALL:Q54450) (188 aa)
FT                   fasta scores: E(): 0.051, 23.38 38d in 201 aa. Note the
FT                   product of this CDS is also significantly similar to the
FT                   CDS directly upstream and downstream, YE0123,YE0124 and
FT                   YE0126."
FT                   /db_xref="EnsemblGenomes-Gn:YE0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10266"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI28"
FT                   /inference="similar to sequence:INSDC:AJ414159"
FT                   /inference="similar to sequence:UniProtKB:Q54450"
FT                   /protein_id="CAL10266.1"
FT                   /translation="MTITIKYHSQFAEYSVSSYIHQWTTAYGDLIQTPTSFKTYGTLSN
FT                   RIDANNNESVQAEFQSFYESNVAMIVGGSRLEQEQGSTSFIMKKQIQTLEFGESLISNA
FT                   DNTGKQLQQLQLKLDGLNIEDDFYPSLCSISQALDAEPGKPYQGGIDHGTYNLLRGKAA
FT                   PMLEILKAQGINLDSPLKDIAIASQFGVVGDTPIIDTVGAADNSGILLAA"
FT   CDS             143211..143819
FT                   /transl_table=11
FT                   /locus_tag="YE0126"
FT                   /product="probable hemophore"
FT                   /note="Similar to Yersinia pestis hemophore HasA or Ypo3922
FT                   SWALL:Q8ZA90 (EMBL:AJ414159) (205 aa) fasta scores: E():
FT                   2.1e-13, 28.23 38d in 209 aa. Note the product of this CDS
FT                   is also significantly similar to the CDS directly upstream,
FT                   YE0123, YE0124 and YE0125."
FT                   /db_xref="EnsemblGenomes-Gn:YE0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10267"
FT                   /db_xref="InterPro:IPR010495"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI29"
FT                   /inference="similar to sequence:INSDC:AJ414159"
FT                   /protein_id="CAL10267.1"
FT                   /translation="MTVTIIFNGNIKDETIYSYTHKWIADFNIPTVDGYNFTEFHSIKD
FT                   TISRQYEQFSVTNTSGDKATIIMSGEISFKMCHRTIHGKVESLELGKEGVIQNEKNNII
FT                   LEKHLVEPQLIFNGLSIIGDYDNLKITGENQRNDVHQMGFNLKAGNADVLLEILISQGI
FT                   DVNTPLKDMPIASQFEVVANMPIIEVVGEANGGGILLAA"
FT   CDS             144005..145786
FT                   /transl_table=11
FT                   /locus_tag="YE0127"
FT                   /product="ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10268"
FT                   /db_xref="GOA:A1JI30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI30"
FT                   /protein_id="CAL10268.1"
FT                   /translation="MESSQNASASLVSPTLISTLGRHKKILWGIGLFTAVINLLMLAPA
FT                   IYMLQVYDRVLASANTMTLLMLTVLVLAIFAFIGLLEWVRSAIVIRLGTRIDMQLNQQV
FT                   FNAAFASNLNGQKVQAAQALNDLTTLRQFATGNALFAFFDAPWFPFYLLVIFILHPWLG
FT                   ALAALGAVFLIFLAWLNHWICRKPLKEASHITSQATQQANANLRNADAIQAMGMLKALR
FT                   DRWLKQHSHFLYQQNIASDKSSRVTALSKSSRQALQSMMLGLGALLVIDGAITAGVMIA
FT                   GSILVGRVLGPIDQLIAVWKQWSHTRLAYQRLSSLLAQHSQPTTGMVLPPPKGKLSVTQ
FT                   LTVCKPGTHIPVLQSINFELQPGGVLGVLGPSGSGKSTLAKLLVASQPAFSGSVRLDSA
FT                   DLARWDKSHLGEFIGYLPQDIQLFRGSIAENIARFGLIDHAKVIAAAQLADVHDLILHL
FT                   PQGYDTSLGDEGEGLSGGQRQRIALARAMYGVPRLIVLDEPNASLDKVGEQALLASISQ
FT                   LKQQGCTIVMVTHKPELLSGSDYLLFLQNGQIELFDRTQTILQDGQGKNKATTGRNSWG
FT                   SGMSYGVAPIRTASQKS"
FT   misc_feature    join(144080..144148,144191..144259,144410..144478,
FT                   144488..144556,144794..144862)
FT                   /note="5 probable transmembrane helices predicted for
FT                   YE0127 by TMHMM2.0 at aa 26-48, 63-85, 136-158, 162-184 and
FT                   264-286"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    144083..144883
FT                   /note="Pfam match to entry PF00664 ABC_membrane, ABC
FT                   transporter transmembrane region, score 19.6, E-value
FT                   4.6e-05"
FT                   /inference="protein motif:PFAM:PF00664"
FT   misc_feature    145091..145645
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 204.6, E-value 1e-58"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    145112..145135
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    145421..145465
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             145917..147149
FT                   /transl_table=11
FT                   /locus_tag="YE0128"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10269"
FT                   /db_xref="GOA:A1JI31"
FT                   /db_xref="InterPro:IPR003997"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI31"
FT                   /protein_id="CAL10269.1"
FT                   /translation="MVCGGFIGSLLWAGLAPLDKGIAVMGHIVVAENRKLVQPLQGGRI
FT                   QQLHVAEGDDVTQGQLLITLDDTALLSHRDNLQNQYLSALAQESRLTAEQHELPTITFP
FT                   PALLQHPAQALVERNTVLQQQLFLHRRQAQLSDIARLSAQITRHESRLDGLQVARGHNQ
FT                   RQFDLFQRQLQGVQLLAKNGHVAQSQLLEMERQAISLRANIEKNTSEILELHKQIGETE
FT                   QHILQRREQYKSENREQLAKAQQSTQELEQRLGIAEYELDNTRIYAPVSGTVIALTQHT
FT                   VGGVVSTGQTLMELVPNGQPLLAEAQLPVSLIDKVMVGLPVDLNFSAFNQSSTPRLQGS
FT                   VLHVGADRIQNSHTLEPYYPLTVAIDITQTELEIRPGMSVDIFIRTGERSLLNYLFKPL
FT                   TDRLHVAFAEE"
FT   misc_feature    146013..146948
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein, score 152.6, E-value 4.5e-43"
FT                   /inference="protein motif:PFAM:PF00529"
FT   CDS             147226..148026
FT                   /transl_table=11
FT                   /locus_tag="YE0129"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10270"
FT                   /db_xref="GOA:A1JI32"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI32"
FT                   /protein_id="CAL10270.1"
FT                   /translation="MIFFWVSALLTSGVHIYLIWLLSNTPIPPAYTEVSPVAIMLAVST
FT                   EPEFTQHMEQDSVVGITQNINEPVTELSEHQPEEVSHILTAPEHSNAALIVEREVNEPP
FT                   KELNKAKRPQQKVMTPRQPINERTPENHSNPSTPAVVTSTPLSGESHRVAAAANSHSLH
FT                   NQQSKMNWKSRLQGHLAGFKRYPPHARKQRQQGTVIIRFVVNKEGDVLSTKLVKSSGVI
FT                   ALDQEALAVVKRAQPLPQPPVGLLSNEQVSLTMPVDFDLKNIRR"
FT   repeat_region   complement(148088..149391)
FT                   /note="IS1330"
FT   CDS             complement(148114..149307)
FT                   /transl_table=11
FT                   /gene="tpn1330"
FT                   /locus_tag="YE0130"
FT                   /product="transposase for IS1330"
FT                   /note="Previously sequenced as Yersinia enterocolitica
FT                   IS10-like transposase for IS1330 element SWALL:Q8RSF5
FT                   (EMBL:AJ344215) (397 aa) fasta scores: E(): 2.6e-162,99.24
FT                   38d in 397 aa. Also similar to Escherichia coli, and
FT                   Salmonella typhi IS 10 transposase SWALL:Q53371
FT                   (EMBL:S67119) (402 aa) fasta scores: E(): 2e-43, 35.27 38d
FT                   in 394 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10271"
FT                   /db_xref="GOA:A1JI33"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI33"
FT                   /inference="similar to sequence:INSDC:AJ344215"
FT                   /inference="similar to sequence:INSDC:S67119"
FT                   /protein_id="CAL10271.1"
FT                   /translation="MLVRKVCQNFFQNALAPFHKYRQSALMDATVALINGASLTLTSIG
FT                   RFLPGQAQVKNKIKRVDRLLGNESLHRDIPLIFNNIIAMLTRKLSLCVVAVDWSGYHSH
FT                   EYHILRASLICDGRSIPLLSQIVPSAEQQSEQIHKTFLNALARAVNPDARVIIVTDAGF
FT                   QNAWFKHIKSLGWDFVGRIRGYTRLRLHREGDIWYKPQELQARSQPEYLGPGTLSRTQY
FT                   ARCEGHFYLYKKAPKGRKNRRSRGRIKRYKQERDGRSSAKTPWLLFTSSDDFRPREVIK
FT                   IYSRRMQIEQNFRDEKSERFGFGLRASRSRTTERMQVLSLLATLSTIVMWLMGYHFENK
FT                   GLHVRYQANSVKSRRVISYLTLAENVLRHSPLILRRIALNSALNHLARAYRNMVLVY"
FT   misc_feature    complement(148318..149037)
FT                   /note="Pfam match to entry PF01609
FT                   Transposase_11,Transposase DDE domain, score 52.8, E-value
FT                   4.8e-13"
FT                   /inference="protein motif:PFAM:PF01609"
FT   CDS             complement(149422..150870)
FT                   /transl_table=11
FT                   /locus_tag="YE0131"
FT                   /product="putative pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10272"
FT                   /db_xref="GOA:A1JI34"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI34"
FT                   /protein_id="CAL10272.1"
FT                   /translation="MKTLNVDVAVIGGGTAGLGAYRAAKLATPNVVMIEGGEYGTTCAR
FT                   VGCMPSKLLIAAAEAVHQIEKAPDFGIHPQGDILINGREVMDRVKRERDRFVGFVLEGV
FT                   DNIPANDKIQGYAHFIDDNTLQVDDHTRIVAQRIVIATGSRPSWPAAWNELGDRLIVND
FT                   DVFNWDDLPESVAVFGPGVIGLELGQALHRLGVQVKMFGVGGGVGPLTDSIVRNYAAKT
FT                   LGEEFYLNPDVKVEVMQREGDKVFIRYLDDAGLPQEIMVDYVLAATGRRPNVDKLSLEN
FT                   TSLVLDDRGVPPADRLTMQTSVPHIFIAGDASNQLPLLHEASDQARIAGVNAGGFPEVI
FT                   PGLRRSPISVVFSDPQIAMVGSTFRELSQKFSACGCFEIGEVSFENQGRSRVMLKNKGI
FT                   LRVYGEQGTGRFLGAEMMGPSAEHIAHLLAWAHQQQMTINQMLDMPFYHPVIEEGLRTA
FT                   LRDLQSKLKLGTDEAERCLRCPGE"
FT   misc_feature    complement(149494..149826)
FT                   /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 48.8, E-value 7.9e-12"
FT                   /inference="protein motif:PFAM:PF02852"
FT   misc_feature    complement(149908..150852)
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 150.3,E-value
FT                   2.2e-42"
FT                   /inference="protein motif:PFAM:PF00070"
FT   CDS             complement(151070..151801)
FT                   /transl_table=11
FT                   /locus_tag="YE0132"
FT                   /product="putative peroxiredoxin/glutaredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10273"
FT                   /db_xref="GOA:A1JI35"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI35"
FT                   /protein_id="CAL10273.1"
FT                   /translation="MFTSQEGKKVPQVTFHTRQGDQWVDVTTDELFNNKTVIVFSLPGA
FT                   FTPTCSSSHLPRYNELAGVFKQHGVDSILCVSVNDTFVMNAWKADQHAENITFIPDGNG
FT                   EFTKGMDMLVEKADLGFGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APDFKVQESVSVFTKPGCPFCAKAKQMLQDRGIQYEEIVLGKDATTVSLRAVTGRGTVP
FT                   QVFIGGRHIGGSDDLENYLSA"
FT   misc_feature    complement(151118..151288)
FT                   /note="Pfam match to entry PF00462
FT                   glutaredoxin,Glutaredoxin, score 42.7, E-value 5.5e-10"
FT                   /inference="protein motif:PFAM:PF00462"
FT   misc_feature    complement(151229..151279)
FT                   /note="PS00195 Glutaredoxin active site."
FT                   /inference="protein motif:Prosite:PS00195"
FT   misc_feature    complement(151319..151786)
FT                   /note="Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA
FT                   family, score 159.1, E-value 4.8e-45"
FT                   /inference="protein motif:PFAM:PF00578"
FT   CDS             151949..152881
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="YE0133"
FT                   /product="oxidative stress transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10274"
FT                   /db_xref="GOA:A1JI36"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI36"
FT                   /protein_id="CAL10274.1"
FT                   /translation="MNIRDLEYLVALAEFRHFRRAADSCHVSQPTLSGQIRKLEDELGV
FT                   MLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASLQGESMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHQTFPKLEMYLHEAQTQNLLAQLDSGKLDCAILALVKETEAFIEVPLFDE
FT                   PMQLAIYADHPWADRDKVQMHELAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPSLAVPNERKRDGVCYLECYKPVPKRTIALVYRPGSPLRGR
FT                   YEQLAEAIREHMQPRMNSDVINQKLEQAV"
FT   misc_feature    151955..152134
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   97.2, E-value 2.1e-26"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    151994..152059
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1674.000, SD 4.89 at aa 16-37, sequence
FT                   RHFRRAADSCHVSQPTLSGQIR"
FT   misc_feature    151997..152089
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    152204..152830
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 202.6, E-value 3.9e-58"
FT                   /inference="protein motif:PFAM:PF03466"
FT   CDS             complement(152864..154264)
FT                   /transl_table=11
FT                   /gene="sthA"
FT                   /gene_synonym="sth"
FT                   /gene_synonym="udhA"
FT                   /locus_tag="YE0134"
FT                   /product="soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10275"
FT                   /db_xref="GOA:A1JI37"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI37"
FT                   /protein_id="CAL10275.1"
FT                   /translation="MQQHFHFDAIVIGSGPGGEGAAMGLVKQGARVAVIERYNNVGGGC
FT                   THWGTIPSKALRHAVSRIIEFNQNPLYSDNARTISSSFSDILNHADRVINQQTRMRQGF
FT                   YDRNHCQMFSGDASFIDANTINVRYADGTNDTLRADNIVIATGSRPYRPANVDFTHERI
FT                   YDSDTILQLSHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMSDA
FT                   LSYHFWNNGVVIRHNEEFEQIEGTVDGVIVHLKSGKKVKADCLLYANGRTGNTSGLGLE
FT                   KIGLEADSRGLLKVNSMYQTALSHVYAVGDVIGYPSLASAAYDQGRIAAQAMIKGEANT
FT                   HLIEDIPTGIYTIPEISSVGKTEQDLTAMKVPYEVGRAQFKHLARAQIVGMDTGSLKIL
FT                   FHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRVAA
FT                   LNGLNRLF"
FT   misc_feature    complement(152891..153229)
FT                   /note="Pfam match to entry PF02852 pyr_redox_dim, Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain,
FT                   score 134.6, E-value 1.2e-37"
FT                   /inference="protein motif:PFAM:PF02852"
FT   misc_feature    complement(153302..154243)
FT                   /note="Pfam match to entry PF00070 pyr_redox, Pyridine
FT                   nucleotide-disulphide oxidoreductase, score 251.7,E-value
FT                   6.7e-73"
FT                   /inference="protein motif:PFAM:PF00070"
FT   misc_feature    complement(153698..153730)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             154470..155114
FT                   /transl_table=11
FT                   /locus_tag="YE0135"
FT                   /product="TetR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10276"
FT                   /db_xref="GOA:A1JI38"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI38"
FT                   /protein_id="CAL10276.1"
FT                   /translation="MGTIMGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVSREA
FT                   GIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIG
FT                   NNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLELENHMPRSFTEAQAEAMVT
FT                   IVFSAGAEVLDVDAEQRRQLEERLVLQLRMISKGAYYWYRREQEKLAVSRA"
FT   misc_feature    154524..154667
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 46.6, E-value
FT                   3.7e-11"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    154575..154640
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1615.000, SD 4.69 at aa 36-57, sequence
FT                   LSLREVSREAGIAPTSFYRHFR"
FT   CDS             155245..155607
FT                   /transl_table=11
FT                   /gene="yijD"
FT                   /locus_tag="YE0136"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10277"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI39"
FT                   /protein_id="CAL10277.1"
FT                   /translation="MITGLAINGSFNALFSGFVPFSVFPLLTLILAVYCLHQRYLNFAM
FT                   PQGLPVLAGACFLLGILLYSAIVRVEHPAIGSNFVPSILSVVLVFWILFKLKARKSAQT
FT                   DINADTDTDIDNQQPQ"
FT   misc_feature    join(155287..155355,155389..155448,155458..155526)
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0136 by TMHMM2.0 at aa 15-37, 49-68 and 72-94"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    155380..155412
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(155840..156943)
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="YE0138"
FT                   /product="tRNA (uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10278"
FT                   /db_xref="GOA:A1JI40"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI40"
FT                   /protein_id="CAL10278.1"
FT                   /translation="MTPDILPTDGYEHQLAEKSARLQAMMSPFQAPAAEIFRSPAEHYR
FT                   MRAEFRVWHDEDDLYHIMFDQQTKLRIRVEQFPVASLLINRLMSALMTAIRAEPILRHK
FT                   LFQIDYLSTLSGKLLATLLYHRPLDEEWQQKARELRDQLREQGFDLQLIGRASKTKIML
FT                   DHDYIDEVLPVAGRDMIYRQVENSFTQPNAAVNIHMLEWAIDVTQHASGDLLELYCGNG
FT                   NFSLALARNFDRVLATEIAKPSVAAAQYNIAANHIDNVQIIRMSAEEFTQAMQGVREFN
FT                   RLKGIDLTSYNCETIFVDPPRSGLDDETVKLVQAYPRILYISCNPETLCANLEQLQYTH
FT                   KISRLALFDQFPYTHHMECGVLLEKRD"
FT   misc_feature    complement(155870..155902)
FT                   /note="PS01231 RNA methyltransferase trmA family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01231"
FT   misc_feature    complement(155960..156049)
FT                   /note="PS01230 RNA methyltransferase trmA family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS01230"
FT   misc_RNA        157085..157301
FT                   /note="Cobalamin riboswitch (RF00174) as predicted by Rfam,
FT                   score 104.18, positions 1 to 190"
FT   CDS             157369..159267
FT                   /transl_table=11
FT                   /gene="btuB"
FT                   /locus_tag="YE0139"
FT                   /product="exported vitamin B12 receptor protein"
FT                   /note="Similar to Escherichia coli vitamin B12 receptor
FT                   precursor Btub or Bfe or Cer or DcrC or B3966
FT                   SWALL:BTUB_ECOLI (SWALL:P06129) (614 aa) fasta scores: E():
FT                   2.3e-123, 52.7 38d in 628 aa, and to Yersinia pestis
FT                   putative vitamin B12 receptor protein Ypo3910 SWALL:Q8ZAA1
FT                   (EMBL:AJ414159) (625 aa) fasta scores: E(): 5.4e-144,58.45
FT                   38d in 633 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10279"
FT                   /db_xref="GOA:A1JI41"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI41"
FT                   /inference="similar to sequence:INSDC:AJ414159"
FT                   /inference="similar to sequence:UniProtKB:P06129"
FT                   /protein_id="CAL10279.1"
FT                   /translation="MTTKNTITIKKYTLLTALSVTAFSGWAQGNTATGNKDEMVVTASR
FT                   FKQPVSTVLAPADVVTRDDIDRWQAKSLNEVMRRLPGVDIAQFGGVGQGSSMYIRGTEA
FT                   RHVLILIDGIPLARTGIVNSVNLDQIPISLVQRVEYIRGPRSAVYGSGAIGGVINVITQ
FT                   TDQEGAQINAGIGSKGYQQYDGSVRQRFGDTLATLAGGYQTSNGYNIKPDSPNPIDNDR
FT                   DGFRNKNFWAGLEHQFSQEISGFIRGYGYTNNSDYDIGSLSSPAYSGDEERLYNHTYDA
FT                   GLRYASGAYSSQLIGSYQKYKDYNFSSQYGRYGVATTLDNMDQRNVQWGNTYSFESGTL
FT                   SAGLDWQQQRLTSSSQTISDTYKRDNTGLYLSGQQKIGNVTLEASGRGDKDEQFGWHET
FT                   WQTAAGWEFVPDYRVTLSYGTGFLAPSLGQQYGSQRFDIISNSDLKPEESRQWEAGLEG
FT                   VTGPLDWRLSAYHNKIENLIDYSFDNSIFKGHYYNVNSATIKGVEWTGNLTTGIFTHGV
FT                   TLQYIDPRNDLNNEVLARRSKQQAKYQLDWTMFNLDIDISYQYYGKRYDNSTSAYSSTQ
FT                   RELSSYSTVDVSAGYPVTSHLTVRGRIANLFDKEYETAYGYKTAGREYYLTGSYNF"
FT   misc_feature    158959..159264
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 71.2, E-value
FT                   1.4e-18"
FT                   /inference="protein motif:PFAM:PF00593"
FT   misc_feature    159211..159264
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01156"
FT   CDS             159212..160075
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /gene_synonym="dga"
FT                   /gene_synonym="glr"
FT                   /locus_tag="YE0140"
FT                   /product="putative glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10280"
FT                   /db_xref="GOA:A1JI42"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI42"
FT                   /protein_id="CAL10280.1"
FT                   /translation="MAIKPLDESITSREAITSKADTAPRPTALIFDSGVGGLSVYQEIR
FT                   QLLPDLHYIYAFDNVAFPYGEKSGEFIVERVLEIVTAVQQRHPLAIVVIACNTASTVSL
FT                   PALRERFTFPVVGVVPAIKPAVRLTRNGVVGLLATRGTVHASYTQDLIERFATDCKIEL
FT                   LGSSELVELAETKLHGGVVPKEALKKILHPWLAMREPPDTIVLGCTHFPLLTEELAQVL
FT                   PEGTRMVDSGAAIARRTAWLISSQENVISSDEENIAYCMALNADTDALLPVLQGYGFPS
FT                   LEKLPI"
FT   misc_feature    159293..159943
FT                   /note="Pfam match to entry PF01177
FT                   Asp_Glu_race,Asp/Glu/Hydontoin racemase, score 337.7,
FT                   E-value 8.3e-99"
FT                   /inference="protein motif:PFAM:PF01177"
FT   misc_feature    159488..159514
FT                   /note="PS00923 Aspartate and glutamate racemases signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00923"
FT   misc_feature    159821..159853
FT                   /note="PS00924 Aspartate and glutamate racemases signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00924"
FT   rRNA            160552..162040
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT                   /note="match to 16S_rRNA 1..1461 (Y.enterocolitica 16S)"
FT   tRNA            162169..162245
FT                   /gene="tRNA-Ile (GAT)"
FT                   /product="transfer RNA-Ile (GAT)"
FT   tRNA            162320..162395
FT                   /gene="tRNA-Ala (TGC)"
FT                   /product="transfer RNA-Ala (TGC)"
FT   rRNA            162741..165734
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT                   /note="match to 23S_rRNA 1..2994 (Y. enterocolitica 23S
FT                   EMBL:U77925, Y.pestis KIM 98 38dentity, Citrobacter
FT                   freundii 23S EMBL:U77928 94 38dentity)"
FT   rRNA            165734..165970
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT                   /note="match to 5SrRNA 1..240 Y.enterocolitica"
FT   tRNA            166090..166166
FT                   /gene="tRNA-Asp (GTC)"
FT                   /product="transfer RNA-Asp (GTC)"
FT   tRNA            166220..166295
FT                   /gene="tRNA-Trp (CCA)"
FT                   /product="transfer RNA-Trp (CCA)"
FT   CDS             166814..167770
FT                   /transl_table=11
FT                   /locus_tag="YE0141"
FT                   /product="putative periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10281"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI43"
FT                   /protein_id="CAL10281.1"
FT                   /translation="MYRRLLLAAAVTAAMCSAVQAAPLVVGFSQIGSESGWRSAETKVS
FT                   KQEAEKRGITLKIADAQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWTPVLQEAKEAK
FT                   IPVFLLDRMIEVNDPSLYTAAVASDSVYEGKVAGEWLLKDVAGKPCNVVELQGTVGSSV
FT                   AINRKKGFADGIASAPNVKIIRSQSGDFTRSKGKEVMESFIKAEQNGKNICAVYAHNDD
FT                   MAIGAIQAIKEAGLKPGSEIKIVSIDGVPDIFKAMSSGEANATVELTPNMAGPAFDALI
FT                   ALKKDGTQPPKFIQTESRLLQPDTAKQEYESKKSLGY"
FT   sig_peptide     166814..166876
FT                   /locus_tag="YE0141"
FT                   /note="Signal peptide predicted for YE0141 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 21 and 22"
FT   misc_feature    166826..166894
FT                   /note="1 probable transmembrane helix predicted for YE0141
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    166880..167743
FT                   /note="Pfam match to entry PF00532
FT                   Peripla_BP_like,Periplasmic binding proteins and sugar
FT                   binding domain of the LacI family, score 2.7, E-value
FT                   1e-05"
FT                   /inference="protein motif:PFAM:PF00532"
FT   CDS             167855..169345
FT                   /transl_table=11
FT                   /locus_tag="YE0142"
FT                   /product="putative sugar transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10282"
FT                   /db_xref="GOA:A1JI44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI44"
FT                   /protein_id="CAL10282.1"
FT                   /translation="METLLEVRGLSVEFPGVKALDSVDFSLQRGEVVALLGENGAGKST
FT                   LIKALTGVYKRAAGEVYLDSVAICPIDTADAQKMGIGTVYQEVNLLPNISIAANLFIGR
FT                   EPLRWGLIDHRAMNQQATKLLKGYGLELDVQRPLADFSIAIQQIVAIARAVDLSAKVLI
FT                   LDEPTASLDAKEVSMLLDILRQLRDQGIGMVFVTHFLDQVYRISDRITVLRNGKLVGTK
FT                   NTTELPRIELVQMMLGHSFDEQLLKRGEHNIAVSNPLVEFKNYSRRGVVENFDLSVSPG
FT                   EIVGLAGLLGSGRTETAQLIFGVTTPDTGEAKIQGKPVKIRTPRKASRYGFGYCPEDRK
FT                   TDGIVGAATVRENIILALQAQRGWLRPISIREQTQIAEDFIQQLGIRTPGPEQQIQYLS
FT                   GGNQQKVLLARWLATKPRFLILDEPTRGIDVGAHAEIIRLIEKLCNEGLALLIISSELE
FT                   ELAGYADRVIVLRDRRHIAQLGHDEISVPAIMQAIAVQ"
FT   misc_feature    167942..168502
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 196.8, E-value 2.1e-56"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    167963..167986
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    168695..169273
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 101.9, E-value 8.2e-28"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    169046..169090
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             169357..170376
FT                   /transl_table=11
FT                   /locus_tag="YE0143"
FT                   /product="putative sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10283"
FT                   /db_xref="GOA:A1JI45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI45"
FT                   /protein_id="CAL10283.1"
FT                   /translation="MGNRSLSMPQRPRKVKWVLPKGATQFGALIVILLIDSLVAPHFFS
FT                   IHIQDGRLFGSVIDILNRGAPVALLALGMTLVIATGGIDLSVGAVMAIAGATAATLTSA
FT                   GHPFFTVLVAALAVGALCGLWNGFLVAVLQIQPIVATLMLMVAGRGIAQLITEGQIVTF
FT                   DSGGLAELGSSTLMYMPMSVVIAFSMLIIVWLLTRKTALGLFIESVGINLRSARNAGVS
FT                   TRLVLISVYVICGVCAAVAGIIVTADIRGADANNAGLWLELDAILAVVIGGASLMGGRF
FT                   NLLLSVIGALIIQGMNTGILLSGYQPEFNLVLKAIVVLAVLVVQSPMISLSHIFRRRK"
FT   misc_feature    join(169432..169500,169561..169629,169687..169755,
FT                   169768..169836,169879..169947,170029..170097,
FT                   170125..170184,170203..170271,170299..170361)
FT                   /note="9 probable transmembrane helices predicted for
FT                   YE0143 by TMHMM2.0 at aa 26-48, 69-91, 111-133,
FT                   138-160,175-197, 225-247, 257-276, 283-305 and 315-335"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             170376..171344
FT                   /transl_table=11
FT                   /locus_tag="YE0144"
FT                   /product="putative sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10284"
FT                   /db_xref="GOA:A1JI46"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI46"
FT                   /protein_id="CAL10284.1"
FT                   /translation="MLKRNIPLLITIAVFILGYAFCLSQFPSFSSTRVWCDLLTDNAFL
FT                   GIVAVGMTFVILSGGIDLSVGSVIAFTGVLLAKLIGTYGIHPMYAFAIVLVMGAMFGAF
FT                   MGWIIDSLKLPAFIITLAGMFFVRGMSFIVSEESIPIDHPIYSTLANYAWKVPGGGRFT
FT                   LLALIMLLVVAFGILLAHRTRFGHNVYAIGGNSVSAALMGVPVRQTTIKIYMLSSTLAA
FT                   LSGIVFSLYTSAGYALAASGVELDAIAAVVIGGTLLTGGIGTVFGTLFGVLIQGLIQSY
FT                   ITFDGTLSSWWTKIVIGILLFSFIAIQKAMSAFYLNRRARP"
FT   sig_peptide     170376..170465
FT                   /locus_tag="YE0144"
FT                   /note="Signal peptide predicted for YE0144 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.989) with cleavage site
FT                   probability 0.851 between residues 30 and 31"
FT   misc_feature    170466..171329
FT                   /note="Pfam match to entry PF02653
FT                   BPD_transp_2,Branched-chain amino acid transport system /
FT                   permease component, score -43.8, E-value 0.00011"
FT                   /inference="protein motif:PFAM:PF02653"
FT   misc_feature    170946..170993
FT                   /note="PS00012 Phosphopantetheine attachment site."
FT                   /inference="protein motif:Prosite:PS00012"
FT   CDS             complement(171355..172236)
FT                   /transl_table=11
FT                   /locus_tag="YE0145"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0145"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10285"
FT                   /db_xref="GOA:A1JI47"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI47"
FT                   /protein_id="CAL10285.1"
FT                   /translation="MDTELLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLLPYAETLMSTWQLAKKEVAHSLQHTELSIGATASLWEAYL
FT                   TPWLQQLYKQRETLRLEARIALRQSLVKQLHERQLDLLITTEPPKMDELASLLLGHFSL
FT                   RLFSSIPFELPEKTDDGTEHKNANEAPYIKLEWGADFHQQESRLLNSEQMPVLTTTSAH
FT                   LTRQLLDTTGGCAFLPEHWQKEYPELVVNADIPPIVRPLYAVWLQNSDQQTLIRQLLKT
FT                   PMNNAAQSAIRD"
FT   misc_feature    complement(171376..171987)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 56.9, E-value 3e-14"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    complement(172051..172230)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   97.3, E-value 2e-26"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    complement(172096..172188)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(172126..172191)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1285.000, SD 3.56 at aa 16-37, sequence
FT                   RHFGRAAESLYLTQSAVSFRIR"
FT   CDS             172356..172694
FT                   /transl_table=11
FT                   /locus_tag="YE0146"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10286"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI48"
FT                   /protein_id="CAL10286.1"
FT                   /translation="MADSFITTNRFFDNKHYPRGFSRHGDFTIKEAQLLERHGYAFNEL
FT                   DLGKREPVTEEEQLFVAVCRGEREPVSAEEKVWSKYVTRTRRPKRFHTLSGGKPQMDAV
FT                   EDYTDSDD"
FT   CDS             complement(172798..174321)
FT                   /transl_table=11
FT                   /locus_tag="YE0147"
FT                   /product="putative magnesium chelatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10287"
FT                   /db_xref="GOA:A1JI49"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI49"
FT                   /protein_id="CAL10287.1"
FT                   /translation="MSLATIYTRATLGIQAPSVTVEVHISNGLPGLVLVGLPETTVKEA
FT                   RDRVRSALINSGFTFPAKRITVSLAPADLPKEGGRYDLPIALAILAASEQIPADKLAHY
FT                   EFLGELALSGALRRISGAIPAALASSQAQRQLILPSENSLEIGLIAQGNSRVADHLLAV
FT                   CSFLQGENTLAQGQRLEATQDWDNRLDLQDIIGQSQAKRALEIAAAGGHNLLLLGPPGT
FT                   GKTMLANRLTSLLPPLTDQEALEAAAINGLSHSNELPAQWRCRAFRAPHHSASMAALIG
FT                   GGSIPRPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIIISRAAAKVCFPAKVQ
FT                   LIAAMNPSPSGHYQGIHNRAPPQQVLRYLAKLSGPFLDRFDLSIEVPLLPAGMLGTQKH
FT                   QGENSKTVRQRVLQARKKQLDRAGKTNKQLNSQEIAEYCYLVPEDAVFLEQVLLKLGLS
FT                   VRTWHHILKVARTIADLALEDNIQKNHLSEALSYRCMDRLLSQLHKSLM"
FT   misc_feature    complement(172921..172986)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1104.000, SD 2.95 at aa 446-467, sequence
FT                   VFLEQVLLKLGLSVRTWHHILK"
FT   misc_feature    complement(173290..174267)
FT                   /note="Pfam match to entry PF01078 Mg_chelatase, Magnesium
FT                   chelatase, subunit ChlI, score 299.4, E-value 2.8e-87"
FT                   /inference="protein motif:PFAM:PF01078"
FT   misc_feature    complement(173647..173670)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             174892..176538
FT                   /transl_table=11
FT                   /gene="ilvG"
FT                   /locus_tag="YE0148"
FT                   /product="acetolactate synthase isozyme II large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YE0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10288"
FT                   /db_xref="GOA:A1JI50"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI50"
FT                   /protein_id="CAL10288.1"
FT                   /translation="MNGAQWVVQALRAQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAIAAIGYARATGKVGVCIATSGPGATNLITGLADALLDSVPVIAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESLDALPAIMAEAFAIATSGRPGPVLIDIPKDIQL
FT                   AVGELTPHLMPVEEHLIDSAAELQQALDMLATAKKPMLYVGGGVGMAQAVPALREFIDV
FT                   TGIPAVATLKGLGAPDTNHPCYLGMLGMHGTKAANFAVQDCDLLIAVGARFDDRVTGKL
FT                   NTFAAKAKVIHMDIDPAELGKLRQAHVALQGDLKVLLPALQQPLNIQPWRDEVIALKQQ
FT                   HSWRYDHPGQAIYAPLLLKQISDRKAPQTVVTTDVGQHQMWTAQHMNFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQMARPDDMVICVSGDGSFMMNVQELGTIKRKQLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDGRYSETNLSDNPDFITLASAFNIPGQRITRKDQVDAALDALFNSEGP
FT                   YLLQVSIDELENVWPLVPPGAGNETMLEKVS"
FT   misc_feature    174892..175401
FT                   /note="Pfam match to entry PF02776 TPP_enzymes_N, Thiamine
FT                   pyrophosphate enzyme, N-terminal TPP binding domain ,score
FT                   332.6, E-value 3e-97"
FT                   /inference="protein motif:PFAM:PF02776"
FT   misc_feature    175069..175161
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    175435..175896
FT                   /note="Pfam match to entry PF00205 TPP_enzymes, Thiamine
FT                   pyrophosphate enzyme, central domain, score 229.7,E-value
FT                   2.7e-66"
FT                   /inference="protein motif:PFAM:PF00205"
FT   misc_feature    175933..176457
FT                   /note="Pfam match to entry PF02775 TPP_enzymes_C, Thiamine
FT                   pyrophosphate enzyme, C-terminal TPP binding domain ,score
FT                   300.1, E-value 1.7e-87"
FT                   /inference="protein motif:PFAM:PF02775"
FT   misc_feature    176122..176181
FT                   /note="PS00187 Thiamine pyrophosphate enzymes signature."
FT                   /inference="protein motif:Prosite:PS00187"
FT   CDS             176535..176792
FT                   /transl_table=11
FT                   /gene="ilvM"
FT                   /locus_tag="YE0149"
FT                   /product="acetolactate synthase isozyme II small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YE0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10289"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI51"
FT                   /protein_id="CAL10289.1"
FT                   /translation="MIQHQISIQARFRPEMLERVLRVVRHRGFQVCAMNMSPMINAENI
FT                   NIELTVASGRPVDLLSSQLSKLMDVACVEILQPNTLQIRA"
FT   CDS             176815..177741
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="YE0150"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10290"
FT                   /db_xref="GOA:A1JI52"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI52"
FT                   /protein_id="CAL10290.1"
FT                   /translation="MTKKADFIWFNGEMVPWAEAKVHVMSHALHYGTSVFEGVRCYNSH
FT                   KGPVVFRHREHMQRLHDSAKIYRMPVSQSVDELMEACRATLRKNNLTSAYIRPLVFIGD
FT                   VGMGVNPPDGYKTDVIIAAFPWGAYLGAEALEQGIDAMVSSWNRVAPNTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDIHGFLSEGAGENLFEVKDGILFTPPFTSSALPGITR
FT                   DAIIKLAKDMGLEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGKRGPIT
FT                   GKIQQAFFGLFTGETEDKWGWLDPINQ"
FT   misc_feature    176845..177681
FT                   /note="Pfam match to entry PF01063
FT                   aminotran_4,Aminotransferase class IV, score 460.9, E-value
FT                   7e-136"
FT                   /inference="protein motif:PFAM:PF01063"
FT   misc_feature    177391..177480
FT                   /note="PS00770 Aminotransferases class-IV signature."
FT                   /inference="protein motif:Prosite:PS00770"
FT   CDS             177853..179703
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="YE0151"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0151"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10291"
FT                   /db_xref="GOA:A1JI53"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI53"
FT                   /protein_id="CAL10291.1"
FT                   /translation="MPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIEASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLD
FT                   LVDAMIQGANPNVSDADSEQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGNGSLL
FT                   ATHADRKQLFLDAGKHIVELTKRYYEQDDISALPRSIANKAAFENAMTLDIAMGGSTNT
FT                   VLHLLAAAQEGDIDFDISDIDRLSRKVPHLCKVAPSTQKYHMEDVHRAGGVVGILGELD
FT                   RAGLLNREVKNVLGLNLPQTLEAYDVMLTKDEGVKQMYSAGPAGIRTTKAFSQDCRFPS
FT                   LDTDRQEGCIRTREHAYSQDGGLAVLYGNLSENGSIVKTAGVDKDSLTFRGPAKVYESQ
FT                   DDAVAAILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFS
FT                   GGTSGLSIGHASPEAASGGLIALVQDGDIIDIDIPNRAMKLDVSDAELAARREAELARG
FT                   DAAWTPKARERQVSYALRAYALLATSADKGAVRDKSKLGG"
FT   misc_feature    177952..179682
FT                   /note="Pfam match to entry PF00920 ILVD_EDD, Dehydratase
FT                   family, score 1247.3, E-value 0"
FT                   /inference="protein motif:PFAM:PF00920"
FT   misc_feature    178216..178248
FT                   /note="PS00886 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 1."
FT                   /inference="protein motif:Prosite:PS00886"
FT   misc_feature    178288..178311
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    179377..179412
FT                   /note="PS00887 Dihydroxy-acid and 6-phosphogluconate
FT                   dehydratases signature 2."
FT                   /inference="protein motif:Prosite:PS00887"
FT   CDS             179709..181253
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="YE0152"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10292"
FT                   /db_xref="GOA:A1JI54"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI54"
FT                   /protein_id="CAL10292.1"
FT                   /translation="MAVSQPLSTAPDGAEYLRAILRAPVYEVAQVTPLQVMEKISSRLD
FT                   NTILVKREDRQPVHSFKLRGAYAMLAGLTAEQKACGVITASAGNHAQGVALSANKLGIK
FT                   ALIVMPVATADIKVDAVRGFGGEVLLFGANFDEAKGKAIELSQLQGYTFVPPFDHPAVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSACLRA
FT                   ALDAGKPVDLARVGLFAEGVAVKRIGDEPFRLCQEYLDEVISVDSDAICAAVKDLFEDV
FT                   RAIAEPSGALALAGLKKYVQQHNIQGERLAHVLSGANVNFHGLRYVSERCELGEQREAL
FT                   LAVTIPEQKGSFLRFCELLGGRSVTEFNYRYADADNACIFVGVRLTRGYAERAEILAEL
FT                   QGKGYQVVDLSDDEMAKLHVRYMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHW
FT                   NISLFHYRSHGTDFGRVLAGFELSDSEPQFEQHLTALGYDCHDETNNPAFKFFLAG"
FT   misc_feature    179781..180659
FT                   /note="Pfam match to entry PF00291 PALP,Pyridoxal-phosphate
FT                   dependent enzyme, score 318.7,E-value 4.4e-93"
FT                   /inference="protein motif:PFAM:PF00291"
FT   misc_feature    179865..179906
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   misc_feature    180693..180965
FT                   /note="Pfam match to entry PF00585
FT                   Thr_dehydrat_C,C-terminal regulatory domain of Threonine
FT                   dehydratase ,score 159.3, E-value 4.3e-45"
FT                   /inference="protein motif:PFAM:PF00585"
FT   misc_feature    180978..181244
FT                   /note="Pfam match to entry PF00585
FT                   Thr_dehydrat_C,C-terminal regulatory domain of Threonine
FT                   dehydratase ,score 151.2, E-value 1.2e-42"
FT                   /inference="protein motif:PFAM:PF00585"
FT   CDS             181439..182935
FT                   /transl_table=11
FT                   /locus_tag="YE0153"
FT                   /product="putative membrane protein"
FT                   /note="Similar in parts to many including: Plasmodium
FT                   falciparum putative replication A protein Mal4p2.32
FT                   SWALL:Q9U0J0 (EMBL:AL035475) (1145 aa) fasta scores: E():
FT                   0.55, 19.25 38d in 483 aa and Mycoplasma pulmonis
FT                   hypothetical protein Mypu_4790 SWALL:Q98Q87 (EMBL:AL445564)
FT                   (804 aa) fasta scores: E(): 2, 22.8 38d in 307 aa. Note the
FT                   abundance of Asn residues in the predicted product of this
FT                   CDS."
FT                   /db_xref="EnsemblGenomes-Gn:YE0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10293"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI55"
FT                   /inference="similar to sequence:INSDC:AL035475"
FT                   /inference="similar to sequence:INSDC:AL445564"
FT                   /protein_id="CAL10293.1"
FT                   /translation="MMSLLILSYWITLFLELSNLIITYWSLYMSELITLNFKSTSTYLD
FT                   WNATSIGARYQYHADGTRFNGGVSYSVQKINQAIEGDSNYYRRFDQMQATIDQGSVSKE
FT                   GGAGNEIYFIENKANNSAAVSYFKYGLDNKLNESQSFNYQSNILTSRTKIMPNSIGQIT
FT                   KSQKFNIHDKLVESNVFSYKKDRIGNDLIIIQKEKYSGNEVVSTTHKELYDSSGKIIKI
FT                   DVYDKNDKQLERNEFSYFNNGNKCRTVKSTFNISGNLNHQEKIIYNKNGDLRAMVQSNY
FT                   DNGQSLKDSKSTYYINGEVDRVVEVEYSADGKVIVGRIEKAYNITNAILIKETESSYSM
FT                   DGKIIIGRINKEYSALDGRLEKITRSNRSDSGQLKREVESYLDINGQESKRISQYYSNG
FT                   VTKCFERSFSAGKMTGKVYMEFDNNGNAINIKRLNPEGKMVDVLINASLDTFFKGVTQL
FT                   ADAINSFPTREQAPAAVDTIIGSHANLRNLVPVMNYASRQ"
FT   misc_feature    181457..181525
FT                   /note="1 probable transmembrane helix predicted for YE0153
FT                   by TMHMM2.0 at aa 7-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(182937..183818)
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="YE0154"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10294"
FT                   /db_xref="GOA:A1JI56"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI56"
FT                   /protein_id="CAL10294.1"
FT                   /translation="MDLRDLKLFLHLAESRHFGRSAKAMHVSPSTLSRQIQRLEETIGQ
FT                   PLFLRDNRTVQLTDAGTQLKAFAQQTLLQYQQLRHALGQHGPSLSGELRLFCSVTAAYS
FT                   HLPPILDRFRARHPLVEIKLTTGDAADAVDKVQSNEADLGIAGRPEVLPTSVAFTQIGE
FT                   IPLVLIAPALPCAVRSQVSVDQPDWATIPFILPEHGPSRKRIDLWFRRQRITNPLIYAT
FT                   VSGHEAIVSMVALGCGVALIPSVVVDNSPEPVRNRISLLDDVSLVEPFELGVCVQKKRL
FT                   NEPLIEAFWGLL"
FT   misc_feature    complement(182940..183563)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 118.2, E-value 9.9e-33"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    complement(183633..183812)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   97.4, E-value 1.8e-26"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    complement(183678..183770)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(183708..183773)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1928.000, SD 5.75 at aa 16-37, sequence
FT                   RHFGRSAKAMHVSPSTLSRQIQ"
FT   CDS             184071..185549
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="YE0155"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10295"
FT                   /db_xref="GOA:A1JI57"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI57"
FT                   /protein_id="CAL10295.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSAVVQAVQPLMKDGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLCFDKLVSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAYALSEQLKEIMAPLFQKHMDDIISGEFSSGMMADWANDDKKLLNWREETGKTAFE
FT                   NAPQFEGKISEQEYFDHGVLMIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKGKFMDSLQAGDLGKSVAGTAVDNAQ
FT                   LRDVNEAIRNHPIEAVGHKLRGYMTDMKRIAVAG"
FT   misc_feature    184698..185528
FT                   /note="Pfam match to entry PF01450 IlvC, Acetohydroxy acid
FT                   isomeroreductase, catalytic domain, score 463.0, E-value
FT                   1.6e-136"
FT                   /inference="protein motif:PFAM:PF01450"
FT   CDS             complement(185847..186524)
FT                   /transl_table=11
FT                   /locus_tag="YE0157"
FT                   /product="putative chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10296"
FT                   /db_xref="GOA:A1JI58"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI58"
FT                   /protein_id="CAL10296.1"
FT                   /translation="MACSVPAMASVVAEKTRIIFSEGSTEESLQLVNSNDYPVAVQVWV
FT                   DDGDLMATPEKAISPVLVLPPLFRLQPQAQRSLRLILSGASKLPLDRESAFWLNVYEIP
FT                   PKATTKVDDESSVTLALRMQYKVFYRPKSLPAPADTVSKALTFVLERNGNTASVRVDNP
FT                   TPYYASLASLTLGLAEGLPDMVAPFSKLDFPLNRVPIADSKTVNFVLIDDLGNRKPFSR
FT                   ELK"
FT   misc_feature    complement(185859..186110)
FT                   /note="Pfam match to entry PF02753
FT                   pili_assembly_C,Gram-negative pili assembly chaperone,
FT                   C-terminal domain ,score 28.6, E-value 9.5e-06"
FT                   /inference="protein motif:PFAM:PF02753"
FT   misc_feature    complement(186120..186497)
FT                   /note="Pfam match to entry PF00345
FT                   pili_assembly,Gram-negative pili assembly chaperone,
FT                   N-terminal domain ,score 141.8, E-value 8.2e-40"
FT                   /inference="protein motif:PFAM:PF00345"
FT   misc_feature    complement(186210..186263)
FT                   /note="PS00635 Gram-negative pili assembly chaperone
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00635"
FT   CDS             complement(186571..187938)
FT                   /transl_table=11
FT                   /locus_tag="YE0158"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10297"
FT                   /db_xref="GOA:A1JI59"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI59"
FT                   /protein_id="CAL10297.1"
FT                   /translation="MLRPTEQLISCEVSRPTMPVHCRRSYIVAGTMLLIGLFSTSAWSA
FT                   CTRITAQSQLGAGDGTASAWSGSLDYNNGSLGLPGVIDLSTAANFQPDGTLLAAATSDF
FT                   TTFALNTSYDPDRVLFRCAAADVDQLFEMYATNGDNDYGGKNEDGAIAGNVPSGFATYV
FT                   RNVVIRLTNLSTGEYYSRLWKGRRLTGLDTDSTGRILVKAKNFSNLYTELFRIDYVRAG
FT                   TNNAASYTYAYTQPNAYIAFKGPGISGPVEGTDSVSNWPGWYSTWPASIGLYNYVTFRR
FT                   TTICAVTNFTPTVILPRISVAELNSGSSSSAEFSVDFQCQTGITSGVNAGAVAMGFLVP
FT                   AANAAKAQALGLMNGSGGISHLVSDNYGAAGMANGVGIRIYRNNNPMYLLSKNVTQTGN
FT                   NGGWYGIFQGAQTITGTVSGGNSYTENFRAELSKISGQTVTAGAVNAHAQVVIRVQ"
FT   misc_feature    complement(187801..187833)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(187956..190175)
FT                   /transl_table=11
FT                   /locus_tag="YE0159"
FT                   /product="putative outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10298"
FT                   /db_xref="GOA:A1JI60"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI60"
FT                   /protein_id="CAL10298.1"
FT                   /translation="MAERVKGASFHFDQAKLRLELSIPQALLQQRPRGYIERSEWEEGE
FT                   KLAFVNYSANFYRSDTQTQQNSTSDYGFVGLKSGLNLGLWQLRQQSNLSYSSNNNSSDT
FT                   QWNNIRTYVQRPISQLDSELTLGETFTDSTLFGTMSFRGVKMATDQRMWPESMRGFAPE
FT                   VRGVATSNARVIISQNGREIYETNVAPGPFVINDLYSTTSQGDLNVEVIEANGSRSTFT
FT                   VPFSAVPDSMRPGVSRYNAVVGESRDFTNIDSYFTDFTYERGLTNQLTANSGIRLAQDY
FT                   TALLVGGVIGTSVGAFGLNTTYSHAKVEDNQTQDGWRMQATYSQTFNETGTSFSLAGYR
FT                   YSTKGYRDLNDVFGVRSVQKNGGTWDSSTYKQRSQFTTTINQTLAGYGQLSASASTSDY
FT                   YNDTQRDTQLQLNYSNSYKDISYNVALSRQRTIYTSTQFGWDADDTDETMTTTRYGNTE
FT                   NIASLTVSIPLNIGSGNQYLSMSANRNPKSGNNYQTSLSGTAGERNTLNYSVNAGYDDS
FT                   NVSGSSNNWGANVQKQFPNATVNGSYSRGNNYTQYGAGARGAAVIHSKGVTLGPYLGDT
FT                   FGLIEADGAQGATVRNAQGARIDKNGFALVPSLTPYNYNTVGLDTKGINRNTELKENQG
FT                   RVVPYAGAAVRVKFETLTGYAVLIQTQTADGEGLPLGSDVYNNKDELVGMVGQGNQIYA
FT                   RVKENKGSLYVRWGENSNEQCELPYDFASQDTEQDIIHLTGSCRR"
FT   misc_feature    complement(188010..190172)
FT                   /note="Pfam match to entry PF00577 Usher, Fimbrial Usher
FT                   protein, score 734.3, E-value 3.4e-218"
FT                   /inference="protein motif:PFAM:PF00577"
FT   misc_feature    complement(189582..189614)
FT                   /note="PS01151 Fimbrial biogenesis outer membrane usher
FT                   protein signature."
FT                   /inference="protein motif:Prosite:PS01151"
FT   CDS             complement(190653..191330)
FT                   /transl_table=11
FT                   /locus_tag="YE0160"
FT                   /product="putative fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YE0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10299"
FT                   /db_xref="GOA:A1JI61"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI61"
FT                   /protein_id="CAL10299.1"
FT                   /translation="MGISFANASVVMSGSRIIYSAGEKEHSIQLTNNDNFPNAVQVWLD
FT                   SGDTQSTPETGKAPFIVTPPFFRIEANAGQTLRLKYTGSGLPTDRESVFYLNFLQVPPV
FT                   NKAEKNNKMLVLMRNRIKVFYRPENIAGRVDQVSSALTFNVRQQGKDVVVTGKNPTGFY
FT                   ATIASGEVVGGGKKLKMKSEMIPPMSQAQWVIPNSSVPSNAIVNFLLVNDFGGQDTGSY
FT                   KIQ"
FT   misc_feature    complement(190665..190928)
FT                   /note="Pfam match to entry PF02753
FT                   pili_assembly_C,Gram-negative pili assembly chaperone,
FT                   C-terminal domain ,score 33.8, E-value 2.6e-07"
FT                   /inference="protein motif:PFAM:PF02753"
FT   misc_feature    complement(190938..191306)
FT                   /note="Pfam match to entry PF00345
FT                   pili_assembly,Gram-negative pili assembly chaperone,
FT                   N-terminal domain ,score 179.4, E-value 3.7e-51"
FT                   /inference="protein motif:PFAM:PF00345"
FT   CDS             complement(191517..192047)
FT                   /transl_table=11
FT                   /locus_tag="YE0161"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10300"
FT                   /db_xref="GOA:A1JI62"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI62"
FT                   /protein_id="CAL10300.1"
FT                   /translation="MNKITLAMALFAASTTVAMAASNNTITFQGEVTAQTCSVTVNGLD
FT                   ANPMVLLPTVSSGDLDASGKTAGKTTFTLGVSGCATGAADIDIKTVFVGNQVTTAGNLK
FT                   NTGTASNVDLQLLKDATTTTGIDLNSSVGQDGIVLKAGDTSAEHDFAVQYFATGQAGPG
FT                   SVIASVQYAVSYL"
FT   misc_feature    complement(191520..191978)
FT                   /note="Pfam match to entry PF00419 Fimbrial, Fimbrial
FT                   protein, score 26.4, E-value 3.4e-08"
FT                   /inference="protein motif:PFAM:PF00419"
FT   sig_peptide     complement(191988..192047)
FT                   /locus_tag="YE0161"
FT                   /note="Signal peptide predicted for YE0161 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.991 between residues 20 and 21"
FT   CDS             complement(192664..192945)
FT                   /transl_table=11
FT                   /gene="ppiC"
FT                   /locus_tag="YE0162"
FT                   /product="peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:YE0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10301"
FT                   /db_xref="GOA:A1JI63"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI63"
FT                   /protein_id="CAL10301.1"
FT                   /translation="MANKASALHILVDDEKQANDILAQLNNGANFQELAKKFSNCPSKR
FT                   NGGDLGEFNKGDMVPAFDKAVFSCELLQPYGPVKTQFGYHIIKVLYRN"
FT   misc_feature    complement(192673..192942)
FT                   /note="Pfam match to entry PF00639 Rotamase, PPIC-type
FT                   PPIASE domain, score 132.4, E-value 5.3e-37"
FT                   /inference="protein motif:PFAM:PF00639"
FT   CDS             193159..195183
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="YE0163"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:YE0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10302"
FT                   /db_xref="GOA:A1JI64"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI64"
FT                   /protein_id="CAL10302.1"
FT                   /translation="MRLNPSQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRQCGY
FT                   QPKHIAAVTFTNKAAREMKERVAQTLGRKEARGLMIATFHTLGLEIIKKEYKALGMKSN
FT                   FSLFDAQDQLGLLKDLTHKWLEDDKTLLQQLISQISNWKNDLLDPAAAAALARSERDKL
FT                   FVHCYGLYDAHLKACNVLDFDDLISLPTLLLQKDLEVRERWQNRLRYLLVDEYQDTNTS
FT                   QYQMVKLLVGSRARFTVVGDDDQSIYSWRGARPQNLVLLNEDFPQLQVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKKLFSELEYGDELKVITANNEDHEAERVVGELIAHHFVKKT
FT                   QYSDYAILYRGNHQSRLFEKLLMQNRIPYRISGGDSFFSRPEIKDLLAYLRVLTNQDDD
FT                   SAFLRIVNTPKREIGSATIQKLGEWANVRNKSLFRASFDLGLGEHLKGRGLESLQRFTH
FT                   WMEGIIRLVEREPIAAVRDLIHGIDYESWLFETSPSPKAAEMRMKNVNLLFSWMTEMLE
FT                   GSELNEPMTLTQVVTRFTLRDMMERGESDEELDQVQLMTLHASKGLEFPYVFLVGMEEG
FT                   LLPHQSSIDEDNVDEERRLAYVGITRAQRELFFTLCKERRQYGELIRPEPSRFLMELPQ
FT                   DDLKWENERKAVSPEERMQKGQSHLANIRAQLANAKKPQ"
FT   misc_feature    193165..194610
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 718.8, E-value 1.6e-213"
FT                   /inference="protein motif:PFAM:PF00580"
FT   misc_feature    193222..193245
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(195239..197065)
FT                   /transl_table=11
FT                   /gene="pehX"
FT                   /locus_tag="YE0164"
FT                   /product="exo-poly-alpha-D-galacturonosidase precursor"
FT                   /EC_number="3.2.1.82"
FT                   /note="Highly similar to the plant pathogenic Erwinia
FT                   chrysanthemi exo-poly-alpha-D-galacturonosidase PehX
FT                   SWALL:PEHX_ERWCH (SWALL:P15922) (602 aa) fasta scores: E():
FT                   3.6e-145, 61.23 38d in 601 aa. This CDS was previously
FT                   sequenced as: Yersinia enterocolitica exopolygalacturonase
FT                   SWALL:O68975 (EMBL:AF059505) (601 aa) fasta scores: E(): 0,
FT                   98.83 38d in 600 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10303"
FT                   /db_xref="GOA:A1JI65"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI65"
FT                   /inference="similar to sequence:INSDC:AF059505"
FT                   /inference="similar to sequence:UniProtKB:P15922"
FT                   /protein_id="CAL10303.1"
FT                   /translation="MQAQLQRPRTTGMLVIMASLMVGTPMAMAAKSSSLDAPQQLQVPT
FT                   LAYDESSIVLVWKAPEDTRKIVDYQIFSAGKLLGKASDNNDKFSPAKPYIDHFYVNDKD
FT                   NFQHKIVMQNFTVIGLKPETSYQFTVKAQYADGSLSVASKPITAKTSAKPQIVNVRDFG
FT                   AIDDGKTLNTKAIQQAIDSCKPGCRVEIPAGTYKSGALWLKSDMTLNLQAGAILLGSEN
FT                   PNDYPAGYRLYPYSTIERPASLINAIDPNNSKPGTFRNIRITGSGVIDGNGWLRAKTAE
FT                   ITDELGRSLPQYVASKNSKVHEDGILAKNQVEKAVSDGMDLKNAYGQRRSSLMTLRGVE
FT                   NVYLAGFTVRNPAFHGIMNLENHNVVANGLIHQTYDANNGDGIEFGNSQNVMVFNNFFD
FT                   TGDDCINFAAGTGEKAQEQEPMKGAWLFNNYFRMGHGAIVTGSHTGAWIEDILAENNVM
FT                   YLTDIGLRAKSTSTIGGGARNVTFRNNAMRDLAKQVMVMTLDYADSNANIDYPPAKIPA
FT                   QFYDFTLKNVTVDNSTGKNPSIEIKGDTANKAWHRLVHVNNVQLNNVTPTAISDLRDSE
FT                   FNKVTFTELRGDTPWHFSEVKNVKVDGKPVAP"
FT   misc_feature    complement(195356..196519)
FT                   /note="Pfam match to entry PF00295
FT                   Glyco_hydro_28,Polygalacturonase (pectinase), score -27.9,
FT                   E-value 7.2e-09"
FT                   /inference="protein motif:PFAM:PF00295"
FT   misc_feature    complement(196556..196579)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(196637..196963)
FT                   /note="Pfam match to entry PF00041 fn3, Fibronectin type
FT                   III domain, score 28.4, E-value 1.1e-05"
FT                   /inference="protein motif:PFAM:PF00041"
FT   misc_feature    complement(196979..197032)
FT                   /note="1 probable transmembrane helix predicted for YE0164
FT                   by TMHMM2.0 at aa 12-29"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(196979..197065)
FT                   /gene="pehX"
FT                   /locus_tag="YE0164"
FT                   /note="Signal peptide predicted for YE0164 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.985 between residues 29 and 30"
FT   CDS             complement(197407..198903)
FT                   /transl_table=11
FT                   /gene="gppA"
FT                   /locus_tag="YE0165"
FT                   /product="guanosine-5'-triphosphate,3'-diphosphate
FT                   pyrophosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:YE0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10304"
FT                   /db_xref="GOA:A1JI66"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI66"
FT                   /protein_id="CAL10304.1"
FT                   /translation="MMLSSTSLYAAIDLGSNSFHMLVVREVAGSIQTLARIKRKVRLAA
FT                   GLDTQNHLSQEAMERGWQCLKLFSERLQDIPLDQIRVVATATLRLASNAEEFLQTATEI
FT                   LGCPIQVISGEEEARLIYHGVAHTTGGPEQRLVVDIGGGSTELVTGNGAQANILVSLPM
FT                   GCVTWLERYFSDRNLAKDNFDRSESAAREMLKPVAQRFREHGWQICVGASGTVQALQEI
FT                   MVAQGMDELITLAKLQQLKQRAIQCGKLEELEIPGLTLERALVFPSGLSILIAIFQELA
FT                   IESMTLAGGALREGLVYGMLHLPVEQDIRSRTVRNIQRRYLLDTEQAKRVSKLADNFLL
FT                   QVEKEWRLDSRCRELLQNACLIHEIGLSIDFKRAPQHAAYLIRNLDLPGFTPAQKLLLA
FT                   ALLQNQSDTLDLSLLNQQNALPVDMAQHLCRLLRLAIIFSSRRRDDTLPAVRLRANGET
FT                   LYVLLPHGWLQQHPYRAEALEQESHWQSYVQWPLLLEEFN"
FT   misc_feature    complement(197992..198840)
FT                   /note="Pfam match to entry PF02541 Ppx-GppA, Ppx/GppA
FT                   phosphatase family, score 427.6, E-value 7.2e-126"
FT                   /inference="protein motif:PFAM:PF02541"
FT   CDS             complement(198907..199983)
FT                   /transl_table=11
FT                   /gene="rhlB"
FT                   /gene_synonym="mmrA"
FT                   /locus_tag="YE0166"
FT                   /product="putative DEAD-box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10305"
FT                   /db_xref="GOA:A1JI67"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI67"
FT                   /protein_id="CAL10305.1"
FT                   /translation="MLSHPAEEGRQTNQPRALIMAPTRELAVQIHSDAESLSQVTGLKL
FT                   GLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQVVVLDEADRMYDLG
FT                   FIKDIRWLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEYVEVEPLQKTGHRIQE
FT                   ELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQ
FT                   KKRLRILEDFTKGDLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDYVHRIGRTGRAG
FT                   ESGHSISLACEEYALNLPAIETYTGHSIPVSKYNSDALLTDLPAPKRLARTRTGNGPRR
FT                   NSAPRRSGAPRNNRKRPS"
FT   misc_feature    complement(199141..199356)
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 116.3, E-value 3.7e-32"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    complement(199492..199983)
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 94.6, E-value 1.3e-25"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    complement(199681..199707)
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00039"
FT   CDS             200312..200638
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /gene_synonym="tsnC"
FT                   /gene_synonym="fipA"
FT                   /locus_tag="YE0167"
FT                   /product="thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:YE0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10306"
FT                   /db_xref="GOA:A1JI68"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI68"
FT                   /protein_id="CAL10306.1"
FT                   /translation="MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDE
FT                   IAEEYEGRLTITKLNIDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKEFL
FT                   DANL"
FT   misc_feature    200315..200635
FT                   /note="Pfam match to entry PF00085 thiored, Thioredoxin
FT                   ,score 168.2, E-value 8.7e-48"
FT                   /inference="protein motif:PFAM:PF00085"
FT   misc_feature    200384..200440
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   CDS             201295..202554
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /gene_synonym="nitA"
FT                   /gene_synonym="psuA"
FT                   /gene_synonym="rnsC"
FT                   /gene_synonym="tsu"
FT                   /gene_synonym="sbaA"
FT                   /locus_tag="YE0168"
FT                   /product="transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10307"
FT                   /db_xref="GOA:A1JI69"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI69"
FT                   /protein_id="CAL10307.1"
FT                   /translation="MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVIASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDFNRSGTRKEELLTTTEELQKMWILRRILHPMGEIDAMEFL
FT                   ISKLATAKTNDQFFDNMRRS"
FT   misc_feature    201523..202407
FT                   /note="Pfam match to entry PF00006 ATP-synt_ab, ATP
FT                   synthase alpha/beta family, nucleotide-binding domain
FT                   ,score 290.0, E-value 1.9e-84"
FT                   /inference="protein motif:PFAM:PF00006"
FT   misc_feature    201724..201798
FT                   /note="PS00464 Ribosomal protein L22 signature."
FT                   /inference="protein motif:Prosite:PS00464"
FT   misc_feature    201826..201849
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             202836..203933
FT                   /transl_table=11
FT                   /gene="rfe"
FT                   /gene_synonym="b3784"
FT                   /locus_tag="YE0169"
FT                   /product="putative undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10308"
FT                   /db_xref="GOA:A1JI70"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI70"
FT                   /protein_id="CAL10308.1"
FT                   /translation="MNLLTMSTEIFVIFMFSLAFLFVARKVAKKIGLVDKPNYRKRHQG
FT                   LIPLVGGISVFAGICFTFLITNQHIPHFRLYLGCAGLLVFVGALDDRFDISVKIRAFVQ
FT                   ALVGIAMMAVAGLYLRSLGHAFGPWEMILGPFGYVVTLFAVWAAINAFNMVDGIDGLLG
FT                   GLSCVSFGAMGILLYQSGQMALALWCFAMIAAILPYILLNLGLLGRRYKVFMGDAGSTL
FT                   IGFTAIWILLQTTQGNAHPINPVTALWIIAIPLMDMIAIMYRRLRKGMSPFSPDRQHIH
FT                   HLIMRAGFTSRQAFVLITLAAALLAAVGVIGERLTFVPEWVMLALFLLAFILYGYCIKR
FT                   AWRVARFIKRTKRRMRRASQNKHES"
FT   misc_feature    join(202848..202907,202968..203036,203049..203102,
FT                   203139..203198,203226..203294,203313..203372,
FT                   203385..203453,203472..203540,203568..203624,
FT                   203715..203768,203796..203849)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0169 by TMHMM2.0 at aa 5-24, 45-67, 72-89,
FT                   102-121,131-153, 160-179, 184-206, 213-235, 245-263,
FT                   294-311 and 321-338"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    203052..203543
FT                   /note="Pfam match to entry PF00953 Glycos_transf_4,Glycosyl
FT                   transferase, score 20.2, E-value 9.7e-08"
FT                   /inference="protein motif:PFAM:PF00953"
FT   CDS             203969..205030
FT                   /transl_table=11
FT                   /gene="wzzE"
FT                   /gene_synonym="wzz"
FT                   /gene_synonym="b3785"
FT                   /locus_tag="YE0170"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10309"
FT                   /db_xref="GOA:A1JI71"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI71"
FT                   /protein_id="CAL10309.1"
FT                   /translation="MSTDKTGSTHNEPSVDNELDIRSLCRTLWRGKVWIIGMAILFAAI
FT                   ALGVSYLVKQQWSATAITDRPTVNNLGGYYSQQQFLRNLDNRINSAASSEQPGISDEAY
FT                   GEFITQLAAYDTRRDFWLQTDYYKQRVEGDAKADAALLDELVNNIVFTPRDDKKMLNDS
FT                   IKLTAETASDSNKLLRSYIDFASQRAASHLNDEIEGAWAARTQSMKAQVKRQEAVAKAV
FT                   FDREVTAVTQALKVASQQGINRNQTDTPAEQLPDSKMFMLGKPMLEARLETLQATGPSF
FT                   DIDYDQNRAMLATLNVGPTLDKTFQTYRYLRTPEDPVTRDSPRRVFLLIMWGAIGALVG
FT                   AGVVLVRRTSRTE"
FT   misc_feature    204017..204520
FT                   /note="Pfam match to entry PF02706 wzz, Chain length
FT                   determinant protein, score 45.5, E-value 7.8e-11"
FT                   /inference="protein motif:PFAM:PF02706"
FT   misc_feature    join(204059..204127,204947..205006)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0170 by TMHMM2.0 at aa 31-53 and 327-346"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             205110..206240
FT                   /transl_table=11
FT                   /gene="rffE"
FT                   /gene_synonym="wecB"
FT                   /gene_synonym="nfrC"
FT                   /locus_tag="YE0171"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10310"
FT                   /db_xref="GOA:A1JI72"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI72"
FT                   /protein_id="CAL10310.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPLVHALAQDEAFESRVCVTAQHREMLDQ
FT                   VLRLFEIQPDYDLNIMKPGQGLTEITCRILEGLKPVLAEFKPDVILVHGDTTTTLSTSL
FT                   AAFYHRIPVGHVEAGLRTGNLYSPWPEEANRQLTGHLAMYHFAPTENSRQNLLREMVPD
FT                   NRIFVTGNTVIDALFWVRDRVMNNPQLRASLAERYPFIDTNKKMILVTGHRRESFGGGF
FT                   ERICSALAEIALKHPEVQVVYPVHLNPNVSEPVNRILKGIDNIILIDPQDYLPFVYLMN
FT                   HAYLILTDSGGIQEEAPSLGKPVLVMRDTTERPEAVDSGTVLLVGTNINKIVDAVTRLL
FT                   TDETAYHQMTRAHNPYGDGHACQRILEALKNHQVTL"
FT   misc_feature    205233..206219
FT                   /note="Pfam match to entry PF02350
FT                   Epimerase_2,UDP-N-acetylglucosamine 2-epimerase, score
FT                   723.5, E-value 6e-215"
FT                   /inference="protein motif:PFAM:PF02350"
FT   CDS             206237..207499
FT                   /transl_table=11
FT                   /gene="rffD"
FT                   /gene_synonym="wecC"
FT                   /gene_synonym="b3787"
FT                   /locus_tag="YE0172"
FT                   /product="putative UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10311"
FT                   /db_xref="GOA:A1JI73"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI73"
FT                   /protein_id="CAL10311.1"
FT                   /translation="MSFETISVIGLGYIGLPTAAAFASRKKKVIGVDVNAHAVETINRG
FT                   AIHIVEPDLDKVVKIAVEGGYLQAVTKPLAADAFLIAVPTPFKGDHEPDMVYVESAAKS
FT                   IAPVLKKGDLVILESTSPVGATEQMAQWLAEARPDLSFPQNVGEEADINIAYCPERVLP
FT                   GQVMVELIQNDRVIGGMTPKCSARASELYKIFLEGECVVTNSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICDEQGINVWELIRLANRHPRVNILQPGPGVGGHCIAVDPWFIVSQNPQL
FT                   ARLIHTARLVNDGKPLWVVDRVKAAVADCLAATDKRASEVKIACFGLAFKPNIDDLRES
FT                   PAVEIAHLIAQWHTGETLVVEPNVEQLPKSLVGHVTLKDTATALQQADVLVMLVDHSQF
FT                   KAIKPEDVKQSWIVDTKGVWR"
FT   sig_peptide     206237..206305
FT                   /gene="rffD"
FT                   /gene_synonym="b3787"
FT                   /gene_synonym="wecC"
FT                   /locus_tag="YE0172"
FT                   /note="Signal peptide predicted for YE0172 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.673) with cleavage site
FT                   probability 0.576 between residues 23 and 24"
FT   misc_feature    206246..206827
FT                   /note="Pfam match to entry PF03721
FT                   UDPG_MGDP_dh_N,UDP-glucose/GDP-mannose dehydrogenase
FT                   family, NAD binding domain, score 299.1, E-value 3.6e-87"
FT                   /inference="protein motif:PFAM:PF03721"
FT   misc_feature    206849..207127
FT                   /note="Pfam match to entry PF00984
FT                   UDPG_MGDP_dh,UDP-glucose/GDP-mannose dehydrogenase family,
FT                   central domain, score 153.9, E-value 1.9e-43"
FT                   /inference="protein motif:PFAM:PF00984"
FT   misc_feature    207206..207481
FT                   /note="Pfam match to entry PF03720
FT                   UDPG_MGDP_dh_C,UDP-glucose/GDP-mannose dehydrogenase
FT                   family, UDP binding domain, score 91.3, E-value 1.2e-24"
FT                   /inference="protein motif:PFAM:PF03720"
FT   CDS             207496..208563
FT                   /transl_table=11
FT                   /gene="rffG"
FT                   /locus_tag="YE0173"
FT                   /product="dTDP-D-glucose-4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10312"
FT                   /db_xref="GOA:A1JI74"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI74"
FT                   /protein_id="CAL10312.1"
FT                   /translation="MRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLA
FT                   VVAHSERYAFEQVDICDRAELDRVFAQYQPDVVMHLAAESHVDRSIDGPAAFIETNVVG
FT                   TYQMLEAARHYWQPLDAKKKLAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSAS
FT                   KASSDHLVRAWLRTYGLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQ
FT                   VRDWLFVEDHARALYQVVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPEKPAGI
FT                   ARYRDLITFVKDRPGHDMRYAIDASKIERELGWRPQETFESGIRKTVLWYLNNKSWWQR
FT                   VQDGSYAGERLGLGD"
FT   misc_feature    207505..208500
FT                   /note="Pfam match to entry PF01370 Epimerase, NAD dependent
FT                   epimerase/dehydratase family, score 720.1,E-value 6.4e-214"
FT                   /inference="protein motif:PFAM:PF01370"
FT   CDS             208794..209675
FT                   /transl_table=11
FT                   /gene="rffH"
FT                   /locus_tag="YE0174"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10313"
FT                   /db_xref="GOA:A1JI75"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI75"
FT                   /protein_id="CAL10313.1"
FT                   /translation="MKGIILAGGSGTRLHPITRGVSKQLLPVYDKPMIYYPLSVLMLAG
FT                   IRDILIISTPEDLPSFQRLLGNGDEFGINLSYAAQPSPDGLAQAFIIGEEFIGNEPCCL
FT                   VLGDNIYFGQGFSPKLKAVAAREHGATVFGYQVMDPERFGVVEFDDDFRALSIEEKPTQ
FT                   PKSNWAVTGLYFYDNQVVDFAKKVKPSSRGELEITSINQMYLDRGELTVELLGRGFAWL
FT                   DTGTHDSLIEASTFVQTVEKRQGFKIACLEEISWRNGWLDDDGVRRAATALAKTGYGKY
FT                   LLDLLHARPRQY"
FT   misc_feature    208797..209513
FT                   /note="Pfam match to entry PF00483
FT                   NTP_transferase,Nucleotidyl transferase, score 390.3,
FT                   E-value 1.2e-114"
FT                   /inference="protein motif:PFAM:PF00483"
FT   CDS             209764..210390
FT                   /transl_table=11
FT                   /gene="rffC"
FT                   /gene_synonym="wecD"
FT                   /gene_synonym="b3790"
FT                   /locus_tag="YE0175"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10314"
FT                   /db_xref="GOA:A1JI76"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI76"
FT                   /protein_id="CAL10314.1"
FT                   /translation="MDAFTLTQAKVPTHRLDLIDSLGQLGFKLVEGEVDLVLLVEEKDR
FT                   VGTENASSAIDTGTYQQRLATTADIPLLRSVAAQAFALSRFRAPWYDPQDSGRFYALWA
FT                   EKAVLGTFDHQCLLVMDTFGQPAGFVTLRDLQDGSARIGLLAVFPDAQGKGIGSLLMSA
FT                   AKQWCQSHGLHRLRVATQMSNVAALRLYIRSGASIESTAYWLCRG"
FT   misc_feature    210115..210354
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 73.5,
FT                   E-value 2.9e-19"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS             210392..211522
FT                   /transl_table=11
FT                   /gene="rffA"
FT                   /gene_synonym="wecE"
FT                   /gene_synonym="b3791"
FT                   /locus_tag="YE0176"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10315"
FT                   /db_xref="GOA:A1JI77"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI77"
FT                   /protein_id="CAL10315.1"
FT                   /translation="MIPFNAPPVVGTELGYMQAAITSGKLCGDGGFTRRCQQWMEKRFD
FT                   CPKVLLTPSCTASLEMAALLLDIKPGDEVIMPSFTFVSTANAFVLRGAKMVFVDIRPDT
FT                   MNIDETKIEAAITDKTKVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKG
FT                   KALGTIGHIGCFSFHETKNYTAGGEGGATLINDPSLIDRAEIIREKGTNRSQFFRGQVD
FT                   KYTWRDIGSSYLMSDLQAAYLWGQLEAADQINQRRLALWHTYYDAFKPLADAGRIDLPV
FT                   IPGNLAQNAHMFYIKLRDIEDRSKFISFLKEAEIMAVFHYIPLHACPAGEEFGRMDGED
FT                   RFTTKESERLVRLPIFYNLTDVNQSTVINTVLSFFA"
FT   misc_feature    210410..211507
FT                   /note="Pfam match to entry PF01041
FT                   DegT_DnrJ_EryC1,DegT/DnrJ/EryC1/StrS aminotransferase
FT                   family, score 291.1, E-value 9.2e-85"
FT                   /inference="protein motif:PFAM:PF01041"
FT   misc_feature    210758..210790
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             211524..212780
FT                   /transl_table=11
FT                   /gene="wzxE"
FT                   /gene_synonym="wzx"
FT                   /gene_synonym="b3792"
FT                   /locus_tag="YE0177"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10316"
FT                   /db_xref="GOA:A1JI78"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI78"
FT                   /protein_id="CAL10316.1"
FT                   /translation="MSLAKASIWTAGSTLIKIGVGLLVVKLLAVTFGPSGVGQAGNFRQ
FT                   LITVLGVLSGAGIFNGITKYVAEYHQQPERLRAVLGTSSAIVLGFSTLLALIFLLAAKP
FT                   VSIALFGHADYQNVVRAVAFIQMGIAYANLFLAILKGYRDAMGNALAVIGGSLIGVVAY
FT                   YICFRIGGYPGALVGLALVPALVVIPAAAMLIRRKTIPLSYLKLSWDKALASHLGKFTI
FT                   MALITSVTLPVAYVMMRNLLADRYGWDAVGIWQGVSSISDAYLQFITASFTVYLLPTLS
FT                   RLKAKADISREILRSLKFVLPAVATASLIVWLLRDFAIWLLFSHQFTAMRDLFAWQLVG
FT                   DVLKVGSYVFGYLVIAKASLRFYILTEVSQFLLLTGFAHWLIPMNGSLGAAQAYMATYI
FT                   VYFALCSCVFLMYRRHSSP"
FT   misc_feature    211530..212375
FT                   /note="Pfam match to entry PF01943
FT                   Polysacc_synt,Polysaccharide biosynthesis protein, score
FT                   36.7, E-value 3.4e-08"
FT                   /inference="protein motif:PFAM:PF01943"
FT   misc_feature    join(211560..211628,211656..211724,211761..211829,
FT                   211872..211940,211959..212027,212040..212108,
FT                   212169..212237,212280..212348,212409..212477,
FT                   212520..212588,212607..212675,212685..212753)
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0177 by TMHMM2.0 at aa 13-35, 45-67, 80-102,
FT                   117-139,146-168, 173-195, 216-238, 253-275, 296-318,
FT                   333-355,362-384 and 388-410"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    212712..212744
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             212803..213888
FT                   /transl_table=11
FT                   /locus_tag="YE0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10317"
FT                   /db_xref="GOA:A1JI79"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI79"
FT                   /protein_id="CAL10317.1"
FT                   /translation="MTTLIHVLGSDIPHHNLTVLRFFNDVLTTRVPAEQARHFMVAAKE
FT                   TAPFSSFPQLEIETHSNKKTLAEAVITRAQASRDTRFFWHGQFNATLWLALLSGKIKPH
FT                   QVYWHIWGADLYEDAKSLKFRLFYLLRRIAQGRVGHVFATRGDLIYFQQRHPRVPASLL
FT                   YFPTRMDAALTGVNIDKPLAGPMTILVGNSGDSTNRHIEALKAIHQQFGPDARVILPMG
FT                   YPANNELYIEKVRQAGLALFAADNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGT
FT                   LCLLTQFGVPFVLSRKNPFWQDLAEQHIPVLFYGDSLDEPLIREAQRQLAGLDKHAIAF
FT                   FNPNYIEGWQQALALAAGEHP"
FT   CDS             213885..215261
FT                   /transl_table=11
FT                   /gene="wecF"
FT                   /gene_synonym="rffT"
FT                   /locus_tag="YE0179"
FT                   /product="probable 4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10318"
FT                   /db_xref="GOA:A1JI80"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI80"
FT                   /protein_id="CAL10318.1"
FT                   /translation="MTLGQFGGLFSVYLIAVIFILILTYQEFRRVRFNFNVLFSMLYLL
FT                   TFYFGFPLTCMLVFQFGVAVVPVEYLLYAMLSATAFYGIYYVSYKTRLRKPRSQPRAPV
FT                   FTMNRVETNLTWMLLALVAIGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRFFYF
FT                   FIPAMLVVYFLRQDMRAWFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGW
FT                   ITLWMLAAAGVFGIVGMFWLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNY
FT                   DKIDFQGLAPIIRDFYVFIPSSLWPARPDLVLNTANYFTWDVLDNHSGLAISPTLIGSL
FT                   VVMGGVLFIPLGAIVVGLIIKWFDWLYEQGKAEKNRYKAAILQSFCFGAVFNIIVLARE
FT                   GLDSFVSRVVFFCVIFGACLILAKLLYWLFDTAGLIKQRVQHHIGKPKPLSVPHESSQL
FT                   "
FT   misc_feature    join(213900..213959,213996..214064,214092..214151,
FT                   214212..214280,214338..214406,214425..214484,
FT                   214494..214553,214557..214616,214893..214961,
FT                   215022..215075,215103..215171)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0179 by TMHMM2.0 at aa 6-25, 38-60, 70-89,
FT                   110-132,152-174, 181-200, 204-223, 225-244, 337-359,
FT                   380-397 and 407-429"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    214716..214763
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    215106..215138
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             215354..216028
FT                   /transl_table=11
FT                   /gene="wecG"
FT                   /gene_synonym="rffM"
FT                   /locus_tag="YE0180"
FT                   /product="probable UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10319"
FT                   /db_xref="GOA:A1JI81"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI81"
FT                   /protein_id="CAL10319.1"
FT                   /translation="MEQTLDHLLSSGPVKTGTLVAMNAEKLLKAEDDAALRQLITEAEY
FT                   LYADGISMVRAIRRKYPQAKLSRVAGADLWEALMQRAGQQGIPVFLVGGKPDVLAETEA
FT                   KLRAQWNVNLVGSQDGYFTPEQREALFARIAASGAAIVTVAMGSPKQEMFMRDCRKVYP
FT                   DALYMGVGGTYDVFTGHVKRAPKIWQNMGLEWLYRLLAQPSRIRRQFKLLKFVGYYYSG
FT                   RL"
FT   misc_feature    215465..215980
FT                   /note="Pfam match to entry PF03808 Glyco_tran_WecB,Glycosyl
FT                   transferase WecB/TagA/CpsF family, score 292.2,E-value
FT                   4.2e-85"
FT                   /inference="protein motif:PFAM:PF03808"
FT   CDS             216379..217770
FT                   /transl_table=11
FT                   /locus_tag="YE0181"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10320"
FT                   /db_xref="GOA:A1JI82"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI82"
FT                   /protein_id="CAL10320.1"
FT                   /translation="MADNEEKKGLHRGLEARHIELIALGGTIGVGLFMGSASTLKWAGP
FT                   SVLLAYIIAGLFVFFIMRSMGEMLYLEPVAGSFAVYAHKYLSPYFGYLTAWGYWFMWIA
FT                   VGISEITAIGVYVQFWFPEIPQWLPAIAGVAIVALANLAAVRLYGELEFWFAMIKVTTI
FT                   IVMILVGLGVIFFGFGNHGQPIGFDNLTAHGGFFAGGWKGFMFALCIVVASYQGVELVG
FT                   ITAGEARNPQVTLKRAINNILWRILIFYVGAIFVIVTIFPWDGIGTGGSPFVLTFAKIG
FT                   IVSAAGIINFVVLTAALSGCNSGMYSGGRMLYALAKNRQLPACLTKLSASGVPVYCIAV
FT                   TILCLMVGSSLNYIIPNPQQVFVYVYSASVLPGMVPWFVVLVSQLRFRQAHVEALKQHP
FT                   FKSIMFPYVNYLTIAFLICVLVGMGLNPDTRLSLLVGVIFLGLVTACYFCLGMHNKVPV
FT                   EIKRR"
FT   misc_feature    216406..217737
FT                   /note="Pfam match to entry PF00324 aa_permeases, Amino acid
FT                   permease, score 500.3, E-value 9.3e-148"
FT                   /inference="protein motif:PFAM:PF00324"
FT   misc_feature    join(216439..216492,216502..216561,216661..216729,
FT                   216757..216825,216844..216912,216955..217023,
FT                   217099..217167,217195..217263,217375..217443,
FT                   217456..217524,217585..217653,217663..217731)
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0181 by TMHMM2.0 at aa 21-38, 42-61, 95-117,
FT                   127-149,156-178, 193-215, 241-263, 273-295, 333-355,
FT                   360-382,403-425 and 429-451"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    216505..216597
FT                   /note="PS00218 Amino acid permeases signature."
FT                   /inference="protein motif:Prosite:PS00218"
FT   misc_feature    217249..217281
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    217684..217716
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   tRNA            217919..217995
FT                   /gene="tRNA-Arg (CCG)"
FT                   /product="transfer RNA-Arg (CCG)"
FT   tRNA            218079..218154
FT                   /gene="tRNA-His (GTG)"
FT                   /product="transfer RNA-His (GTG)"
FT   tRNA            218170..218256
FT                   /gene="tRNA-Leu (CAG)"
FT                   /product="transfer RNA-Leu (CAG)"
FT   tRNA            218332..218408
FT                   /gene="tRNA-Pro (TGG)"
FT                   /product="transfer RNA-Pro (TGG)"
FT   CDS             complement(219361..220560)
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="YE0184"
FT                   /product="putative protoheme IX biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10321"
FT                   /db_xref="GOA:A1JI83"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI83"
FT                   /protein_id="CAL10321.1"
FT                   /translation="MLRVLLLFLILTAGIVLGPMLAGHQGYVLIQTDNYNVETSVTGLV
FT                   IMLVLVLVAFLIVEWILRRIFRTGARTRGWFLGRKRTRARKQTKAALIKLAEGDFKQVE
FT                   KLLTRNADHAEQPMVNYLLAAEAAQQRGDEFRTNQYLERAAEVADTDQLPVDITRVRIQ
FT                   LAQGHVHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYSSLLEILPAMSKVQVHTAE
FT                   EIAALEQQAYIGMMNQCMAEEGSDGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDSDV
FT                   AQQIILDGLKRQYDERLVLLIPRLKSGNPEPIEKSLRQHIKQHGATPLLNSTLGQLMLK
FT                   HGEWEKASEAFKAALAQRPDGYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESL
FT                   "
FT   misc_feature    complement(220072..220101)
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   misc_feature    complement(join(220375..220443,220480..220548))
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0184 by TMHMM2.0 at aa 5-27 and 40-62"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(220492..220560)
FT                   /gene="hemY"
FT                   /locus_tag="YE0184"
FT                   /note="Signal peptide predicted for YE0184 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.919) with cleavage site
FT                   probability 0.457 between residues 23 and 24"
FT   CDS             complement(220563..221687)
FT                   /transl_table=11
FT                   /gene="hemX"
FT                   /locus_tag="YE0185"
FT                   /product="putative uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10322"
FT                   /db_xref="GOA:A1JI84"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI84"
FT                   /protein_id="CAL10322.1"
FT                   /translation="MTEQNTPSAPVEETTTAAERHQQPEPEIRREKKSGPILGAIAIAL
FT                   AIALGAGLYYHGHQQAQLQEAANIALQEQLAELKQSQLQEKQQLESLLQQQGKALEAAD
FT                   RQQTSLTRQLNELQEKVATISGSDAKTWLLAQADFLVKMAGRKLWSDQDVTTAATLLKS
FT                   ADASLADMNDPSLIDVRRALTEDISTLSAVTQVDFDGIILKLNQLSNQVDNLRLADNNI
FT                   DDSPMDANSDELSSSLAEWRQNLTKSWHSFMSDFITIRRRDSSAEPLLAPNQDVYLREN
FT                   IRSRLLVAAQAVPRHQDEVYKQSLETISTWVRAYFDVNDPNTKAFLDELESLSQQSISM
FT                   DVPDQLKSQPMLEKLMQTRVRNLLAQAPVAAQGE"
FT   misc_feature    complement(221517..221585)
FT                   /note="1 probable transmembrane helix predicted for YE0185
FT                   by TMHMM2.0 at aa 35-57"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(221720..222466)
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="YE0186"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10323"
FT                   /db_xref="GOA:A1JI85"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI85"
FT                   /protein_id="CAL10323.1"
FT                   /translation="MTILVTRPSPAGEQLVSRLRALGRVAYHAPLIDFSPGDDLPKLPA
FT                   LLQDMQAGDLVFALSQNAVRYANPLLKRNNLSWPAQLSYYAIGRNTALALHTASRLHVT
FT                   FPPTGETSEMLLSLPDLQQLTGKKALLLRGNGGRELLGESLRERGATVTFCECYQRSPI
FT                   FYDGSEQSAHWQRSGVDILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLVVVSDRLAALA
FT                   AQMGWSNIRVAENADNDALIRALQDF"
FT   misc_feature    complement(221735..222439)
FT                   /note="Pfam match to entry PF02602
FT                   HEM4,Uroporphyrinogen-III synthase HemD, score 165.6,
FT                   E-value 5.5e-47"
FT                   /inference="protein motif:PFAM:PF02602"
FT   CDS             complement(222463..223404)
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /gene_synonym="popE"
FT                   /locus_tag="YE0187"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10324"
FT                   /db_xref="GOA:A1JI86"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI86"
FT                   /protein_id="CAL10324.1"
FT                   /translation="MLDKIIRIATRQSPLALWQAHYVQHLLQANHPGLQVELVPMVTRG
FT                   DIILDTPLAKVGGKGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDP
FT                   RDAFVSINYAHLDELPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDKGE
FT                   YHAIILAVAGLKRLGLETRIRYAMPAEESLPAVGQGAVGIECRLDDNFTRQLLAPLNHR
FT                   ETELRVCAERAMNTRLEGGCQVPIGSYAELDGDTLWLRALVGAPDGSEIIRGERRGPAE
FT                   NAEQMGVELADELLSRGAREILAEVYQDNPPL"
FT   misc_feature    complement(222511..222732)
FT                   /note="Pfam match to entry PF03900
FT                   Porphobil_deamC,Porphobilinogen deaminase, C-terminal
FT                   domain, score 117.1, E-value 2.1e-32"
FT                   /inference="protein motif:PFAM:PF03900"
FT   misc_feature    complement(222664..222714)
FT                   /note="PS00533 Porphobilinogen deaminase cofactor-binding
FT                   site."
FT                   /inference="protein motif:Prosite:PS00533"
FT   misc_feature    complement(222754..223392)
FT                   /note="Pfam match to entry PF01379
FT                   Porphobil_deam,Porphobilinogen deaminase, dipyromethane
FT                   cofactor binding domain, score 471.6, E-value 4.3e-139"
FT                   /inference="protein motif:PFAM:PF01379"
FT   CDS             223809..226355
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /gene_synonym="cya"
FT                   /locus_tag="YE0189"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10325"
FT                   /db_xref="GOA:A1JI87"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI87"
FT                   /protein_id="CAL10325.1"
FT                   /translation="MYLYIETLKQRLDAINQLRVDRALAAMGPAFQKVYSLLPTLLHCH
FT                   HPLMPGYLDGNVPHGICLFTPNETQQDYLSEVEAKWGQPLQQSVGGELPITGVYSMGST
FT                   SSIGQCHTSDLDIWVCHQAWLDAEERNRLQKKCSLLEKWAASMGVEVSFFLIDENRFRH
FT                   NASGSLGGEDCGSTQHILLLDEFYRSAVRLAGKRILWNMVPVEEENNYDDYVLSLYAQG
FT                   VLTPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTVLLEAYSWEYPNSQLL
FT                   AMEIKQRLHAGEIVAFGLDAYCMMLDRVTRYLTQINDTTRLNLVRRCFYLKVCEKLSRT
FT                   PASVGWRREILSQLVSEWGWSDESLAVLDNRANWKIERVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEEHLTFIHVPAGR
FT                   ANRPGWYLYNQAPSMETIVSHQPLEYNRYLNKLVSWAYFNGLLTSKTHLHIKSANLCDT
FT                   VKLQELVTDISHHFPLRLPAPTPKALYSPCEIRHLAIIVNLEHDPTAAFRNQVVHFDFR
FT                   KLDVFSFGEQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAVLEALKTILGKMHQDAAPPE
FT                   SVDVFCYSQHLRGLIRTRIQQLVSECIELRLSSTRQEPGRFKAVRVAGQTWGLFFERLS
FT                   VSVQKLENAIEFYGAISNNKLHGLSIQVETDQIHLPPVVDGFASEGIIQFFFEGTADEK
FT                   GFNIYILDETNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNALSHLHIADKETSAPAQQFQLH"
FT   misc_feature    223809..226298
FT                   /note="Pfam match to entry PF01295
FT                   Adenylate_cycla,Adenylate cyclase, class-I, score 2160.8,
FT                   E-value 0"
FT                   /inference="protein motif:PFAM:PF01295"
FT   misc_feature    224085..224102
FT                   /note="PS00343 Gram-positive cocci surface proteins
FT                   'anchoring' hexapeptide."
FT                   /inference="protein motif:Prosite:PS00343"
FT   misc_feature    224532..224567
FT                   /note="PS01092 Adenylate cyclases class-I signature 1."
FT                   /inference="protein motif:Prosite:PS01092"
FT   misc_feature    225600..225644
FT                   /note="PS01093 Adenylate cyclases class-I signature 2."
FT                   /inference="protein motif:Prosite:PS01093"
FT   CDS             complement(226526..226846)
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="YE0190"
FT                   /product="frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10326"
FT                   /db_xref="GOA:A1JI88"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI88"
FT                   /protein_id="CAL10326.1"
FT                   /translation="MNDSEFHQLADQLMLCIEETLDGFSGDSDIDYETNGGVMTLTFEN
FT                   GSKIVINRQEPLHQVWLATKAGGYHFDYREGHWYCSRSGEEFFTKLSEAATAQAGEVVS
FT                   FS"
FT   misc_feature    complement(226529..226846)
FT                   /note="Pfam match to entry PF01491
FT                   Frataxin_Cyay,Frataxin-like domain, score 242.5, E-value
FT                   3.8e-70"
FT                   /inference="protein motif:PFAM:PF01491"
FT   CDS             226960..227163
FT                   /transl_table=11
FT                   /locus_tag="YE0191"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10327"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI89"
FT                   /protein_id="CAL10327.1"
FT                   /translation="MKKKLCWSLTAMMVFALSGCGLKGPLYFPPSDKPKVETTKQDSGQ
FT                   VDKNQQGLPGDSKPTQSIAGPQ"
FT   sig_peptide     226960..227028
FT                   /locus_tag="YE0191"
FT                   /note="Signal peptide predicted for YE0191 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.994) with cleavage site
FT                   probability 0.378 between residues 23 and 24"
FT   misc_feature    226972..227040
FT                   /note="1 probable transmembrane helix predicted for YE0191
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    226987..227019
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             227252..228076
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="YE0192"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10328"
FT                   /db_xref="GOA:A1JI90"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JI90"
FT                   /protein_id="CAL10328.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLADRHTGVGFDQM
FT                   LVVEPPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVRLKGLTNKRDISVSTQTGRM
FT                   ILSVTEDELVCVNMGEPNFEPQSVPFRAAKAEKTYILRAAEHTVLCGVVSMGNPHCVMQ
FT                   VDDVSVANVALLGPVLESHERFPERANIGFMQVVSREHIRLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQELLGEEVHVELPGGSLHISWKGPGHPLYMTGPATHVYDGFIHL"
FT   misc_feature    227258..227623
FT                   /note="Pfam match to entry PF01678
FT                   DAP_epimerase,Diaminopimelate epimerase, score 179.5,
FT                   E-value 3.5e-51"
FT                   /inference="protein motif:PFAM:PF01678"
FT   misc_feature    227441..227485
FT                   /note="PS01326 Diaminopimelate epimerase signature."
FT                   /inference="protein motif:Prosite:PS01326"
FT   misc_feature    227702..228052
FT                   /note="Pfam match to entry PF01678
FT                   DAP_epimerase,Diaminopimelate epimerase, score 182.3,
FT                   E-value 5.2e-52"
FT                   /inference="protein motif:PFAM:PF01678"
FT   CDS             228170..228874
FT                   /transl_table=11
FT                   /locus_tag="YE0193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10329"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI91"
FT                   /protein_id="CAL10329.1"
FT                   /translation="MKSSEEQALAGIELDDDAVMQYLLQNPDFFIRNARLVEQMHIPHP
FT                   VRGTVSLVEWQLGRQRNQIGQLEEEITLLMEQAGLNEVLFNRLLQLQGNLAAASSLQDM
FT                   LNRLQRWARDFGLAGANVRLFTDRWQIGAPSDFTHLGLSRHAFEPMRIQRLGNARHYLG
FT                   SLNGPELLLLLPQAKQVGSVALSLLGKEGDLGVIVFSSRDIQHYQQGMGTVMLNQLSML
FT                   LPSLLERWIEPV"
FT   CDS             228871..229782
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="YE0194"
FT                   /product="putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10330"
FT                   /db_xref="GOA:A1JI92"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="InterPro:IPR023109"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI92"
FT                   /protein_id="CAL10330.1"
FT                   /translation="MTDFSTSLAPQVEAFLRYLKVERQLSPLTITSYRRQLQALMEMGE
FT                   QMGLAHWQTLDAAQVRSLVSRSKRAGLHSSSLALRLSALRSFLNWLVSQGVLQANPAKG
FT                   VSTPRSGRHLPKNIDVDEVAKLLDIDLNDPLAVRDRAMLEVMYGAGLRLSELVGMNCKH
FT                   VDLASGEVWVMGKGSKERKVPIGKTAVKWLDHWLELRELFEPQDDAIFLANTGKRISAR
FT                   NVQKRFAEWGVKQGVSSHIHPHKLRHSFATHMLESSGDLRAVQELLGHANLTTTQIYTH
FT                   LDFQHLATVYDAAHPRAKRGKS"
FT   misc_feature    228898..229158
FT                   /note="Pfam match to entry PF02899 Phage_integr_N, Phage
FT                   integrase, N-terminal SAM-like domain, score 104.1,E-value
FT                   1.8e-28"
FT                   /inference="protein motif:PFAM:PF02899"
FT   misc_feature    229222..229737
FT                   /note="Pfam match to entry PF00589 Phage_integrase, Phage
FT                   integrase family, score 208.0, E-value 9.4e-60"
FT                   /inference="protein motif:PFAM:PF00589"
FT   CDS             229782..230498
FT                   /transl_table=11
FT                   /locus_tag="YE0195"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10331"
FT                   /db_xref="GOA:A1JI93"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI93"
FT                   /protein_id="CAL10331.1"
FT                   /translation="MHFYRPLERISAITFDLDDTLYDNRPVISRTEQESVAFLQQYHPN
FT                   LAQLQAADLHRFRRELLEQDPDIYHDVTQWRWHAIELGLMRHGLSKSEAQCGADAAMEN
FT                   FALWRSRIYVPPATHDTLSALAEHYPLVAITNGNADPKACGLDNYFQFVLRSGPHGRAK
FT                   PFRDMYHKAANHLDIPLKNILHVGDDLTTDVAGSLRCGMQACWVNDRQQSLMTASDSRL
FT                   LPHIEISQLASLTALL"
FT   misc_feature    229809..230411
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 92.0, E-value 7.7e-25"
FT                   /inference="protein motif:PFAM:PF00702"
FT   CDS             230599..232761
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /gene_synonym="mutU"
FT                   /gene_synonym="pdeB"
FT                   /gene_synonym="rad"
FT                   /gene_synonym="recL"
FT                   /locus_tag="YE0196"
FT                   /product="DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:YE0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10332"
FT                   /db_xref="GOA:A1JI94"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI94"
FT                   /protein_id="CAL10332.1"
FT                   /translation="MDVSDLLDSLNEKQREAVAAPRCNLLVLAGAGSGKTRVLVHRIAW
FT                   LLSVENASPYSIIAVTFTNKAAAEMRHRIEHLIGTSQGGMWIGTFHGLAHRLLRAHHMD
FT                   ANLPQDFQILDSDDQLRLLKRLVKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIESYG
FT                   NPVEATWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILNHYRERFTNILVDEF
FT                   QDTNNIQYAWIRLLAGDRSNVMIVGDDDQSIYGWRGAQVENIQRFLKDFPGAETIRLEQ
FT                   NYRSTSNILTAANTLIANNDGRMGKNLWTDGAQGEPISLYCAFNELDEARFVVNRIKAW
FT                   QDNGGALNDCAILYRSNAQSRVLEEALLQTAMPYRIYGGQRFFERQEIKDALAYLRLIS
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVIRQTARDRQLTLWQSTRAMLQEKVLAGRAASAL
FT                   QRFVELVDSLAHETADMPLHVQTDRVIRDSGLWSMYEQEKGEKGQARVENLEELVNATR
FT                   QYSYQDEDQDLMPLQAFLSHAALEAGEGQADAYQDAVQLMTIHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLCYAESRRLYGKEVNHRPSRFIGE
FT                   LPQECVEEVRLRATVSRPVNHRRMGTPMNENDSGFSLGQRVRHPKFGEGTIVNLEGSGE
FT                   HSRLQVAFPGEGIKWLVAAYARLEAV"
FT   misc_feature    230626..232068
FT                   /note="Pfam match to entry PF00580 UvrD-helicase, UvrD/REP
FT                   helicase, score 747.8, E-value 2.9e-222"
FT                   /inference="protein motif:PFAM:PF00580"
FT   misc_feature    230683..230706
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    232705..232734
FT                   /note="PS00215 Mitochondrial energy transfer proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00215"
FT   CDS             complement(233186..233758)
FT                   /transl_table=11
FT                   /locus_tag="YE0197"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10333"
FT                   /db_xref="GOA:A1JI95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI95"
FT                   /protein_id="CAL10333.1"
FT                   /translation="MSMYEQGAFPSIIEVANAAQLSRATAYRYFPTQSALVSAMVDESL
FT                   GPILAWQPTQPDAGQRIAELLSFAYPRMLQHEGVLRAALHLSLQQWADNRSNPNNEEKL
FT                   IRGNRKRLLKLAVEPLEGKLTPEALQRVIHAFSLIYGSEVFMVLKDIWHLDDAGIQDVT
FT                   QWMGKAILLQAETDAKQAAQDESRMNK"
FT   misc_feature    complement(233639..233719)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 22.2, E-value
FT                   3.4e-05"
FT                   /inference="protein motif:PFAM:PF00440"
FT   misc_feature    complement(233666..233731)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1464.000, SD 4.17 at aa 10-31, sequence
FT                   PSIIEVANAAQLSRATAYRYFP"
FT   CDS             234065..235297
FT                   /transl_table=11
FT                   /locus_tag="YE0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10334"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI96"
FT                   /protein_id="CAL10334.1"
FT                   /translation="MPRHIFIATTTDTKGDELAYVSELIKATGLKTVTVDLSTKEARRA
FT                   GGADITAETVASHHPDGRQAVFCGDRGRAISAMAVAFERFIASRDDVAALLGLGGSGGT
FT                   ALITPAMQSLPIGIPKLMVSTMASGDVSGYIGASDIAMMYSVTDIAGLNRISRRVLSNA
FT                   AHQIAGAVYFAKEVFAQAELATDDKPALGLTMFGVTTPCIQAVSAALSAEYDCLVFHAT
FT                   GSGGKAMEKLAESGLLAGALDLTTTEVCDLLFDGVLACGPERFDAIAHSQIPYVGSCGA
FT                   LDMVNFGSPATIPVKYADRLFYEHNAQVTLMRTTKQENIEMARWIGEKLNRCEGEVRFL
FT                   IPQGGFSALDAPGQPFWDEKALQAFIHTLQETVIQTDKRRLVHYPFNINDPQFAQAAVE
FT                   NFKEIAKTPSH"
FT   misc_feature    234704..234724
FT                   /note="PS00290 Immunoglobulins and major histocompatibility
FT                   complex proteins signature."
FT                   /inference="protein motif:Prosite:PS00290"
FT   CDS             235324..236154
FT                   /transl_table=11
FT                   /locus_tag="YE0199"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10335"
FT                   /db_xref="GOA:A1JI97"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI97"
FT                   /protein_id="CAL10335.1"
FT                   /translation="MPKFQRQAILAKFREMIARREPIIGGGAGTGLSAKCEEAGGIDLI
FT                   VIYNSGRYRMAGRGSLAGLLAYGNANEIVVDMAKEVLPVVKHTPVLAGVNGTDPFCQFD
FT                   QFLDQLKALGFSGVQNFPTVGLIDGNFRANLEETGMGYGLEVDMIRLAHEKDLLTTPYV
FT                   FSAEDAVAMTQAGADIIVPHMGLTTGGNIGADTALKLADCVPLINKWAAAAKAVREDVI
FT                   VLCHGGPISTPQDAQYIMDNCPQCDGFYGASSMERLPTEIALTDTTKQFKNIKR"
FT   CDS             236657..237607
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="YE0200"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10336"
FT                   /db_xref="GOA:A1JI98"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI98"
FT                   /protein_id="CAL10336.1"
FT                   /translation="MLSAFKLSNNRLSRLELDESDDLTTSLWVDLVEPEEGERERVQNE
FT                   LGQSLATRPELDDIEASARFFEDEDGLHIHSFFYYEDAEDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRARNQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLEALSRVIM
FT                   EGQQGDEYDAALSTLAEQEDIGWKVRLCLMDTQRALNFLVRKARLPSGQLEQAREVLRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELRWSFGYPAAIGLMIIAGLAPYLYFKRKNWL"
FT   misc_feature    236717..237604
FT                   /note="Pfam match to entry PF01544 CorA, CorA-like Mg2+
FT                   transporter protein, score 394.8, E-value 5.5e-116"
FT                   /inference="protein motif:PFAM:PF01544"
FT   misc_feature    join(237419..237475,237518..237586)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0200 by TMHMM2.0 at aa 255-273 and 288-310"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(237795..238685)
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="YE0201"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10337"
FT                   /db_xref="GOA:A1JI99"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A1JI99"
FT                   /protein_id="CAL10337.1"
FT                   /translation="MDKQRTRQGIFFALAAYFIWGIAPAYFKLIQQVPADEILTHRIIW
FT                   SFFFMLILLTVSRNWPQVRSAIKNRKRLLLLAVTAVLIASNWLLFIWAVNHNHMLEASL
FT                   GYFINPLVNVLFGMLFLGERFRRMQWVAVALAFGGVLIQLWQFGSLPVIGLGLAITFAL
FT                   YGLIRKKLGIDAQTGMLVETMWLLPIAAVYLFFIADSPTSHMGANAWSLNVLLAAAGVI
FT                   TTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFVFIWAALL
FT                   LFTLDALYTQRKLRG"
FT   misc_feature    complement(join(237819..237878,237891..237959,
FT                   237996..238064,238092..238151,238185..238238,
FT                   238251..238304,238323..238391,238401..238469,
FT                   238506..238574,238602..238661))
FT                   /note="10 probable transmembrane helices predicted for
FT                   YE0201 by TMHMM2.0 at aa 9-28, 38-60, 73-95,
FT                   99-121,128-145, 150-167, 179-198, 208-230, 243-265 and
FT                   270-289"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(237831..238211)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 21.2, E-value 0.0016"
FT                   /inference="protein motif:PFAM:PF00892"
FT   misc_feature    complement(238251..238634)
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 53.9, E-value 2.3e-13"
FT                   /inference="protein motif:PFAM:PF00892"
FT   CDS             complement(238765..239235)
FT                   /transl_table=11
FT                   /locus_tag="YE0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10338"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA0"
FT                   /protein_id="CAL10338.1"
FT                   /translation="MPVTPLTLESARNLIGEIFVYHMPFNRELGLKLTRFEQDFAEITF
FT                   DNNDKLVGNIAQRILHGGVIAAVLDVAAGLVCVGNSLVRHEPLIQEQLQMKLAKMGTID
FT                   LRVDYLRPGRGEHFIASSCILRSGNKVSVARVELHNENQMHIASATATYLVG"
FT   misc_feature    complement(238768..239181)
FT                   /note="Pfam match to entry PF02584 DUF157, Uncharacterized
FT                   protein PaaI, COG2050, score -2.7, E-value 0.00013"
FT                   /inference="protein motif:PFAM:PF02584"
FT   CDS             239416..240294
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="YE0203"
FT                   /product="phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10339"
FT                   /db_xref="GOA:A1JIA1"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA1"
FT                   /protein_id="CAL10339.1"
FT                   /translation="MGRFWQILIALLLVPTLVQAEEATVEKIHDAPTVRGSIIAAMLQD
FT                   HDNPFLLYPYETNYLLYTYTSDINKDAISSYDWAQNANKDEVKFQLSLGFPIWRGIAGD
FT                   NSLLGASYTQRSWWQASNKDESSPFRETNYEPQLFLAWATDYELAGWTFREVEFGYNHQ
FT                   SNGKADPTSRSWDRVYTRLMAQRGNLEIDLKPWYRLPESDSKDDNPDINKYMGYYRLKV
FT                   GYALGESVFSLDGRYNWNTGYGGAEMGWSYPITKHVRFYTQVFSGYGESMIDYNFRQTR
FT                   VGVGIMLNDVL"
FT   sig_peptide     239416..239475
FT                   /gene="pldA"
FT                   /locus_tag="YE0203"
FT                   /note="Signal peptide predicted for YE0203 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 20 and 21"
FT   misc_feature    239479..240282
FT                   /note="Pfam match to entry PF02253 PLA1, Phospholipase A1,
FT                   score 651.6, E-value 2.7e-193"
FT                   /inference="protein motif:PFAM:PF02253"
FT   CDS             240371..242221
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="YE0204"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10340"
FT                   /db_xref="GOA:A1JIA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA2"
FT                   /protein_id="CAL10340.1"
FT                   /translation="MSTAAVINRELLAEQVLRDTFGYQQFRPGQQEIINATLSGQDCLV
FT                   VMPTGGGKSLCYQIPALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTREQQ
FT                   LAVMDGCRSGQIKLLYIAPERLVMESFLDQLHQWRPALLAVDEAHCISQWGHDFRPEYR
FT                   ALGQLKQRFPNLPVIALTATADEATRGDIVRLLNLDQPLIQVSSFDRPNIRYTLVEKFK
FT                   PLDQLWRFVQDQRGKSGIIYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRAQVQEA
FT                   FQRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPAEAMLLY
FT                   DPADMAWLRRCLEEKPAGAQQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKQQSCGN
FT                   CDICLDPPKRYDGLADAQKALSCVYRVGQRFGLGYIVEVLRGANNQRIREFDHDKLSVY
FT                   GIGREQSHEHWVSVLRQLIHLGLLSQNIAMFSALQLTEAARPVLRAELPLQLAVPRIQS
FT                   LKVRSSANQKSYGGNYDRKLFAKLRKLRKSIADEGNIPPYVVFNDATLLEMAEQMPITA
FT                   SELLSVNGVGQRKLERFGAPFMAMIRDHVDNIHVDNNVDD"
FT   misc_feature    240416..241024
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 152.1, E-value 6.2e-43"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    240620..240652
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    241148..241363
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 103.7, E-value 2.4e-28"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    241961..242203
FT                   /note="Pfam match to entry PF00570 HRDC, HRDC domain ,score
FT                   116.3, E-value 3.7e-32"
FT                   /inference="protein motif:PFAM:PF00570"
FT   CDS             242284..242904
FT                   /transl_table=11
FT                   /gene="rhtC"
FT                   /locus_tag="YE0205"
FT                   /product="threonine efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10341"
FT                   /db_xref="GOA:A1JIA3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA3"
FT                   /protein_id="CAL10341.1"
FT                   /translation="MLMLFLTVALVHLVALMSPGPDFFFVSQTAASRSRREAMMGVTGI
FT                   SLGIVVWAGVALMGLNLILHKMAWLHQIIMVGGGLYLCWMGWQLLKSARSKRDTSEAEV
FT                   QVALPARGRTFLRGFLTNLSNPKAVIYFGSVFSLFVGDNVTAGARWGLFVLIVAETFVW
FT                   FSIVACVFALPVMRRGYQRLSKWIDGLAGVLFAGFGIHLILSR"
FT   sig_peptide     242284..242373
FT                   /gene="rhtC"
FT                   /locus_tag="YE0205"
FT                   /note="Signal peptide predicted for YE0205 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.709) with cleavage site
FT                   probability 0.229 between residues 30 and 31"
FT   misc_feature    join(242293..242361,242407..242475,242485..242553,
FT                   242638..242706,242734..242802,242839..242898)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0205 by TMHMM2.0 at aa 4-26, 42-64, 68-90,
FT                   119-141,151-173 and 186-205"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    242485..242811
FT                   /note="Pfam match to entry PF01810 LysE, LysE type
FT                   translocator, score 115.7, E-value 5.8e-32"
FT                   /inference="protein motif:PFAM:PF01810"
FT   CDS             complement(242954..243574)
FT                   /transl_table=11
FT                   /gene="rhtB"
FT                   /locus_tag="YE0206"
FT                   /product="putative homoserine/homoserine lactone efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10342"
FT                   /db_xref="GOA:A1JIA4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA4"
FT                   /protein_id="CAL10342.1"
FT                   /translation="MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVIASICG
FT                   LQLGLAVHIVLVGVGLGALISQSLLAFELLKWLGAAYLIWLGIQQWRAAGALDLHALAN
FT                   SMPRRKLFKRAVFVNLTNPKSIVFLAALFPQFVLPHQPQVAQYLILGSTSVIVDIIVMM
FT                   GYATLATRIAGWIKSPQQMKLLNRIFGGLFMLVGALLATARKV"
FT   misc_feature    complement(join(242966..243025,243050..243118,
FT                   243161..243229,243317..243385,243395..243463,
FT                   243500..243562))
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0206 by TMHMM2.0 at aa 5-25, 38-60, 64-86,
FT                   116-138,153-175 and 184-203"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(243056..243364)
FT                   /note="Pfam match to entry PF01810 LysE, LysE type
FT                   translocator, score 112.4, E-value 5.6e-31"
FT                   /inference="protein motif:PFAM:PF01810"
FT   sig_peptide     complement(243503..243574)
FT                   /gene="rhtB"
FT                   /locus_tag="YE0206"
FT                   /note="Signal peptide predicted for YE0206 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.803) with cleavage site
FT                   probability 0.440 between residues 24 and 25"
FT   CDS             243778..244833
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="YE0207"
FT                   /product="putative lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10343"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA5"
FT                   /protein_id="CAL10343.1"
FT                   /translation="MPLDNHMNNWLTREEQFAAFVNGPLLDFWQQRDEDEFMGVDNIPI
FT                   RYVRFCSPQHTRVVVVVPGRIESYVKYPEVAYDLFQQGYDVIVLDHRGQGRSGRILDDR
FT                   NRGHVIKFDDYIEDFAQLVQREITGSHYQQRFALAHSMGGAILTRYLAREPTVFNAVAL
FT                   CAPMFGIHLPMPGWLAHRIVDWTEKHQKLRDYYAIGTGQWRPLPYVVNMLTHSRERYRR
FT                   YLRQYADSPEIRVGGPTYHWVRESLLVGEQIIAQADKITTPVLLLQASEDRVVHNPAHN
FT                   AFTQAMTLAGHPCEGEQPKLIKGARHEILFERDTLRAEALSAILRFFAQHHSSLQHKKP
FT                   VGPQDSDTTRG"
FT   misc_feature    244027..244752
FT                   /note="Pfam match to entry PF00561 abhydrolase, alpha/beta
FT                   hydrolase fold, score 94.9, E-value 1e-25"
FT                   /inference="protein motif:PFAM:PF00561"
FT   CDS             244845..245654
FT                   /transl_table=11
FT                   /locus_tag="YE0208"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10344"
FT                   /db_xref="GOA:A1JIA6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA6"
FT                   /protein_id="CAL10344.1"
FT                   /translation="MYHVVASDLDGTLLSPDHILTPYTKETLKLLTQRDVHFVFATGRH
FT                   HIDVAQIRDNLEISAFMITSNGARVHNTAGELIFSHNLDADIARDLYNIEHHNPDILTN
FT                   VYLNDEWYMNRESPAQEEFFRESVFKYQVFEPALLPTDGVCKVYFTCDDHDKLLILEEA
FT                   INARWGDRVNVSFSFPTCLEVMGGGVSKGHALEQVAKIIGYSLKECIAFGDGMNDLEML
FT                   SMSGKGCIMRDAHQRLKDMLPNLEVIGSNADDAVPHYLRKMFLGSDK"
FT   misc_feature    244848..245549
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 31.2, E-value 1.6e-06"
FT                   /inference="protein motif:PFAM:PF00702"
FT   misc_feature    244854..244889
FT                   /note="PS01228 Hypothetical cof family signature 1."
FT                   /inference="protein motif:Prosite:PS01228"
FT   CDS             complement(245866..246864)
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="YE0209"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10345"
FT                   /db_xref="GOA:A1JIA7"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA7"
FT                   /protein_id="CAL10345.1"
FT                   /translation="MVIAHRGASGYLPEHSLPAKAMAYAQGADYLEQDLVMTKDNELVV
FT                   LHDHYLDRVTDVAERFPDRARKDGRYYAIDFTLPEIKSLKFTEGFDIDKEGKKVQSYPG
FT                   RFPMGKADFRVHTFQEEIEFVQGLNHSTGKNIGIYPEIKAPWFHKQEGKDISTKVLEVL
FT                   KQYGYTTKADKVYLQCFDANELKRIKNELEPKMGMNLKLVQLVAYTDWNETYEQKPDGK
FT                   WVNYSYDWMFKPGAMKQVAQYADGIGPDYHMLVVETSTPNNIKLTNMVKEAHANNMMVH
FT                   PFTIRADKLPKYATDVNQLFDIIYNQAGVDGVFTDFPDKGVQFLQKQGQHQ"
FT   misc_feature    complement(245899..246852)
FT                   /note="Pfam match to entry PF03009 GDPD, Glycerophosphoryl
FT                   diester phosphodiesterase family, score 317.6, E-value
FT                   9.4e-93"
FT                   /inference="protein motif:PFAM:PF03009"
FT   CDS             complement(247088..248452)
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="YE0210"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="Highly similar to Escherichia coli
FT                   glycerol-3-phosphate transporter glpT or b2240
FT                   SWALL:GLPT_ECOLI (SWALL:P08194) (452 aa) fasta scores: E():
FT                   2.3e-165, 91.29 38d in 448 aa and to Salmonella typhimurium
FT                   MFS family, Sn-glycerol-3-phosphate transport protein GlpT
FT                   or stm2283 SWALL:Q8ZNG6 (EMBL:AE008802) (452 aa) fasta
FT                   scores: E(): 2.8e-167, 92.58 38d in 445 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10346"
FT                   /db_xref="GOA:A1JIA8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA8"
FT                   /inference="similar to sequence:INSDC:AE008802"
FT                   /inference="similar to sequence:UniProtKB:P08194"
FT                   /protein_id="CAL10346.1"
FT                   /translation="MLSIFKPAPHVARLPADQVDPTYRRLRWQIFMGIFFGYAAYYLVR
FT                   KNFTLAMPYLIEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLSAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSKKERGSIVSVWNC
FT                   AHNVGGGLPPLLFLLGMAWFNDWKAALYMPAFGAILVALIVFGLMRDTPQSVGLPPIEE
FT                   YKNDYPDDYSEEAEEELTAKQIFMQYILPNKLLWYIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFKGNRGATGVFFMTLVTIATIVYW
FT                   LNPVGNPGIDMACMITIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDYFGWDGGFMVMIGGSILAVLLLIVVMFSEKKHHEELARQAEMDKK"
FT   misc_feature    complement(247106..248368)
FT                   /note="Pfam match to entry PF00083 sugar_tr, Sugar (and
FT                   other) transporter, score -109.0, E-value 0.00052"
FT                   /inference="protein motif:PFAM:PF00083"
FT   misc_feature    complement(join(247142..247201,247229..247297,
FT                   247334..247402,247430..247498,247517..247576,
FT                   247634..247693,247832..247891,247904..247972,
FT                   248027..248095,248105..248173,248192..248260,
FT                   248318..248377))
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0210 by TMHMM2.0 at aa 26-45, 65-87, 94-116,
FT                   120-142,161-183, 188-207, 254-273, 293-312, 319-341,
FT                   351-373,386-408 and 418-437"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(247946..247996)
FT                   /note="PS00942 glpT family of transporters signature."
FT                   /inference="protein motif:Prosite:PS00942"
FT   CDS             248974..250629
FT                   /transl_table=11
FT                   /gene="glpA"
FT                   /locus_tag="YE0212"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10347"
FT                   /db_xref="GOA:A1JIA9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIA9"
FT                   /protein_id="CAL10347.1"
FT                   /translation="MTNSSPYTETDVIIIGGGATGAGIARDCARRGLACTLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDGESARECIEENRILKRIARHCIEQTDGLFITLPEDSLEY
FT                   QQQFIARCQEAGIEAEAIDPKQALRLEPAANPTLIAAVRVPDGTVDPFRLTAANMLDAR
FT                   EHGANVLTYHEVIGLLRHGDRVSGVRVFDHKNQRQYDIHAQIVVNAAGIWGQHIAEYAD
FT                   LRIRMFPAKGALLILGHRINNMVINRCRKPADADILVPGDTISLIGTTSTHIEYDQIDN
FT                   MVVTAQEVDTLIREGSKLSPQLAQTRILRAYAGVRPLVASDDDPSGRNVSRGIVLLDHA
FT                   SRDGLEGFITITGGKLMTYRLMAEWATDKVCEKLGVTAACTTAQEPLPGSQQSAEQTLS
FT                   KVISLPASIRGSAVYRHGDRATQLLAGNRLDNSLVCECEAVTAGEVRYAIESLSVNNLL
FT                   DLRRRTRVGMGTCQGELCACRAAGLLSRFKVTTPQQSREQLRQFLNERWKGVRPIAWGD
FT                   ALRESEFTHWVYQGLCGLDDSPNTANVQEKPDEI"
FT   misc_feature    249001..250074
FT                   /note="Pfam match to entry PF01266 DAO, FAD dependent
FT                   oxidoreductase, score 408.8, E-value 3.2e-120"
FT                   /inference="protein motif:PFAM:PF01266"
FT   misc_feature    249016..249069
FT                   /note="PS00977 FAD-dependent glycerol-3-phosphate
FT                   dehydrogenase signature 1."
FT                   /inference="protein motif:Prosite:PS00977"
FT   misc_feature    250030..250062
FT                   /note="PS00978 FAD-dependent glycerol-3-phosphate
FT                   dehydrogenase signature 2."
FT                   /inference="protein motif:Prosite:PS00978"
FT   CDS             250619..251893
FT                   /transl_table=11
FT                   /gene="glpB"
FT                   /locus_tag="YE0213"
FT                   /product="putative anaerobic glycerol-3-phosphate
FT                   dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:YE0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10348"
FT                   /db_xref="GOA:A1JIB0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIB0"
FT                   /protein_id="CAL10348.1"
FT                   /translation="MKFDVIIIGGGLAGLVCGIRLAEQGKYCAIVSAGQNALHFSSGSL
FT                   DLLAKLPNGQAVSQPLSALETLAELAPEHPYSKMGQTGQVGELAQQAESLLSRCGLSLV
FT                   GSAAKNHLRLTPLGNCRPTWLSPADIPVAPLEGPLPWQKVAVIGIEGFLDFQPQMVASA
FT                   LQEQGVEVTSDYLHLPALDRLRDNPSEFRAVNIARVLDLPENLQPLADELARLSSTAEM
FT                   ILLPACIGLDESAPLEALRAAVGKPIQLLPTLPPSLLGMRLHQALRHRFQQLGGIVMPG
FT                   DAVLRAELVGNRITGLYSRNHGDIPLRAAQMVLASGSFFSNGLVATFEHVYEPILDLDI
FT                   LSLPNRADWSNSNMFAPQPYLQFGVNTDNRLRALRGGVALDNLHVIGAVLGGYDPLQQG
FT                   CGAGVSLTSALFVAEQIVSAMEVTL"
FT   sig_peptide     250619..250684
FT                   /gene="glpB"
FT                   /locus_tag="YE0213"
FT                   /note="Signal peptide predicted for YE0213 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.893) with cleavage site
FT                   probability 0.891 between residues 22 and 23"
FT   CDS             251932..253155
FT                   /transl_table=11
FT                   /gene="glpC"
FT                   /locus_tag="YE0214"
FT                   /product="anaerobic glycerol-3-phosphate dehydrogenase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:YE0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10349"
FT                   /db_xref="GOA:A1JIB1"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB1"
FT                   /protein_id="CAL10349.1"
FT                   /translation="MARDKSFESCIKCTVCTTYCPVAKVNPLYPGPKQAGPDGERLRLK
FT                   DPALYDDALKYCTNCKRCEVACPSDVKIGDIIQRAKASYSSNKPKLRDAILSHTDLMGT
FT                   LSTPFAPVINAVTGLKPVRVLLDKALKIDHRRELPKYSFGTFRRWYRKQAEKQQQYAEQ
FT                   VAFFHGCFVNYNHPQLGKDLVSVFNAMNIGVQLLKREKCCGVPLIANGFIEQAKKQARV
FT                   NLESLTDAVIDRDIPVVATSSSCTFTLRDEYPHLLDVDTAPVRDRVELATRYLYRLLDQ
FT                   GRELPLKPLLSNQNKPLRIAYHTPCHMEKMGWTAYTLALLQRIPGIELVVLDSQCCGIA
FT                   GTYGFKSENYATSQGIGASLFQQIEESGVDLVITDCETCKWQIEMSTSKKCEHPITLLA
FT                   QALNPLCP"
FT   misc_feature    251959..251994
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00198"
FT   misc_feature    252079..252150
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 13.2, E-value 0.0015"
FT                   /inference="protein motif:PFAM:PF00037"
FT   misc_feature    252100..252135
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00198"
FT   misc_feature    252490..252681
FT                   /note="Pfam match to entry PF02754 DUF224, Domain of
FT                   unknown function (DUF224), score 35.2, E-value 9.6e-08"
FT                   /inference="protein motif:PFAM:PF02754"
FT   misc_feature    252895..253083
FT                   /note="Pfam match to entry PF02754 DUF224, Domain of
FT                   unknown function (DUF224), score 61.2, E-value 1.5e-15"
FT                   /inference="protein motif:PFAM:PF02754"
FT   CDS             complement(253311..253754)
FT                   /transl_table=11
FT                   /gene="dcrB"
FT                   /locus_tag="YE0215"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10350"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB2"
FT                   /protein_id="CAL10350.1"
FT                   /translation="MGQPVSLLEGKVAFSLPADLSDQSGKMGSQANNMHVYANKTGDKA
FT                   VIVILGDDTNEALNVLTDRLAEQQRARDANLQVVTNKAIKVDGHPFQQLDSIITSGGQK
FT                   AYSSVLMGQVDNHLMTIQITLPADNQQQAQTEAESIISTLKLK"
FT   CDS             complement(253896..254576)
FT                   /transl_table=11
FT                   /gene="yhhQ"
FT                   /locus_tag="YE0216"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10351"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB3"
FT                   /protein_id="CAL10351.1"
FT                   /translation="MFSFTAQQRMTALVWLSLFHIVIITSSNYLVQLPISIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPLARRIILSVMVPALLISYLISALFYQGSWQGFLALSSF
FT                   NLFVARIAAASFMAYVLGQILDVQVFNRLRQRSAWWVAPTAAMFFGNISDTMAFFFIAF
FT                   YRSSDPFMAANWVEIALVDYSFKLLICMLFFLPAYGMMLNVLLKYFARKTEQQTLMQAN
FT                   TAEQ"
FT   misc_feature    complement(253947..254564)
FT                   /note="Pfam match to entry PF02592 DUF165, Uncharacterized
FT                   ACR, YhhQ family COG1738, score 254.3, E-value 1.1e-73"
FT                   /inference="protein motif:PFAM:PF02592"
FT   misc_feature    complement(join(253959..254027,254085..254153,
FT                   254187..254255,254298..254366,254385..254444,
FT                   254472..254540))
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0216 by TMHMM2.0 at aa 13-35, 45-64, 71-93,
FT                   108-130,142-164 and 184-206"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             254823..255077
FT                   /transl_table=11
FT                   /locus_tag="YE0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10352"
FT                   /db_xref="GOA:A1JIB4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIB4"
FT                   /protein_id="CAL10352.1"
FT                   /translation="MTDIFANPDKTLDALGLRCPEPVMMVRKTVRHMEDGQTLLIIADD
FT                   PATTRDIPGFCRFMDHQLLAQDTGQTPYRYLVKKGAKAE"
FT   misc_feature    254838..255059
FT                   /note="Pfam match to entry PF01206 UPF0033,Uncharacterized
FT                   protein family UPF0033, score 136.2,E-value 3.8e-38"
FT                   /inference="protein motif:PFAM:PF01206"
FT   misc_feature    254856..254894
FT                   /note="PS01148 Uncharacterized protein family UPF0033
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01148"
FT   CDS             complement(255099..257429)
FT                   /transl_table=11
FT                   /locus_tag="YE0218"
FT                   /product="putative P-type cation-translocating membrane
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10353"
FT                   /db_xref="GOA:A1JIB5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB5"
FT                   /protein_id="CAL10353.1"
FT                   /translation="MHSHSEHRHSTETQSHCGCGHDHAKKQTGCSSQPAANISHDSSNS
FT                   VSEHSHQEGGCCSQSSHTDDGDEESDRLANATPAGSQHFSWQVKGMDCPSCARKIENAV
FT                   SNLVGIENVKVLFATEKLVVDARSDIRLQVQQAVIQAGFSLIDTQSPGAGKNTESESRF
FT                   REYLPIALLTTLMLLSWGISLFSVELSELAFTVTTIVGLIPIVTKAWKLIRSGTPFAIE
FT                   TLMSVAAIGAMFIGATAEAAMVLLLFMVGELLESYAANRARRGVTALMALVPEEALLLK
FT                   EGERRQVSVASLRPGDIIEVSPGGRLPADAELMTPFASFDESALTGESVPVERVQGEKV
FT                   AAGSLSVDRATEMRVISEPGNNAIDRILQLIELAEERRAPIERFIDRFSRIYTPAIMFL
FT                   SALVILVPPLAFAEPWETWIYRGLTLLLIGCPCALVISTPAAITSALAAATRRGALIKG
FT                   GAALEQLGRIQTVAFDKTGTLTEGKPQVTDILPISGVSETRLLSLAAAVEAGSHHPLAV
FT                   AIMQRAQQNTPMLPLAEERRALAGIGVEGRVNGLVVRVSAPSKISPELLTAEWLAQFDE
FT                   LESSGKTAVAVLENEKFIGVVALRDTLRTDAKQAIDALKKLGIQGVMLTGDNPRAAAAI
FT                   AGELGIDYRAGLLPADKVQAVMALNATHPTVMVGDGINDAPAMKAASIGIAMGSGTDVA
FT                   LETADAALTHNRLTGLAEIILLSRAANANIRQNITIALGLKGIFLVTTLLGLTGLWLAV
FT                   LADSGATALVTANALRLLRKRDI"
FT   misc_feature    complement(255138..255173)
FT                   /note="PS00141 Eukaryotic and viral aspartyl proteases
FT                   active site."
FT                   /inference="protein motif:Prosite:PS00141"
FT   misc_feature    complement(join(255168..255236,256089..256157,
FT                   256200..256268,256677..256745,256788..256856,
FT                   256875..256934))
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0218 by TMHMM2.0 at aa 166-185, 192-214, 229-251,388-410,
FT                   425-447 and 732-754"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(255357..256028)
FT                   /note="Pfam match to entry PF00702 Hydrolase, haloacid
FT                   dehalogenase-like hydrolase, score 106.1, E-value 4.4e-29"
FT                   /inference="protein motif:PFAM:PF00702"
FT   misc_feature    complement(255360..255428)
FT                   /note="PS01229 Hypothetical cof family signature 2."
FT                   /inference="protein motif:Prosite:PS01229"
FT   misc_feature    complement(255990..256010)
FT                   /note="PS00154 E1-E2 ATPases phosphorylation site."
FT                   /inference="protein motif:Prosite:PS00154"
FT   misc_feature    complement(256038..256703)
FT                   /note="Pfam match to entry PF00122 E1-E2_ATPase, E1-E2
FT                   ATPase, score 295.6, E-value 4e-86"
FT                   /inference="protein motif:PFAM:PF00122"
FT   misc_feature    complement(256989..257180)
FT                   /note="Pfam match to entry PF00403
FT                   HMA,Heavy-metal-associated domain, score 53.8, E-value
FT                   2.5e-13"
FT                   /inference="protein motif:PFAM:PF00403"
FT   misc_feature    complement(257079..257168)
FT                   /note="PS01047 Heavy-metal-associated domain."
FT                   /inference="protein motif:Prosite:PS01047"
FT   CDS             complement(257713..258339)
FT                   /transl_table=11
FT                   /gene="yhhN"
FT                   /locus_tag="YE0219"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10354"
FT                   /db_xref="GOA:A1JIB6"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB6"
FT                   /protein_id="CAL10354.1"
FT                   /translation="MSWPFLAVFFSGWLFVDATYRGPRWQRWVFKPVTLLLLLLLAWQA
FT                   PILGPAGYLIVLGLLATLVADALLLLPSERLLYALGAFFLSHLLYTISFASQMTFTLFW
FT                   PLPLVLIIVGALLLATIWTRLDEMRWPVVAFVGMTLLMVWMAGEQYFARSTDMSFSLLT
FT                   GTVLLLVSHTIWLLNRYRFSFRASDAIVAGCYFVGHFLIVRSLYL"
FT   misc_feature    complement(join(257719..257775,257812..257871,
FT                   257899..257955,257974..258042,258055..258114,
FT                   258127..258186,258199..258258))
FT                   /note="7 probable transmembrane helices predicted for
FT                   YE0219 by TMHMM2.0 at aa 28-47, 52-71, 76-95,
FT                   100-122,129-147, 157-176 and 189-207"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             258627..258947
FT                   /transl_table=11
FT                   /locus_tag="YE0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10355"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB7"
FT                   /protein_id="CAL10355.1"
FT                   /translation="MANEQLLYRIQFINNGKNYQLYVREVGPSALFGFIEIADFVFDSQ
FT                   STLLVDPSTEKLKTEFSGVNRSYIPLHSVIRIDAVTEKGSARISELGSNVMSFPYLPGN
FT                   KP"
FT   CDS             258986..259369
FT                   /transl_table=11
FT                   /locus_tag="YE0222"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10356"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB8"
FT                   /protein_id="CAL10356.1"
FT                   /translation="MNKPPLLFIAVVVLIVVLATRQYWQKKRQDAENDRSPVRSLQVEV
FT                   IDKREVLAPNRRSRQREEIVAEEKRYEVYFQPLLSGVEVKKSNEIKIVLPQQEYNRIEQ
FT                   GAKGTLRLQGTRYISFVPNSVAK"
FT   sig_peptide     258986..259042
FT                   /locus_tag="YE0222"
FT                   /note="Signal peptide predicted for YE0222 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.802) with cleavage site
FT                   probability 0.534 between residues 19 and 20"
FT   misc_feature    258998..259057
FT                   /note="1 probable transmembrane helix predicted for YE0222
FT                   by TMHMM2.0 at aa 5-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(259410..259682)
FT                   /transl_table=11
FT                   /gene="yhhL"
FT                   /locus_tag="YE0223"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10357"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIB9"
FT                   /protein_id="CAL10357.1"
FT                   /translation="MWINIGRLLMLGVWFFLLLNLFQPFPKPLRYFIDVAMIFMVLMHG
FT                   LQLILLKSTQPKDQPISGLQQFKIFVFGVFELLAWQKKQPPLPKK"
FT   misc_feature    complement(join(259443..259502,259530..259598,
FT                   259617..259670))
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0223 by TMHMM2.0 at aa 5-22, 29-51 and 61-80"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(259672..260226)
FT                   /transl_table=11
FT                   /locus_tag="YE0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10358"
FT                   /db_xref="GOA:A1JIC0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC0"
FT                   /protein_id="CAL10358.1"
FT                   /translation="MPVSPGLRPTTDRVRETLFNWLAPMIQGARCLDCFAGSGALGLEA
FT                   LSRYAGFTVLLEADRHVAKQLSNNLALLSADNGQVVNTNSLQWLAQPGQPFDLVFLDPP
FT                   FRKGLLAETVNLLEQFNWLTADAWIYVEAEAESAAADVPASWQLHREKIAGQVAYRLYI
FT                   RNKDVPQDRVSVEEQEQHHVD"
FT   misc_feature    complement(259738..260223)
FT                   /note="Pfam match to entry PF03602 Cons_hypoth95,Conserved
FT                   hypothetical protein 95, score 223.8, E-value 1.6e-64"
FT                   /inference="protein motif:PFAM:PF03602"
FT   misc_feature    complement(259912..259932)
FT                   /note="PS00092 N-6 Adenine-specific DNA methylases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00092"
FT   CDS             260574..262097
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="YE0225"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10359"
FT                   /db_xref="GOA:A1JIC1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC1"
FT                   /protein_id="CAL10359.1"
FT                   /translation="MAKEKKRGFFSWLGLGRQNEEHTAEPLATEKEETAEQVVENPAIE
FT                   EQVLSEKQAEIAPDNTSVEAEARESVAEHSTLAPGEWDSTAISEVAAETLPEVGAEPAA
FT                   QSVEEPINFAEDPQYLQHHFSQNHDDKDKVDSWDEGTVSAPELPLTEHHVVIDTPAPQA
FT                   IVEESQAEVIEEPVVLEEEIEAEEEVVAVVAQEQERPTKEGFFARLKRSLIKTKQNLGS
FT                   GFMGLFSGKKIDDDLFEELEEQLLIADVGVETTRKIITSLTEHASRKQLKDAEALYGKL
FT                   KEEMSEILSKVDKPLDVSGKNPFVILMVGVNGVGKTTTIGKLARQFQAEGKSVMLAAGD
FT                   TFRAAAVEQLQVWGDRNKIAVVAQHTGADSASVIFDAIQAAKARGIDVLLADTAGRLQN
FT                   KAHLMEELKKIVRVMKKLDGDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKL
FT                   DGTAKGGVIFAIADQFGIPIRYIGVGEGIEDLRPFKADDFIEALFARED"
FT   misc_feature    261198..261443
FT                   /note="Pfam match to entry PF02881 SRP54_N, SRP54-type
FT                   protein, helical bundle domain, score 81.0, E-value
FT                   1.6e-21"
FT                   /inference="protein motif:PFAM:PF02881"
FT   misc_feature    261474..262088
FT                   /note="Pfam match to entry PF00448 SRP54, SRP54-type
FT                   protein, GTPase domain, score 416.8, E-value 1.3e-122"
FT                   /inference="protein motif:PFAM:PF00448"
FT   misc_feature    261501..261524
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    262002..262043
FT                   /note="PS00300 SRP54-type proteins GTP-binding domain
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00300"
FT   CDS             262103..262771
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="YE0226"
FT                   /product="cell division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10360"
FT                   /db_xref="GOA:A1JIC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC2"
FT                   /protein_id="CAL10360.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKNREVPFLRRQIGMIFQDHHLLLDRTVYDNVAMPL
FT                   IIAGASTEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDDALSEGILRLFEEFNRVGVTVLMATHDTSLIARRRYPILTLSQGRMSGAHHGE
FT                   "
FT   misc_feature    262184..262741
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 239.0, E-value 4.5e-69"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    262205..262228
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    262514..262558
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             262860..263720
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /gene_synonym="ftsS"
FT                   /locus_tag="YE0227"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10361"
FT                   /db_xref="GOA:A1JIC3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC3"
FT                   /protein_id="CAL10361.1"
FT                   /translation="MMRQPLATLLTVMVIAISLTLPSVCYIVWKNVSQAADQWYPTPQL
FT                   TVYLDKALDDNAAENVVTTLKTEAGVEKVNYLSREEAMGEFRNWSGFGGALDMLEENPL
FT                   PAVAIITPKLDFQSSGTLDTLRDRVSKVEGVAEVRMDDSWFARLAALTGLVGQVAAMIG
FT                   VLMVVAVFLVIGNSVRLSIFSRRDTINVMKLIGATDGFILRPFLNGGAMLGFGGAVLSL
FT                   ILSEALVWKLGSVVTQVATVFGTSFTLHGLSWDECLLLVLISAMIGWIAAWLATVQHLR
FT                   RFTPQ"
FT   sig_peptide     262860..262964
FT                   /gene="ftsX"
FT                   /gene_synonym="ftsS"
FT                   /locus_tag="YE0227"
FT                   /note="Signal peptide predicted for YE0227 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.865) with cleavage site
FT                   probability 0.331 between residues 35 and 36"
FT   misc_feature    join(262878..262946,263331..263399,263460..263528,
FT                   263631..263690)
FT                   /note="4 probable transmembrane helices predicted for
FT                   YE0227 by TMHMM2.0 at aa 7-29, 158-180, 201-223 and
FT                   258-277"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    263310..263699
FT                   /note="Pfam match to entry PF02687 DUF214, Predicted
FT                   permease, score 74.6, E-value 1.4e-19"
FT                   /inference="protein motif:PFAM:PF02687"
FT   CDS             264131..264988
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /gene_synonym="htpR"
FT                   /gene_synonym="hin"
FT                   /gene_synonym="fam"
FT                   /locus_tag="YE0228"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10362"
FT                   /db_xref="GOA:A1JIC4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016263"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC4"
FT                   /protein_id="CAL10362.1"
FT                   /translation="MTKEMQTLALVPQGSLEAYIRAANAYPMLTAEEERELAERLHYQG
FT                   DLEAAKQLILSHLRFVAHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVAKELGV
FT                   TSKDVREMESRMSAQDMTFDPTPDDEVRDGQSMAPVLYLQDKTSDFADGIEEDNWDNHA
FT                   ADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADQYGVSAERVRQLEKNAMKKLRM
FT                   AIEA"
FT   misc_feature    264359..264400
FT                   /note="PS00715 Sigma-70 factors family signature 1."
FT                   /inference="protein motif:Prosite:PS00715"
FT   misc_feature    264884..264949
FT                   /note="Predicted helix-turn-helix motif with score
FT                   2068.000, SD 6.23 at aa 252-273, sequence
FT                   STLQELADQYGVSAERVRQLEK"
FT   misc_feature    264887..264967
FT                   /note="PS00716 Sigma-70 factors family signature 2."
FT                   /inference="protein motif:Prosite:PS00716"
FT   CDS             complement(265084..265476)
FT                   /transl_table=11
FT                   /gene="yhhK"
FT                   /locus_tag="YE0229"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10363"
FT                   /db_xref="GOA:A1JIC5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024612"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC5"
FT                   /protein_id="CAL10363.1"
FT                   /translation="MKLTIERLTNLTHQDLIDLAKIWPEQQQTTWLQWINDGKPLFAAR
FT                   FNERLLGAVKVMVDGQQAELEDLYVREVTRRRGVGLYLIEETLRQLPTIQQWYLSDKQV
FT                   VAANYEAMGSFMLACGFSRNKQGWQR"
FT   misc_feature    complement(265111..265353)
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 23.4,
FT                   E-value 0.00035"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS             265898..267013
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /gene_synonym="livJ"
FT                   /locus_tag="YE0230"
FT                   /product="branched-chain amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10364"
FT                   /db_xref="GOA:A1JIC6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC6"
FT                   /protein_id="CAL10364.1"
FT                   /translation="MKLTKGKVLLAGCIAMAMSHSVLAKDIKVAIVGAMSGPVAQYGDM
FT                   EFTGARQAIADINAKGGIKGDKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLCSS
FT                   STQPASDIYEDEGVIMITPAATNADLTTRGYKMIMRTTGLDSDQGPTAAKYILETIKPK
FT                   RIAVVHDKQQYGEGLARSVRDSLKKQGTEPVLFEGVTAGDKDFSTLVARLKKENVDFVY
FT                   FGGYYPEMGQILRQAKQAGLTARFMGPEGVGNSSLSNIAGDASEGMLVTLPKRYDQVPA
FT                   NQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMERSGSQEPADLVKDLKTGKPVETVM
FT                   GPLSWDEKGDLKGFEFGIFEWHADGSSTAVK"
FT   sig_peptide     265898..265969
FT                   /gene="livK"
FT                   /gene_synonym="livJ"
FT                   /locus_tag="YE0230"
FT                   /note="Signal peptide predicted for YE0230 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 24 and 25"
FT   misc_feature    265958..267007
FT                   /note="Pfam match to entry PF01094 ANF_receptor, Receptor
FT                   family ligand binding region, score 175.3, E-value 6.6e-50"
FT                   /inference="protein motif:PFAM:PF01094"
FT   CDS             267172..268098
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="YE0231"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10365"
FT                   /db_xref="GOA:A1JIC7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC7"
FT                   /protein_id="CAL10365.1"
FT                   /translation="MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMISSYVSFIVIAALMMVGIDASWLLIGSAFLVSIVIASTYGWSIERVAYKPVRSSKR
FT                   LIALISAIGMSIFLQNYVSLNQGSRDLALPSLVTGQWTLAETNGFAATISTMQLTIWIV
FT                   TFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGINTDRVISLTFVIGALMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLILGIAEALTSAYLSTEYKD
FT                   AVSFALLIVVLLVMPTGILGRPEVEKV"
FT   misc_feature    267193..268083
FT                   /note="Pfam match to entry PF02653
FT                   BPD_transp_2,Branched-chain amino acid transport system /
FT                   permease component, score 323.1, E-value 2e-94"
FT                   /inference="protein motif:PFAM:PF02653"
FT   misc_feature    join(267214..267282,267301..267369,267379..267447,
FT                   267484..267543,267628..267696,267790..267858,
FT                   267901..267969,268015..268074)
FT                   /note="8 probable transmembrane helices predicted for
FT                   YE0231 by TMHMM2.0 at aa 15-37, 44-66, 70-92,
FT                   105-124,153-175, 207-229, 244-266 and 282-301"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             268095..269381
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="YE0232"
FT                   /product="high-affinity branched-chain amino acid transport
FT                   system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10366"
FT                   /db_xref="GOA:A1JIC8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC8"
FT                   /protein_id="CAL10366.1"
FT                   /translation="MKQLNFLNAIISSFVLLVLASFVMGLQLQLDGTKLIVQGASEVRW
FT                   LWIGAACIVVFFFQLVRPLIQQGIKKVSGPAWVLPSFDGTTPRQKLLAAAIIIAAIAWP
FT                   FLVSRGSVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLG
FT                   FWESLPLAGIVAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGI
FT                   SQIPKPTLFGLEFSRTAKDGGWDTFHNFFGLTYDPSDRIIFLYMVALLLVILTLFVINR
FT                   LLRMPLGRAWEALREDEIACRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPE
FT                   SFTFVESAFVLAIVVLGGMGSQFAVILAAVLLVVSRELMRDLNAYSMLLLGALMVLMMI
FT                   WRPQGLLPMKRPQLKLKVADIKAKQGEQA"
FT   sig_peptide     268095..268169
FT                   /gene="livM"
FT                   /locus_tag="YE0232"
FT                   /note="Signal peptide predicted for YE0232 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.812 between residues 25 and 26"
FT   misc_feature    join(268113..268181,268224..268277,268365..268424,
FT                   268434..268502,268506..268574,268584..268652,
FT                   268671..268724,268875..268943,269037..269105,
FT                   269148..269216,269235..269294)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0232 by TMHMM2.0 at aa 7-29, 44-61, 91-110,
FT                   114-136,138-160, 164-186, 193-210, 261-283, 315-337,
FT                   352-374 and 381-400"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    268314..269351
FT                   /note="Pfam match to entry PF02653
FT                   BPD_transp_2,Branched-chain amino acid transport system /
FT                   permease component, score 357.7, E-value 8.3e-105"
FT                   /inference="protein motif:PFAM:PF02653"
FT   CDS             269378..270145
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="YE0233"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10367"
FT                   /db_xref="GOA:A1JIC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIC9"
FT                   /protein_id="CAL10367.1"
FT                   /translation="MSTQPLLAVEGLSMRFGGLLAVNNVGLNLNQGEIVSLIGPNGAGK
FT                   TTIFNCLTGFYRPTGGTIKLRDRHIEGLPGQVIARMGVIRTFQHVRLFREMTVVENLLV
FT                   AQHQHLKSGVFAGLLKTPGFRRAEADALERAATWLERVGLLELANRQAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELNQLIMELRDQHQVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGSPIEIRNNPDVIRAYLGE"
FT   misc_feature    269471..270070
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 230.2, E-value 1.9e-66"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    269492..269515
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    269840..269884
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             270190..270891
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="YE0234"
FT                   /product="high-affinity branched-chain amino acid
FT                   transport, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10368"
FT                   /db_xref="GOA:A1JID0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID0"
FT                   /protein_id="CAL10368.1"
FT                   /translation="MLSFNQVSAHYGKIQALHQVSLHIQQGEIVTLIGANGAGKTTLLG
FT                   TLCGEPRATEGSIIFGEQDITSWQTARIMREAIAIVPEGRRVFSRMTVEENLAMGGFFA
FT                   DRQQYQQRIERVYDLFPRLFERRAQRAGTMSGGEQQMLAIGRALMSQPKLLLLDEPSLG
FT                   LAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGRIVLEDTGAALLA
FT                   NEAVRSAYLGG"
FT   misc_feature    270268..270816
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 200.5, E-value 1.7e-57"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    270289..270312
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    270589..270633
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             complement(270952..272022)
FT                   /transl_table=11
FT                   /locus_tag="YE0235"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0235"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10369"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID1"
FT                   /protein_id="CAL10369.1"
FT                   /translation="MNIKSKKLLLILMLFIMQPIAMANPSFYPYIKNYSNCSVTVLEDS
FT                   SIAVSFRAHLVNDLFSDVNPHIEQWKQLIKIPDDESIKLIPHHAILSLYFYNYNGEENH
FT                   SINIRNISNIFLDGANSSHASNNIKEIKFDSSPGTFSHTHYDVSFTIAANTLKNIRIGA
FT                   TVGGVLNRGEQQYSLLSSKGLSFGSTGKQCEIFDPQAGVAPEAVKIDPKFRLSSARWQL
FT                   KPLDLDLLLDNTANGAGLDASLENAENNRFCIHYQSMGVRPVLHRIQANNLNGLSADRN
FT                   HFQLKDKDKIINYQVILMTEGINYAFFLPEDNYINYLKKDAEKMCWTPKIKLFSTNTTD
FT                   KGSYSDTLNFTITPLA"
FT   misc_feature    complement(271930..271998)
FT                   /note="1 probable transmembrane helix predicted for YE0235
FT                   by TMHMM2.0 at aa 9-31"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(271954..272022)
FT                   /locus_tag="YE0235"
FT                   /note="Signal peptide predicted for YE0235 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.977 between residues 23 and 24"
FT   CDS             complement(272084..272602)
FT                   /transl_table=11
FT                   /locus_tag="YE0236"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10370"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID2"
FT                   /protein_id="CAL10370.1"
FT                   /translation="MNTLKIALILLLLPLQARADTIPLGDIDVTLEVTAQPRIEIEKPQ
FT                   GGWYHSITLTSTPENPSLYQAEVPITVKLRRLEGYRISVKKPLVLTRRSGVVYSPVKEF
FT                   SPANISWGTDHASLKLLSDNPQTFTVAKSTSSQSTTDYLLQISAQAPSGLDITGKYYGQ
FT                   LTLLFETNS"
FT   sig_peptide     complement(272546..272602)
FT                   /locus_tag="YE0236"
FT                   /note="Signal peptide predicted for YE0236 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 19 and 20"
FT   CDS             complement(272611..273240)
FT                   /transl_table=11
FT                   /locus_tag="YE0237"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0237"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10371"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID3"
FT                   /protein_id="CAL10371.1"
FT                   /translation="MASFLPVGTFAAIDIQPHVLEVQQKSAVVTVTNHGTETEYITVQL
FT                   YQLNNPGELPEQESLTPVSEQVQPALFAAPAKMTLGPQQSGKILLNALSSPDKEQVYRL
FT                   AVTPVNNRSVSGNGAVLGVQLSYMGLIRHLPASQQHQWTHHCINGSVKLHNTGNTRLQW
FT                   YQLEAQGRVIDDFNLYPGKQRQLAVRDVRGMVESETFNLRCPAGKK"
FT   CDS             complement(273233..273919)
FT                   /transl_table=11
FT                   /locus_tag="YE0238"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10372"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID4"
FT                   /protein_id="CAL10372.1"
FT                   /translation="MKYVYLLSTIALLAAPIATTYAQLVAIPARTTVEALDQHRTVQVY
FT                   NSGDKPLYLDITLQRVDNPGINPEQKTLISDITQPEMIFNPNRITLGPKQKRDIKLLPL
FT                   KAPAQETLYRLYINPIVDIKAIGNSEDKSKIHAPMTVSIGYGVLVHHLPPHAEQIRHWQ
FT                   HQCLSGGNLMLTSTGTIHSKFKQLKSADNSALTDSLNLYPGTPVTLSAQQLMGEVDNET
FT                   FSIRCG"
FT   misc_feature    complement(273839..273907)
FT                   /note="1 probable transmembrane helix predicted for YE0238
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(273854..273919)
FT                   /locus_tag="YE0238"
FT                   /note="Signal peptide predicted for YE0238 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.796 between residues 22 and 23"
FT   CDS             complement(273937..276249)
FT                   /transl_table=11
FT                   /locus_tag="YE0239"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0239"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10373"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID5"
FT                   /protein_id="CAL10373.1"
FT                   /translation="MEWNPMKTPSIIDKAVLVALLLTSFNSVGSEDITIEHLVPAGFSA
FT                   AEEHNTLQLLGILDGKTLPSPLFFSEEKQQLSFDQQQYRDNHIDESSITLLAGILPQIP
FT                   YLQCQNGCDYILSNHRITVDKVNHVVTITNNNNRYLMPVTTWGLVHNQSFDLRLATEQY
FT                   RAVSARGQGYLGLPYQSFAFAHWFYNAARIKNNNSYAHQSGYQQQTQIGVGSWYLQKNF
FT                   QAHYLRAGRQNNLDNSAGSIHTLVNPALDQFVTLGSQSYLAIDKPSAGSLVLYATSDGD
FT                   FEIYRDNQLIRRIPAQLGRNEIDYSQLPGGYYTVEIRLVDRTGKVINQESQTISNIGTQ
FT                   TNNGWFLTLGKGAVRSNNAPHLMQFGRSMNLKSLQTNITLLKDTASHWTAEGNASHPLG
FT                   IYDLNITPTLGLMSGEKRSGGYLRLTGGNSGLGYASLARYQTPDVSIYAPNAGSTSASY
FT                   SRRFGPTQLSYQFNQYKNNRQHRIQSRWDWRRPQYGMALSLGVQKGGQWNSQNNYGVFL
FT                   NTTLSFLKNSASINSAYARQQLTTSASYQKEFSDNYGTSTFGIDGSTSGKSNSVGSFAH
FT                   RSGSRGDVSARAGVDNKIANGGISYNGMLAISPQGIALGRSSYSGTALLIETPDLAGTP
FT                   YSFTAEGQPISGSGVYAIPIPRYQDRFFVRTHSNHSDVEMNIQLPVNITRAHPGQVFSS
FT                   QANITLNLLYHGFLKGPQGQPVSGVIDETGDTVHPNGLFSIQSDVILKNITVQSTSARY
FT                   RCDMRQQRDHIYLCHLN"
FT   misc_feature    complement(273940..273951)
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   misc_feature    complement(275722..275745)
FT                   /note="PS00030 Eukaryotic putative RNA-binding region RNP-1
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00030"
FT   sig_peptide     complement(276163..276249)
FT                   /locus_tag="YE0239"
FT                   /note="Signal peptide predicted for YE0239 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.733 between residues 29 and 30"
FT   CDS             complement(276430..276906)
FT                   /transl_table=11
FT                   /locus_tag="YE0240"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10374"
FT                   /db_xref="GOA:A1JID6"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:A1JID6"
FT                   /protein_id="CAL10374.1"
FT                   /translation="MKKTLLSIVTIAILASSSANAAPVEKDIAIEAKIVSAIKLTKNSG
FT                   RALDAIKMTYDPVKNDGHFTHTEQIKFTSLGGTKIKVSLREAFAMLNSNNKTFTDYKVN
FT                   IEGKELKNGSAAEFFDLTNTDFSGSLNISAKQPIDAVDGEIYTGVLKLSIEAEA"
FT   sig_peptide     complement(276844..276906)
FT                   /locus_tag="YE0240"
FT                   /note="Signal peptide predicted for YE0240 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 21 and 22"
FT   CDS             277469..278788
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="YE0241"
FT                   /product="glycerol-3-phosphate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10375"
FT                   /db_xref="GOA:A1JID7"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR030166"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JID7"
FT                   /protein_id="CAL10375.1"
FT                   /translation="MFNNAIRKTSICVALTLAFSANAMAVTEIPFWHSMEGELGVEVNS
FT                   LADRFNQSHSDYKIVPVYKGNYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIK
FT                   PVFQVFKDANINFDESVFVPTVAGYYTDAKTGHLLSQPFNSSTPVLYYNKDAFKKAGLN
FT                   PDQPPKTWQELAEDTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTD
FT                   AVLEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDESTAKFYNGDCAITTASSGSLADIRH
FT                   YAKFNYGVGMMPYDADAKDAPQNAIIGGASLWVMDGKDKDTYKGVAEFLQFLTQPEIAA
FT                   EWHQKTGYLPITTAAYELTKQQGFYDKNPGADVATRQMLNKPPLPYTKGLRLGNMPQIR
FT                   TVVDEELEGVWTGKKTPQQALDTAVSRGDVLLHRFEQTNK"
FT   sig_peptide     277469..277543
FT                   /gene="ugpB"
FT                   /locus_tag="YE0241"
FT                   /note="Signal peptide predicted for YE0241 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.966 between residues 25 and 26"
FT   misc_feature    277571..278731
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein, score 217.0,E-value
FT                   1.9e-62"
FT                   /inference="protein motif:PFAM:PF01547"
FT   misc_feature    277892..277945
FT                   /note="PS01037 Bacterial extracellular solute-binding
FT                   proteins, family 1 signature."
FT                   /inference="protein motif:Prosite:PS01037"
FT   CDS             278898..279785
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="YE0242"
FT                   /product="sn-glycerol-3-phosphate transport system,permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10376"
FT                   /db_xref="GOA:A1JID8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JID8"
FT                   /protein_id="CAL10376.1"
FT                   /translation="MSSSRPGFSCSWLPYLLVLPQLAITAVFFLWPAGEALWYSVQMLD
FT                   PFGLSSEFVGLSNFIALFHDEYYLASFYTTLIFSSLVAGIGLVVSLFLAAMVDYVLRGS
FT                   RIYQTLMILPYAVAPAVAAVLWIFLFNPGLGLITHFLASLGYNWNHAQNSGQAMFLVVL
FT                   ASVWKQISYNFLFFLAALQSIPRSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVN
FT                   LVYAFFDTFPVIDAATGGGPMQATTTLIYKIYREGFAGLDLSSSAAQSVVLMLLVIGLT
FT                   VIQFRFVERKVRYQ"
FT   misc_feature    join(278931..278999,279111..279179,279240..279308,
FT                   279366..279434,279513..279581,279693..279761)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0242 by TMHMM2.0 at aa 12-34, 72-94, 115-137,
FT                   157-179,206-228 and 266-288"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    279435..279662
FT                   /note="Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component, score 73.6, E-value 2.7e-19"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    279438..279524
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             279782..280627
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="YE0243"
FT                   /product="sn-glycerol-3-phosphate transport system,permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10377"
FT                   /db_xref="GOA:A1JID9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JID9"
FT                   /protein_id="CAL10377.1"
FT                   /translation="MIENRRGLDIFCHVMLIIGVLLILFPLYVAFVAASLDDTQVFQVP
FT                   MTLIPGPHLWQNISHIWHAGVGNNSAPFGLMLFNSFVMAFAITVGKITVSMLSAYAIVY
FT                   FRFPLRNLFFWLIFLTLMLPVEVRIFPTIQVIANLNMLDSYTGLTLPLMASATATFLFR
FT                   QFFMTLPDELLEAARIDGAGAMRFFWDIVLPLSKTNLAALFVITFIYGWNQYLWPILIT
FT                   SDASMGTAVAGIRSMISSSGAPTQWNQVMAAMILTLIPPVAVVLLMQRWFVRGLVDSEK
FT                   "
FT   misc_feature    join(279815..279883,280025..280093,280112..280171,
FT                   280214..280282,280343..280411,280532..280600)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0243 by TMHMM2.0 at aa 12-34, 82-104, 111-130,
FT                   145-167,188-210 and 251-273"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    280274..280510
FT                   /note="Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component, score 64.6, E-value 1.4e-16"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    280277..280363
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             280634..281722
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="YE0244"
FT                   /product="sn-glycerol-3-phosphate transport, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10378"
FT                   /db_xref="GOA:A1JIE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIE0"
FT                   /protein_id="CAL10378.1"
FT                   /translation="MACLKLQAVTKSYDGVTPVIKQIDLDVTDGEFIVMVGPSGCGKST
FT                   LLRMVAGLERTTSGDIYIDNLRVTDMEPKDRGIAMVFQNYALYPHMSVFDNMAYGLKIR
FT                   GFGKEQIRQRVDEAARILELEPLLKRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVIVMNKGVAEQIGTPSEV
FT                   YQRPATLFVASFIGSPAMNLLAGTVSPDGRAFILADGMTLPLEVPRPQWADRRLTLGIR
FT                   PEHIQQRVSQQKTSAQGVPMTLLTLELLGADNLAHGQWGGQSVIARLSHEEMPTAGSVL
FT                   YLYLPPAALHFFDSESGLRMES"
FT   misc_feature    280721..281266
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 223.4, E-value 2.2e-64"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    280742..280765
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    281036..281080
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             281719..282459
FT                   /transl_table=11
FT                   /gene="ugpQ"
FT                   /locus_tag="YE0245"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10379"
FT                   /db_xref="GOA:A1JIE1"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE1"
FT                   /protein_id="CAL10379.1"
FT                   /translation="MSKNWPYPTIVAHRGGGSLAPENTLAAIDVGARHGHKMIEFDAKL
FT                   SQDGQIFLLHDDTLDRTSNGWGVAGELPWEKLIQLDAGDWYSTAFRGERLPLLSEVAAR
FT                   CAQYGMAANIEIKPTTGTETPTGRAIALAARLLWQGQAIPPLLSSFSYEALVAAQQAAP
FT                   ELPRGLLLDKWDDNWQAMTRELDCVSLHINHKQLTAERVALLKAVGLRIMVYTVNQPAR
FT                   AQELLNWGVDCVCTDRIDLIYPRP"
FT   misc_feature    281755..282447
FT                   /note="Pfam match to entry PF03009 GDPD, Glycerophosphoryl
FT                   diester phosphodiesterase family, score 206.3, E-value
FT                   3e-59"
FT                   /inference="protein motif:PFAM:PF03009"
FT   CDS             282591..283550
FT                   /transl_table=11
FT                   /locus_tag="YE0246"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10380"
FT                   /db_xref="GOA:A1JIE2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE2"
FT                   /protein_id="CAL10380.1"
FT                   /translation="MPAFVISLWRQIVLSSPLFVLLALGYGLVRFGQWPSTITDGLTRF
FT                   VFSLALPAMLFRMMCDFSERPAVDARLLIAFFGSCLVVFVIGRIIASRVFHLDGVSGSV
FT                   FALGGIFSNNVMLGLPIATIMLGEKSIPAVALVLVFNGLILWTLVTISVEWARNGSPTL
FT                   AGFAKTARSVLTNPLIIGIISGTLFSLTGLQLPQFIDQPVTMLGQVAPPLSLIVLGMGL
FT                   AEYRVSEGWQISSAICFLKLIVQPMVIWALAWAMNLPALETQVVVLLGSMATGVNVYLM
FT                   SRQFNVLTGPAAASLVMSTVLAAVTTPLILTIIGVGMS"
FT   misc_feature    join(282624..282692,282804..282863,282900..282968,
FT                   282981..283049,283107..283175,283203..283271,
FT                   283290..283358,283368..283436,283473..283541)
FT                   /note="9 probable transmembrane helices predicted for
FT                   YE0246 by TMHMM2.0 at aa 12-34, 72-91, 104-126,
FT                   131-153,173-195, 205-227, 234-256, 260-282 and 295-317"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    282654..283043
FT                   /note="Pfam match to entry PF03547 Auxin_eff, Auxin Efflux
FT                   Carrier, score 48.4, E-value 1e-11"
FT                   /inference="protein motif:PFAM:PF03547"
FT   CDS             283705..284604
FT                   /transl_table=11
FT                   /gene="yigM"
FT                   /locus_tag="YE0247"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10381"
FT                   /db_xref="GOA:A1JIE3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE3"
FT                   /protein_id="CAL10381.1"
FT                   /translation="MLLLIITTILWAFSFSLIGEYLAGQVDSWFSVLMRVGLAALVFLP
FT                   FLRWRNINWRVIVLYMTVGAIQLGIMYLFSFRAYLYLTVPEFLLFTVMTPLYVTLIYDL
FT                   LRRQRLRWGYALSALLAVAGAAIIRYDHLSEHFWWGLVLVQAANICFAIGQVGYKRLME
FT                   VHPIPQHVAFSWFYVGALIVAVIAWFAFGNPQKLPTTPLQWGVLVWLGVGASALGYFMW
FT                   NYGATQVDAGTLGIMNNVHVPAGLLVNLAIWQEKPHWPSFIIGAMVIMASLWVHRRWVA
FT                   PHSLQTADSRKRVAGPNE"
FT   misc_feature    join(283708..283776,283786..283845,283858..283926,
FT                   283936..284004,284038..284097,284110..284178,
FT                   284212..284280,284308..284376,284395..284463,
FT                   284476..284529)
FT                   /note="10 probable transmembrane helices predicted for
FT                   YE0247 by TMHMM2.0 at aa 2-24, 28-47, 52-74,
FT                   78-100,112-131, 136-158, 170-192, 202-224, 231-253 and
FT                   258-275"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    283729..284094
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 35.1, E-value 1.1e-07"
FT                   /inference="protein motif:PFAM:PF00892"
FT   misc_feature    284149..284535
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 47.3, E-value 2.2e-11"
FT                   /inference="protein motif:PFAM:PF00892"
FT   CDS             complement(284492..285445)
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="YE0248"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10382"
FT                   /db_xref="GOA:A1JIE4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE4"
FT                   /protein_id="CAL10382.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAATQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTTQGEILLQLAEQVLPQIKQALQTCNEPHQTALRIAIECHSCIQWL
FT                   TPALDNFHKSWPQVAMDFKSGLTFDPQPALQQGELDLVLTSDILPRSGLHYSPMFDFEV
FT                   RLVLAPDHPLANKARIEPEDLAQEVLMIYPVQRQRLDIWRHFLQPAGINPALKNVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGNGLWSRLYAAVRDGEQRQPVTEAF
FT                   IRSARQHACESLPFVKNAERPNAGVPIARPLSPLPQ"
FT   misc_feature    complement(284576..285196)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 159.7, E-value 3.3e-45"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    complement(285257..285436)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   84.8, E-value 1.1e-22"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    complement(285302..285394)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(285332..285397)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1683.000, SD 4.92 at aa 17-38, sequence
FT                   GSLAAAATQLHQTQSALSHQFS"
FT   CDS             285551..287827
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="YE0249"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocyst
FT                   eine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10383"
FT                   /db_xref="GOA:A1JIE5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIE5"
FT                   /protein_id="CAL10383.1"
FT                   /translation="MTILNHTLGFPRVGLKRELKKAQESYWAGNSTQEELLNVGRELRA
FT                   RHWQQQQQAGVDLVPVGDFAWYDHVLTTSLLLGNVPERHQNADGSIDLDTLFRIGRGRA
FT                   PTGTPAAAAEMTKWFNTNYHYMVPEFQQGQQFKLGWTQLLDEVDEALALGHKIKPVLLG
FT                   PVTYLWLGKVKGEQFDRLSLLKDILPVYQQVLGELAKRGIEWVQIDEPALVLELPPEWL
FT                   DAYQPAYQALQGQVKLLLTTYFDSIGHNLDTIRALPVQGLHVDVVAGQDDIAKLNAKLP
FT                   QEWLLSLGVINGRNVWRADLSHWFERLQPLVNSRPLWLGSSCSLLHSPIDLSEETRLDA
FT                   EVKSWFAFALQKCAELALLTQALNAPSEAKLAELAAYSAPIRARRASSRVHNPQVEQRL
FT                   AAITAQDIERQQPYEARAAAQRKRFNLPAWPTTTIGSFPQTTEIRGLRLDFKQGRLDGK
FT                   NYRTGISEHIKQAIAEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGS
FT                   RCVKPPVIIGDISRPEAITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVSRETI
FT                   AKQIALALRDEVEDLEKAGIGIIQIDEPALREGLPLRRADWQAYLQWAVDAFKLNAAVA
FT                   QNDTQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEDFAYPNEIGPGVY
FT                   DIHSPNVPSVEWIEALLRKAAQRIPAERLWVNPDCGLKTRGWPETRQALANMVLAAQRL
FT                   REEQV"
FT   misc_feature    286835..287806
FT                   /note="Pfam match to entry PF01717
FT                   Methionine_synt,Methionine synthase, vitamin-B12
FT                   independent, score 769.0, E-value 1.3e-228"
FT                   /inference="protein motif:PFAM:PF01717"
FT   CDS             complement(287893..288603)
FT                   /transl_table=11
FT                   /locus_tag="YE0250"
FT                   /product="putative carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10384"
FT                   /db_xref="GOA:A1JIE6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE6"
FT                   /protein_id="CAL10384.1"
FT                   /translation="MPAYIARPAQHSGPYPVVIVVQEIFGVHEHIKDICRRLAKQGYLA
FT                   IAPELFFRQGDAKEYDDINALVKNLVSKVPDRQVMVDLDHTAHWASRHGGDTSKLAITG
FT                   FCWGGRIAWLYAAHNPQLKAAVAWYGKLVGEKTLLLPRYPVDVAVDLCAPVLGLYGGKD
FT                   GSITQEHIDTMRQALRAANADAEIIVYPDAGHAFNADYRPSYQEESALDGWQRMLDWFA
FT                   QHGVAANPINEDDK"
FT   misc_feature    complement(287929..288603)
FT                   /note="Pfam match to entry PF01738 DLH, Dienelactone
FT                   hydrolase family, score 336.2, E-value 2.3e-98"
FT                   /inference="protein motif:PFAM:PF01738"
FT   CDS             289388..290149
FT                   /transl_table=11
FT                   /gene="udp"
FT                   /locus_tag="YE0251"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10385"
FT                   /db_xref="GOA:A1JIE7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR018017"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE7"
FT                   /protein_id="CAL10385.1"
FT                   /translation="MAKSDVFHLGLTKNDLQGATLAIVPGDPQRVEKIAKLMDNPVHLA
FT                   SHREFTSWRAELDGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRIGTTGAIQPHINV
FT                   GDVLVTTAAVRLDGASLHFAPMEFPAVADFDCTTALVNAAKSVGATTHIGVTASSDTFY
FT                   PGQERYDTYSGRVVRRFKGSMEEWQSMGVMNYEMESATLLTMCASQGLRAGMVAGVIVN
FT                   RTQQEIPNEETMKTTESHAVKIVVEAARHLL"
FT   misc_feature    289445..290134
FT                   /note="Pfam match to entry PF01048 PNP_UDP_1,Phosphorylase
FT                   family, score 375.3, E-value 4e-110"
FT                   /inference="protein motif:PFAM:PF01048"
FT   misc_feature    289583..289630
FT                   /note="PS01232 Purine and other phosphorylases family 1
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01232"
FT   CDS             290482..291279
FT                   /transl_table=11
FT                   /locus_tag="YE0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10386"
FT                   /db_xref="InterPro:IPR025163"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE8"
FT                   /protein_id="CAL10386.1"
FT                   /translation="MTTSALSHPSLLPLDGGINFRDLGGNVVADGRRIKRGLLFRSGSL
FT                   DRLSTKDCAVLSSGSVAQILDYRDADEVQAKPDIVWQGASYHNIPANPLSSEVNANLEK
FT                   LTNETLATFDARAFMLELYRRLPFNNQAYKQLVSLLQNSASPEHAAAGVVQHCAVGKDR
FT                   TGVGSALVLFALGADESTVLEDYLLTETTLAPFREHMLAELALKLNSQALGQFAFVLSA
FT                   REEFIQTALRCIQERYGSREQWLQQEFGLGSIEREKLQSYFLE"
FT   CDS             291621..293438
FT                   /transl_table=11
FT                   /locus_tag="YE0253"
FT                   /product="putative carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10387"
FT                   /db_xref="GOA:A1JIE9"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIE9"
FT                   /protein_id="CAL10387.1"
FT                   /translation="MLMQHAITFVIASACVLVICYRLYGIFFVRKVLRVDDSEVTPSHT
FT                   FEDGKDYVPTKKWVNFGSHFAAIAAAGPLVGPVLAAQYGYLPGFLWLLIGCVIGGAVHD
FT                   TVVLFASMKHQGKSLSEVAKSELGPVAGWCTGLAMLFIITITMAGLSMVVVHALERNPW
FT                   GTFAVFMTIPIAICVGLWERMTGSMKGASYVGIAAIMVCVFVGPYIEHTWLGEWLMLKA
FT                   DTVSIILPMYAFFATALPVWMLLTPRGYLSSFMKIGVFGALIVGVVFINPEIQFPAVTQ
FT                   FIHGGGPVLAGPVWPFISITIACGAISGFHAFIGSGTTPKQIDKWSDILPVGFGAMLAE
FT                   CMVGVMALIAATSLHPADYFAINSSAEAWSVLGMEVVNLPKLSQEIGLDLYGRTGGAVT
FT                   LAVGMTDIFIRVPWFSSLAAYFFQFVVMFEAVFILTAVDSGTRVARYLLQDFLGDIWAP
FT                   LKRTDWLPGTLACSVIACVLWGYLLNSGDINSVWALFGVSNQLMASVGLIIGATIILRL
FT                   ATKRIYMLTCVIPLAYLFVTVNYAGYWMITHVYFNSAAKGYNLFNGIISIIMMTLGVII
FT                   LISALKKWRELWIRRSAEMAGNKVVTVNA"
FT   misc_feature    291630..292781
FT                   /note="Pfam match to entry PF02554 CstA, Carbon starvation
FT                   protein CstA, score 696.4, E-value 9.2e-207"
FT                   /inference="protein motif:PFAM:PF02554"
FT   misc_feature    join(291630..291698,291801..291869,291882..291950,
FT                   292008..292076,292104..292163,292188..292247,
FT                   292290..292355,292389..292457,292500..292568,
FT                   292605..292673,292857..292925,293010..293069,
FT                   293097..293165,293184..293252,293295..293363)
FT                   /note="15 probable transmembrane helices predicted for
FT                   YE0253 by TMHMM2.0 at aa 4-26, 61-83, 88-110,
FT                   130-152,162-181, 190-209, 224-245, 257-279, 294-316,
FT                   329-351,413-435, 464-483, 493-515, 522-544 and 559-581"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    291633..291665
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    291876..291908
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    292500..292532
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    293016..293048
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             293567..294097
FT                   /transl_table=11
FT                   /locus_tag="YE0254"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10388"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF0"
FT                   /protein_id="CAL10388.1"
FT                   /translation="MTLNDVITIVIDFVREHETWAMPIVFILAFGESLAFLSLLLPATV
FT                   ILLGLGALIGESGISFWPIWAAAVAGAFFGDWLSYWIGDHYKDRVGTLWPLSRNPQLLV
FT                   RGHAFFERWGFFGAFIGRFFGPLRAVVPLVAGICAMPKFYFQLANITSAIIWAFGILAP
FT                   GAFGIQWLSHWID"
FT   misc_feature    293633..294091
FT                   /note="Pfam match to entry PF00597 DedA, DedA family ,score
FT                   72.7, E-value 4.9e-19"
FT                   /inference="protein motif:PFAM:PF00597"
FT   misc_feature    join(293636..293704,293747..293815,293909..293977,
FT                   294020..294088)
FT                   /note="4 probable transmembrane helices predicted for
FT                   YE0254 by TMHMM2.0 at aa 24-46, 61-83, 115-137 and 152-174"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             294370..295824
FT                   /transl_table=11
FT                   /gene="rumC"
FT                   /locus_tag="YE0255"
FT                   /product="putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0255"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10389"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF1"
FT                   /protein_id="CAL10389.1"
FT                   /translation="MSQQRNKAQQDIERRLLEQSLQQSQQNTLELQALLQRNEQQLRQS
FT                   ELEQRNLHSQLAANAEKLQQLAHWRNECEQLNQELRAQREVNSAQEAELREVTIRLEET
FT                   RLTAEEKQRLLLNSEQRLTTQFENLANRIFEQTGRRADEQNKQSLDRLLLPLREQLDGF
FT                   RRQVQDSFGQEARERHTLTHEIRSLQQLNAQMAREALNLTKALKGDNKTQGNWGEVVLA
FT                   KVLEASGLREGYEYQTQVSVKIDTNSRMQPDVIVRLPQGKDVVIDAKMSLIAYERYFNS
FT                   EDDIEREAALSEHLSSLRAHIRMLGRKDYQQLPGLRSLDYVLMFIPVEPAFLVAIDRQP
FT                   ELISEALQHNIMLVSPTTLLVALRTITNLWRYEHQSQNAQRIAERAAKLYDKLRLFVDD
FT                   MESLGQSLDKAQLSYRQAMNKLSQGRGNLIGQVEGFRTLGVEVKRPISPTLAEKASLED
FT                   QPEDDLALSDDAESEISDSAPLKYQG"
FT   misc_feature    294718..295770
FT                   /note="Pfam match to entry PF02646 DUF195, Uncharacterized
FT                   BCR, YigN family, COG1322, score 615.2, E-value 2.4e-182"
FT                   /inference="protein motif:PFAM:PF02646"
FT   misc_feature    295459..295524
FT                   /note="Predicted helix-turn-helix motif with score 998.000,
FT                   SD 2.59 at aa 364-385, sequence RTITNLWRYEHQSQNAQRIAER"
FT   CDS             295958..296713
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="YE0256"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10390"
FT                   /db_xref="GOA:A1JIF2"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIF2"
FT                   /protein_id="CAL10390.1"
FT                   /translation="MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSF
FT                   GVHRIWKRFTIDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVVLADINESMLRMG
FT                   REKLRDKGIVGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPG
FT                   GRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDSESYRYLAESIRMHPDQETLK
FT                   SMMMDAGFENVTYSNLTGGIVALHRGFKF"
FT   misc_feature    295997..296707
FT                   /note="Pfam match to entry PF01209
FT                   Ubie_methyltran,ubiE/COQ5 methyltransferase family, score
FT                   531.6, E-value 3.6e-157"
FT                   /inference="protein motif:PFAM:PF01209"
FT   misc_feature    296063..296110
FT                   /note="PS01183 ubiE/COQ5 methyltransferase family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS01183"
FT   misc_feature    296429..296473
FT                   /note="PS01184 ubiE/COQ5 methyltransferase family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01184"
FT   CDS             296757..297380
FT                   /transl_table=11
FT                   /locus_tag="YE0257"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10391"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF3"
FT                   /protein_id="CAL10391.1"
FT                   /translation="MSLKPTLLSPLITAAIETSLNSVLFRDKSLKAARLRLAGKVLSIE
FT                   LREVSFPLLLVFSERQVDVLSQWDGDADCTVTTNVAVLAKLRDRQQLSPLMRSGELIVE
FT                   GDIQVVQQLITLLDLAEWEPAEWLAPYIGDIAAETIGQVIHKSNRFLSKQFQQQQHYVA
FT                   EAITEEWKIAPAPLEVVWFNEEVDATARATEALTARLATMETKQ"
FT   CDS             297377..299008
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="YE0258"
FT                   /product="ubiquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10392"
FT                   /db_xref="GOA:A1JIF4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIF4"
FT                   /protein_id="CAL10392.1"
FT                   /translation="MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLP
FT                   NRHKDKPLGERLRLALQELGPVWIKFGQMMSTRRDLFPPAIADQLALLQDRVAPFDGAL
FT                   ARKHIEIAMGGPLETWFDDFEQEALASASIAQVHTARLKENGQEVVLKVIRPDILPIIK
FT                   ADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDS
FT                   PMLYIPEVYSDYCRESVLVMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRD
FT                   SFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVA
FT                   ELHVDSGWVPCDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQP
FT                   QLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAE
FT                   KFPELPELVYDSLQQHKLLQQSVDKLTTQMQGQQQRQGQSRYLFGVGATLLVSGTILFL
FT                   ANAVEISIGFIVAGVLAWFIGWRRTS"
FT   misc_feature    297707..298069
FT                   /note="Pfam match to entry PF03109 ABC1, ABC1 family ,score
FT                   194.8, E-value 8.8e-56"
FT                   /inference="protein motif:PFAM:PF03109"
FT   misc_feature    298925..298993
FT                   /note="1 probable transmembrane helix predicted for YE0258
FT                   by TMHMM2.0 at aa 517-539"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             299209..299475
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /gene_synonym="mtta1"
FT                   /gene_synonym="b3836"
FT                   /locus_tag="YE0259"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:YE0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10393"
FT                   /db_xref="GOA:A1JIF5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF5"
FT                   /protein_id="CAL10393.1"
FT                   /translation="MGGISIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAMGD
FT                   EPQTPPTDANKTSNDADFAKSITEKQQPVAKAEESKSHDKEQG"
FT   misc_feature    299218..299271
FT                   /note="1 probable transmembrane helix predicted for YE0259
FT                   by TMHMM2.0 at aa 4-21"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    299218..299406
FT                   /note="Pfam match to entry PF02416 MttA_Hcf106,mttA/Hcf106
FT                   family, score 38.9, E-value 7.4e-09"
FT                   /inference="protein motif:PFAM:PF02416"
FT   CDS             299479..300135
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /gene_synonym="mtta2"
FT                   /locus_tag="YE0260"
FT                   /product="Sec-independent protein translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:YE0260"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10394"
FT                   /db_xref="GOA:A1JIF6"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIF6"
FT                   /protein_id="CAL10394.1"
FT                   /translation="MFDIGFSELLLVLVIGLVVLGPERLPVAVRTVAGWIRTLRSLAAT
FT                   VQNELAQELKIQELQDSLKKAEEAGLQNLTPELKASMDELKEAAEALKRSYHSDIGLEA
FT                   PHTIHNPLVTEPEAIHDGVTPAESATKAQASPQAPATDVDKTVTPTAVETASNNNEKPI
FT                   VQVETFSASISSVDREPVPVTNTPVTKVQTATVDTHSTDSHGADQPRTHQPGGDR"
FT   misc_feature    299488..299688
FT                   /note="Pfam match to entry PF02416 MttA_Hcf106,mttA/Hcf106
FT                   family, score 7.5, E-value 0.00068"
FT                   /inference="protein motif:PFAM:PF02416"
FT   CDS             300138..300917
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /gene_synonym="mttB"
FT                   /locus_tag="YE0261"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:YE0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10395"
FT                   /db_xref="GOA:A1JIF7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF7"
FT                   /protein_id="CAL10395.1"
FT                   /translation="MAVDDTQPLITHLIELRKRLLNCIITILVVFFVLVFFANDIYHLV
FT                   SAPLIKQLPVGSSMIATDVASPFFTPIKLTMMVSVFVSAPMILYQVWAFIAPALYKHER
FT                   RLMVPLLISSSFLFYLGMAFAYFVVFPLAFGFFAKTAPESVLIATDITKYLDFVMALFM
FT                   AFGISFEVPIAIILLCWAGVTTPEALKKKRPYVFVAAFVVGMLLTPPDVLSQTLLAIPM
FT                   YLLFEVGVFFARFYTGKQRRSDVEEEDEEVDNHPKES"
FT   misc_feature    300189..300800
FT                   /note="Pfam match to entry PF00902 UPF0032, MttB family
FT                   UPF0032, score 327.6, E-value 9.5e-96"
FT                   /inference="protein motif:PFAM:PF00902"
FT   misc_feature    join(300195..300263,300357..300425,300483..300551,
FT                   300609..300677,300714..300767,300777..300845)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0261 by TMHMM2.0 at aa 20-42, 74-96, 116-138,
FT                   158-180,193-210 and 214-236"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    300597..300656
FT                   /note="PS01218 Uncharacterized protein family UPF0032
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01218"
FT   CDS             300973..301755
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /gene_synonym="mttC"
FT                   /locus_tag="YE0262"
FT                   /product="deoxyribonuclease TatD (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:YE0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10396"
FT                   /protein_id="CAL10396.1"
FT                   /translation="MFDIGVNLTSSQFTKDCPQVVARAKEAGVAGMLITGTNAEESQAA
FT                   LELTIAYPDYCWSTAGVHPHHASSWQIDVEQQIRALAAHVSVVAIGECGLDFNRNFSTP
FT                   VEQEVAFTAQLALAAELSLPVFLHCREAHDRFITLLSPWLDKIPAAVVHCFTGTADELD
FT                   SCLALGLSIGITGWVCDERRGLALRALLPRIPAQQLLLETDAPYLLPRDIHPKPASRRN
FT                   EPCFLPHIVQQVAVWRQEDPQWLGQKTDENARRIFRLV"
FT   misc_feature    300988..301746
FT                   /note="Pfam match to entry PF01026 TatD_DNase, TatD related
FT                   DNase, score 331.5, E-value 6.2e-97"
FT                   /inference="protein motif:PFAM:PF01026"
FT   misc_feature    301342..301374
FT                   /note="PS01090 Uncharacterized protein family UPF0006
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01090"
FT   misc_feature    301540..301590
FT                   /note="PS01091 Uncharacterized protein family UPF0006
FT                   signature 3."
FT                   /inference="protein motif:Prosite:PS01091"
FT   CDS             301770..302792
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /gene_synonym="ncf"
FT                   /locus_tag="YE0263"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10397"
FT                   /db_xref="GOA:A1JIF9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIF9"
FT                   /protein_id="CAL10397.1"
FT                   /translation="MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVME
FT                   GNNHQQAVSSMPGVSRMTIDLLVKEAEAIAKLGVPVISLFPVIESGMKSLHAEEAYNPN
FT                   GLVQRTVRALKDAVPELGILTDVALDPYTTHGQDGVIDADGYVINDITKEILVRQALSH
FT                   ADAGAEIVAPSDMMDGRIGAIRDQLELQGLVNTQIMAYSAKYASCYYGPFRDAIGSSSN
FT                   LKGGNKKTYQMDPANSDEALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPIFA
FT                   YQVSGEYAMHMAAIQNGWLQEKPTVMESLLCFKRAGADGVLTYFAKQVAQWLHDDQMQR
FT                   "
FT   misc_feature    301779..302771
FT                   /note="Pfam match to entry PF00490
FT                   ALAD,Delta-aminolevulinic acid dehydratase, score
FT                   663.1,E-value 9.4e-197"
FT                   /inference="protein motif:PFAM:PF00490"
FT   misc_feature    302523..302561
FT                   /note="PS00169 Delta-aminolevulinic acid dehydratase active
FT                   site."
FT                   /inference="protein motif:Prosite:PS00169"
FT   CDS             complement(302881..303369)
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /gene_synonym="hlyT"
FT                   /gene_synonym="sfrB"
FT                   /locus_tag="YE0264"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10398"
FT                   /db_xref="GOA:A1JIG0"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR010215"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIG0"
FT                   /protein_id="CAL10398.1"
FT                   /translation="MKHWHLLYCKRGQLLRAKEHLERQEVNCWTPIVTIEKIMRGKRIE
FT                   TTEALFPNYLFVEFDPEHIHTTTISATRGVSHFVRFGVQPAVIPATVISEMQSHTTDKI
FT                   IAPEIPTPGDTVIIKEGVFAGLQAIYTEPDGEARSMLLLNMLNSPVLQSLDNRQFEKQ"
FT   CDS             303638..305134
FT                   /transl_table=11
FT                   /locus_tag="YE0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10399"
FT                   /db_xref="GOA:A1JIG1"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIG1"
FT                   /protein_id="CAL10399.1"
FT                   /translation="MISMKYRDLRDFLSLLEQRGELKRISQPIDPYLEMTEIADRTLRA
FT                   GGPALLFENPKGYNMPVLCNLFGTAKRVAMGMGQEDVSALRDVGKLLAFLKEPDPPKGF
FT                   RDLFDKLPKFKQVLNMPTKCLSSAPCQEQVWEGEDVDLSRIPVMHCWPEDAAPLVSWGL
FT                   TVTRGPHKERQNLGIYRQQVLGKNKLIMRWLSHRGGALDYQEWCEAHPGERFPVAVALG
FT                   ADPATILAAVTPVPDTLSEYAFAGLLRGHKTEVVKCLSNSLEVPASAEIVLEGYIEQGE
FT                   MAPEGPYGDHTGYYNEIDSFPVFTVTHITQRKDAIYHSTYTGRPPDEPAVMGVALNEVF
FT                   VPILQKQFPEIVDFYLPPEGCSYRLAVVTIKKQYAGHAKRVMMGVWSFLRQFMYTKFVI
FT                   VCDDDINARDWNDVIWAITTRMDPSRDTVLIENTPIDYLDFASPVSGLGSKMGLDATNK
FT                   WPAETPREWGRPIKMDEEVRARVDAIWDELAIFSDKETKR"
FT   misc_feature    303674..304948
FT                   /note="Pfam match to entry PF01977 UPF0096, VdcC family
FT                   ,score 820.0, E-value 5.6e-244"
FT                   /inference="protein motif:PFAM:PF01977"
FT   CDS             305189..305890
FT                   /transl_table=11
FT                   /gene="fadI"
FT                   /gene_synonym="fre"
FT                   /gene_synonym="flrD"
FT                   /gene_synonym="fsrC"
FT                   /gene_synonym="ubiB"
FT                   /locus_tag="YE0266"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10400"
FT                   /db_xref="GOA:A1JIG2"
FT                   /db_xref="InterPro:IPR001221"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIG2"
FT                   /protein_id="CAL10400.1"
FT                   /translation="MTTLSCKVTSVEAITDTVYRVQLVPASAFSFRAGQYLMVVMDERD
FT                   KRPFSMASTPLQKDSIELHIGASELNLYAMAVMDRILQEKTLDVDIPHGEAWFREGSHR
FT                   PLILIAGGTGFSYARSILLAALAEQPDREVSIYWGGREAVHLYDLSELEALSIQYPQLK
FT                   VIPVVEQPEEGWRGRTGTVLSAVLQDYGSLAEQDIYIAGRFEMAKIARERFCAERGALE
FT                   AHIYGDAFAFI"
FT   misc_feature    305201..305479
FT                   /note="Pfam match to entry PF00970
FT                   FAD_binding_6,Oxidoreductase FAD-binding domain, score
FT                   11.9, E-value 6e-05"
FT                   /inference="protein motif:PFAM:PF00970"
FT   misc_feature    305495..305827
FT                   /note="Pfam match to entry PF00175
FT                   NAD_binding_1,Oxidoreductase NAD-binding domain, score
FT                   125.7, E-value 5.5e-35"
FT                   /inference="protein motif:PFAM:PF00175"
FT   CDS             complement(305990..307153)
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /gene_synonym="oldA"
FT                   /locus_tag="YE0267"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10401"
FT                   /db_xref="GOA:A1JIG3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIG3"
FT                   /protein_id="CAL10401.1"
FT                   /translation="MENVVIIDAVRTPMGRSKGGAFRQVRAEDLSAHLMREVLSRNPEL
FT                   NAAEIDDIYWGCVQQTLEQGFNIARNASLLAEIPHSVPAVTVNRLCGSSMQALHDGARA
FT                   IMVGDAQVSLIGGVEHMGHVPMNHGVDFHPGMGRTVAKAAGMMGLTAEMLAKIHNISRQ
FT                   SQDEFAVRSHQRAYAATQADHFAKEIVATNGHDADGILKRFDFDEVIRPETNLAGLAAL
FT                   RPAFDPVNGTVTAGTSSALSDGASAMLIMSESRAKSLGLTPRARIRSMAVVGCDPSIMG
FT                   YGPVPASQLALKRAGLKLEDIGLFELNEAFAAQSLACLKGLGLLESMDDKVNLNGGAIA
FT                   LGHPLGCSGARISTTLLNLMERRDVQFGLATMCIGLGQGIATIFERV"
FT   misc_feature    complement(305996..306379)
FT                   /note="Pfam match to entry PF02803 thiolase_C,
FT                   Thiolase,C-terminal domain, score 271.4, E-value 7.5e-79"
FT                   /inference="protein motif:PFAM:PF02803"
FT   misc_feature    complement(306011..306052)
FT                   /note="PS00099 Thiolases active site."
FT                   /inference="protein motif:Prosite:PS00099"
FT   misc_feature    complement(306107..306157)
FT                   /note="PS00737 Thiolases signature 2."
FT                   /inference="protein motif:Prosite:PS00737"
FT   misc_feature    complement(306392..307153)
FT                   /note="Pfam match to entry PF00108 thiolase,
FT                   Thiolase,N-terminal domain, score 432.9, E-value 1.8e-127"
FT                   /inference="protein motif:PFAM:PF00108"
FT   misc_feature    complement(306440..306472)
FT                   /note="PS00178 Aminoacyl-transfer RNA synthetases class-I
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00178"
FT   misc_feature    complement(306839..306895)
FT                   /note="PS00098 Thiolases acyl-enzyme intermediate
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00098"
FT   CDS             complement(307165..309354)
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /gene_synonym="oldB"
FT                   /locus_tag="YE0268"
FT                   /product="fatty acid oxidation complex alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YE0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10402"
FT                   /db_xref="GOA:A1JIG4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIG4"
FT                   /protein_id="CAL10402.1"
FT                   /translation="MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTQTVANLGEALVV
FT                   LEKQSELKGLLLRSAKAAFIVGADITEFLSLFNEPPEKLHQWLVFANDIFNRLEDLPVP
FT                   TIAAINGYALGGGCECILATDFRVASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSA
FT                   LEIIAAGKDIIAKDALKVGLVDAVVAPEKLVDAALSILNQAIDGKLDWQAARRPKLEPL
FT                   KLNPTEAAMCFTIAKGMVMQVAGKHYPAPLTAVKTIEAAAKFGRAEALILETNSFVPLA
FT                   GSNEARALVGIFLNDQYVKGQAKKLSKGVSAPKQAAVLGAGIMGGGIAYQSALKGVPVI
FT                   MKDINDKSLTLGMNEAAKLLNKQLERGKIDGLKMANILATIQPTLDYAGIERAQVIVEA
FT                   VVENPKVKAAVLAEVETLIGEETVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRM
FT                   PLVEIIRGTKTSDKTIAAVVAYATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDG
FT                   ADFRQIDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAVGFPERMNKDYRDAVDVMF
FT                   DNQRFGQKNGQGFYRYTQDTKGKPRKENDEQVDALLAQVSQPLQKFSDDDIIARTMIPM
FT                   INEVVRCLEEGIIASPAEGDMALVYGLGFPPFHGGVFRYLDTIGSANYVEMAQRYTHLG
FT                   ALYQVPPGLRAKAEHNESYYPVAAALLDVSISQPA"
FT   misc_feature    complement(307579..307869)
FT                   /note="Pfam match to entry PF00725 3HCDH,3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain, score 130.6, E-value
FT                   1.9e-36"
FT                   /inference="protein motif:PFAM:PF00725"
FT   misc_feature    complement(307804..307878)
FT                   /note="PS00067 3-hydroxyacyl-CoA dehydrogenase signature."
FT                   /inference="protein motif:Prosite:PS00067"
FT   misc_feature    complement(307873..308427)
FT                   /note="Pfam match to entry PF02737
FT                   3HCDH_N,3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
FT                   ,score 348.3, E-value 5.5e-102"
FT                   /inference="protein motif:PFAM:PF02737"
FT   misc_feature    complement(308788..309303)
FT                   /note="Pfam match to entry PF00378 ECH, Enoyl-CoA
FT                   hydratase/isomerase family, score 280.2, E-value 1.7e-81"
FT                   /inference="protein motif:PFAM:PF00378"
FT   misc_feature    complement(308977..309039)
FT                   /note="PS00166 Enoyl-CoA hydratase/isomerase signature."
FT                   /inference="protein motif:Prosite:PS00166"
FT   misc_feature    complement(309001..309033)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             309626..310975
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="YE0269"
FT                   /product="proline dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10403"
FT                   /db_xref="GOA:A1JIG5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIG5"
FT                   /protein_id="CAL10403.1"
FT                   /translation="METLASLYNEHLSTLQQRTRDVLERHQLDALLIHSGELQRIFLDD
FT                   RDYPFKVNAQFKAWVPVTQVPNCWLWVDGVNTPKLWFYSPVDYWHCVEPLPDSFWTKAI
FT                   DIQPLVNANDIAQLLPVQRERVAYIGYAQQRAQALGFSAENINPKPVLDYLHFYRSYKT
FT                   DYELACMREAQKTAVAGHNAAHEAFLSGMSEFDINLAYLMATGQRDTDVPYDNIVALNE
FT                   HSAVLHYTTLQHQPPAEIRSFLIDAGAEYNGYAADLTRTYVAGSKNTADSKNDFAALIK
FT                   DLNNEQLGLIKTLKCGVNYTEYNVQMHQRIAKLLRTHNLVTGISEEAMVEQGITCPFLP
FT                   HGLGHPLGLQVHDTAGFMQDDKGAHLSAPSKYPYLRCTRILQPRMVLTIEPGLYFIESL
FT                   LAPWRSGEFSQHFNWDLIETLKPYGGIRIEDNIVIHENRVENMTRDLKLA"
FT   misc_feature    310103..310945
FT                   /note="Pfam match to entry PF00557
FT                   Peptidase_M24,metallopeptidase family M24, score 254.0,
FT                   E-value 1.4e-73"
FT                   /inference="protein motif:PFAM:PF00557"
FT   misc_feature    310646..310684
FT                   /note="PS00491 Aminopeptidase P and proline dipeptidase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00491"
FT   CDS             join(310975..311253,311257..311589)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0270"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="Similar to many proteins of undefined function
FT                   including: Escherichia coli hypothetical protein YigZ or
FT                   b3848 SWALL:YIGZ_ECOLI (SWALL:P27862) (204 aa) fasta
FT                   scores: E(): 3.1e-46, 62.25 38d in 204 aa and to
FT                   Arabidopsis thaliana hypothetical protein SWALL:AAM63017
FT                   (EMBL:AY085801) (234 aa) fasta scores: E(): 1.7e-15,38.85
FT                   38d in 157 aa. Note this CDS contains a stop codon after
FT                   codon 93."
FT                   /db_xref="PSEUDO:CAL10404.1"
FT                   /inference="similar to sequence:INSDC:AY085801"
FT                   /inference="similar to sequence:UniProtKB:P27862"
FT   misc_feature    311023..311253
FT                   /note="Pfam match to entry PF01205 UPF0029,Uncharacterized
FT                   protein family UPF0029, score 56.0,E-value 5.4e-14"
FT                   /inference="protein motif:PFAM:PF01205"
FT   misc_feature    311242..311253
FT                   /note="PS00294 Prenyl group binding site (CAAX box)."
FT                   /inference="protein motif:Prosite:PS00294"
FT   misc_feature    311269..311361
FT                   /note="Pfam match to entry PF01205 UPF0029,Uncharacterized
FT                   protein family UPF0029, score 48.1,E-value 1.5e-13"
FT                   /inference="protein motif:PFAM:PF01205"
FT   CDS             311626..313077
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="YE0272"
FT                   /product="Trk system potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:YE0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10405"
FT                   /db_xref="GOA:A1JIG7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIG7"
FT                   /protein_id="CAL10405.1"
FT                   /translation="MHFRAITRIVGLLVILFSGTMFIPGLVALIYRDGAGRAFSETFFV
FT                   ALSIGLLLWLPNRKQKHELKPREGFLIVVLFWTVLGSVGALPFLFSERPNLSLTDAFFE
FT                   SFSGLTTTGATTLVGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPILGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACALSLWAAGMSVFDAISHSFSTIAIGG
FT                   FSTHDASIGYFNSPTINTIIGIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRMFIFVQ
FT                   LTLVIVCTLVLWQHSVYKSGLETLNQAFFQVVSMATTAGFTTDSISKWPLFLPILLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLYLQGSRELKRLVHPNAVYTIKLGRRALPERILEAVWG
FT                   FFSAYALVFIISMLAIIATGVDEFSAFAAVTATLNNLGPGLGVVADNFTSMNPAAKWIL
FT                   VITMLFGRLEVFTLLVLFTPTFWRE"
FT   sig_peptide     311626..311709
FT                   /gene="trkH"
FT                   /locus_tag="YE0272"
FT                   /note="Signal peptide predicted for YE0272 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.913) with cleavage site
FT                   probability 0.705 between residues 28 and 29"
FT   misc_feature    join(311650..311718,311728..311796,311830..311898,
FT                   312022..312090,312178..312246,312337..312405,
FT                   312442..312510,312616..312684,312811..312879,
FT                   312889..312957,312991..313059)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0272 by TMHMM2.0 at aa 9-31, 35-57, 69-91,
FT                   133-155,185-207, 238-260, 273-295, 331-353, 396-418,
FT                   422-444 and 456-478"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    311812..313068
FT                   /note="Pfam match to entry PF02386 TrkH, Cation transport
FT                   protein, score 539.5, E-value 1.5e-159"
FT                   /inference="protein motif:PFAM:PF02386"
FT   misc_feature    312181..312213
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    312346..312378
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             313099..313632
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="YE0273"
FT                   /product="protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10406"
FT                   /db_xref="GOA:A1JIG8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIG8"
FT                   /protein_id="CAL10406.1"
FT                   /translation="MKVLILYSSRDGQTQTIASYIAKELSTAATCEIRDLAEVGQIDLS
FT                   QYQQVMIGASVRYGHFSPVLSKFVNKHVEQLNQMPSAFFAVNLTARKPEKRSPQTNAYV
FT                   RKFLLSTPWQPTLCAVFAGALRYPRYRWIDRVMIQLIMRMTGGETDTSKEVEYTDWQQV
FT                   SGFAQDFSVLQYEK"
FT   misc_feature    313102..313224
FT                   /note="Pfam match to entry PF00258 flavodoxin, Flavodoxin,
FT                   score 18.4, E-value 1.9e-05"
FT                   /inference="protein motif:PFAM:PF00258"
FT   misc_feature    313111..313161
FT                   /note="PS00201 Flavodoxin signature."
FT                   /inference="protein motif:Prosite:PS00201"
FT   rRNA            314127..315615
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT                   /note="match to 16S_rRNA 1..1461 (Y.enterocolitica 16S)"
FT   tRNA            315840..315915
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu (TTC)"
FT   rRNA            316294..319287
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT                   /note="match to 23S_rRNA 1..2994 (Y. enterocolitica 23S
FT                   EMBL:U77925, Y.pestis KIM 98 38dentity, Citrobacter
FT                   freundii 23S EMBL:U77928 94 38dentity)"
FT   rRNA            319287..319527
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT                   /note="match to 5SrRNA 1..240 Y.enterocolitica"
FT   CDS             319709..320746
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="YE0274"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10407"
FT                   /db_xref="GOA:A1JIG9"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIG9"
FT                   /protein_id="CAL10407.1"
FT                   /translation="MSNQRTPLKHLNTFALSAYASNVISANSTQELIDAWHESVSKHQP
FT                   VLLLGEGSNVLFIENYSGTVLLNRIKGITFTEDDTAWHLHVGAGENWHQLVCYSLQNNM
FT                   PGLENLALIPGCVGSAPIQNIGAYGVELQKVCEYVDLLDLEKGTVRRLSAEDCQFGYRD
FT                   SIFKHHYGHGFAIIAVGIRLIKSWVPTLGYGDLTRMDPLTVTAIDIFNSVCAMRRSKLP
FT                   DPTVTGNAGSFFKNPVVDAAVAEDIVKLYPNAPHYPQPDGTVKLAAGWLIDQCALKGYQ
FT                   IGGAAVHQQQALVLINLAEATGQDVLGLASHIRQQVAKKFAIWLEPEVRFIASNGEVNA
FT                   VERLS"
FT   sig_peptide     319709..319783
FT                   /gene="murB"
FT                   /locus_tag="YE0274"
FT                   /note="Signal peptide predicted for YE0274 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.923) with cleavage site
FT                   probability 0.604 between residues 25 and 26"
FT   misc_feature    319766..320233
FT                   /note="Pfam match to entry PF01565 FAD_binding_4, FAD
FT                   binding domain, score 34.7, E-value 1.4e-07"
FT                   /inference="protein motif:PFAM:PF01565"
FT   misc_feature    320324..320707
FT                   /note="Pfam match to entry PF02873
FT                   MurB_C,UDP-N-acetylenolpyruvoylglucosamine reductase,
FT                   C-terminal domain, score 209.9, E-value 2.6e-60"
FT                   /inference="protein motif:PFAM:PF02873"
FT   CDS             320743..321702
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /gene_synonym="bioR"
FT                   /gene_synonym="dhbB"
FT                   /locus_tag="YE0275"
FT                   /product="bifunctional protein BirA"
FT                   /db_xref="EnsemblGenomes-Gn:YE0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10408"
FT                   /db_xref="GOA:A1JIH0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIH0"
FT                   /protein_id="CAL10408.1"
FT                   /translation="MKDIKVPLRLIGILADGAFHSGEQLGEMLGMSRAAINKHMHTIRE
FT                   WGLDVFTVPGKGYSLPAPIQLLDEQTILSYLPAGQVAVLPVVDSTNQYLLDRITELKSG
FT                   DACVAEYQQAGRGRRGRQWVSPFGANLYLSMFWRLEQGPAAAMGLSLVVGIVMAEVLHK
FT                   LGAEHVRVKWPNDLYLNDKKLAGILVELTGKTGDAAQLVIGAGINLTMRESTTNVISQD
FT                   WINLQEAGVNIDRNKLTAELLSELRLAVVKFENEGLPAFISRWREMDNYLDRPVKLIIG
FT                   NQEIFGIARGIDQQGALLLEQDGNIKPYIGGEISLRGV"
FT   misc_feature    320800..320865
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1520.000, SD 4.36 at aa 20-41, sequence
FT                   HSGEQLGEMLGMSRAAINKHMH"
FT   misc_feature    320977..321387
FT                   /note="Pfam match to entry PF03099
FT                   BPL_LipA_LipB,Biotin/lipoate A/B protein ligase family,
FT                   score 133.9,E-value 1.9e-37"
FT                   /inference="protein motif:PFAM:PF03099"
FT   misc_feature    321553..321693
FT                   /note="Pfam match to entry PF02237 BPL_C, Biotin protein
FT                   ligase C terminal domain, score 63.5, E-value 2.9e-16"
FT                   /inference="protein motif:PFAM:PF02237"
FT   CDS             complement(321742..322692)
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /gene_synonym="rts"
FT                   /gene_synonym="panK"
FT                   /locus_tag="YE0276"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10409"
FT                   /db_xref="GOA:A1JIH1"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH1"
FT                   /protein_id="CAL10409.1"
FT                   /translation="MTKRDQSLATPYLQFDRTQWAALRDSVPLTLTEEEIVKLKGINED
FT                   LSLDEVAQIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQRIPYVIGIAGSVAVGKSTT
FT                   ARLLQALLSRWPEHRSVELITTDGFLYPNKVLNERGLMKKKGFPQSYDMHSLVKFVSEV
FT                   KSGADHVTAPVYSHLIYDIVPDGNKIIKQPDILILEGLNVLQSGMDYPHDPHHVFVSDF
FT                   VDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNYAKLPETEAVKIATQLWKEI
FT                   NGLNLKQNILPTRERASLIMTKSANHAVESVRLRK"
FT   misc_feature    complement(321754..322425)
FT                   /note="Pfam match to entry PF00485 PRK,Phosphoribulokinase
FT                   / Uridine kinase family, score -29.3,E-value 8.4e-07"
FT                   /inference="protein motif:PFAM:PF00485"
FT   misc_feature    complement(322387..322410)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(322902..323453)
FT                   /transl_table=11
FT                   /locus_tag="YE0277"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10410"
FT                   /db_xref="GOA:A1JIH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIH2"
FT                   /protein_id="CAL10410.1"
FT                   /translation="MKIVLLNAATLPIYRSELAHLLIDAVSHGASIGYSTRDLSQNEAE
FT                   NYYHSLHPAITKGTLLLWIARDETGVVGTIQLDLCQKPNGLNRAEVQKLLVHSRSRRAG
FT                   VGHKLVIEMENTAVQLRRGLLYLDTEAGSPAESFYRTQGYRCMGEIPDYACTPDGYYHP
FT                   TAIYFKRLFSVNQAHTSIAS"
FT   misc_feature    complement(323019..323267)
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 43.5,
FT                   E-value 3.1e-10"
FT                   /inference="protein motif:PFAM:PF00583"
FT   tRNA            323856..323931
FT                   /gene="tRNA-Thr (TGT)"
FT                   /product="transfer RNA-Thr (TGT)"
FT   tRNA            323950..324034
FT                   /gene="tRNA-Tyr (GTA)"
FT                   /product="transfer RNA-Tyr (GTA)"
FT   misc_RNA        324050..324207
FT                   /note="RtT RNA (RF00391) as predicted by Rfam, score
FT                   100.37, positions 1 to 171"
FT   tRNA            324352..324426
FT                   /gene="tRNA-Gly (TCC)"
FT                   /product="transfer RNA-Gly (TCC)"
FT   tRNA            324433..324508
FT                   /gene="tRNA-Thr (GGT)"
FT                   /product="transfer RNA-Thr (GGT)"
FT   CDS             324617..325801
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="YE0278"
FT                   /product="elongation factor TU"
FT                   /note="Similar to Yersinia pestis elongation factor TU TufA
FT                   or Ypo0203 SWALL:Q8ZJB2 (EMBL:AJ414141) (394 aa) fasta
FT                   scores: E(): 1.4e-143, 97.2 38d in 393 aa and to
FT                   Escherichia coli elongation factor TU (TufA or B3339) and
FT                   (TufB or B3980) SWALL:EFTU_ECOLI (SWALL:P02990) (393 aa)
FT                   fasta scores: E(): 2.6e-141, 94.64 38d in 392 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10411"
FT                   /db_xref="GOA:A1JIH3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH3"
FT                   /inference="similar to sequence:INSDC:AJ414141"
FT                   /inference="similar to sequence:UniProtKB:P02990"
FT                   /protein_id="CAL10411.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDF
FT                   PGDDTPVVRGSALKALEGEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIQMIVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE"
FT   misc_feature    324644..325228
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 326.6, E-value 1.9e-95"
FT                   /inference="protein motif:PFAM:PF00009"
FT   misc_feature    324671..324694
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    324767..324814
FT                   /note="PS00301 GTP-binding elongation factors signature."
FT                   /inference="protein motif:Prosite:PS00301"
FT   misc_feature    325262..325498
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 109.0, E-value 5.9e-30"
FT                   /inference="protein motif:PFAM:PF03144"
FT   misc_feature    325508..325795
FT                   /note="Pfam match to entry PF03143 GTP_EFTU_D3, Elongation
FT                   factor Tu C-terminal domain, score 213.1, E-value 2.7e-61"
FT                   /inference="protein motif:PFAM:PF03143"
FT   CDS             326041..326424
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /gene_synonym="prlG"
FT                   /locus_tag="YE0279"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YE0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10412"
FT                   /db_xref="GOA:A1JIH4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIH4"
FT                   /protein_id="CAL10412.1"
FT                   /translation="MSANTEAPGSGRGLETAKWLIVAVLLVAAIVGNYYYRDFSLPLRA
FT                   LAVVVIIAVAGAVALMTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   misc_feature    join(326095..326148,326161..326229,326320..326388)
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0279 by TMHMM2.0 at aa 19-36, 41-63 and 94-116"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    326239..326409
FT                   /note="Pfam match to entry PF00584 SecE, SecE/Sec61-gamma
FT                   subunits of protein translocation complex, score
FT                   97.3,E-value 2e-26"
FT                   /inference="protein motif:PFAM:PF00584"
FT   misc_feature    326251..326337
FT                   /note="PS01067 Protein secE/sec61-gamma signature."
FT                   /inference="protein motif:Prosite:PS01067"
FT   CDS             326426..326971
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="YE0280"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10413"
FT                   /db_xref="GOA:A1JIH5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIH5"
FT                   /protein_id="CAL10413.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHDMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGELVRVSDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFSQVEKG"
FT   misc_feature    326441..326572
FT                   /note="Pfam match to entry PF02357 NusG, Transcription
FT                   termination factor nusG, score 81.1, E-value 1.5e-21"
FT                   /inference="protein motif:PFAM:PF02357"
FT   misc_feature    326807..326920
FT                   /note="Pfam match to entry PF00467 KOW, KOW motif, score
FT                   47.9, E-value 1.5e-11"
FT                   /inference="protein motif:PFAM:PF00467"
FT   misc_feature    326915..326944
FT                   /note="PS01014 Transcription termination factor nusG
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01014"
FT   CDS             327165..327593
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /gene_synonym="relC"
FT                   /locus_tag="YE0281"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:YE0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10414"
FT                   /db_xref="GOA:A1JIH6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH6"
FT                   /protein_id="CAL10414.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESIEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGTVTSA
FT                   QVREIAETKAADMTGASIDDMMRSIEGTARSMGLVVEG"
FT   misc_feature    327186..327365
FT                   /note="Pfam match to entry PF03946
FT                   Ribosomal_L11_N,Ribosomal protein L11, N-terminal domain,
FT                   score 139.4,E-value 4.1e-39"
FT                   /inference="protein motif:PFAM:PF03946"
FT   misc_feature    327378..327584
FT                   /note="Pfam match to entry PF00298 Ribosomal_L11,Ribosomal
FT                   protein L11, RNA binding domain, score 130.4,E-value
FT                   2.2e-36"
FT                   /inference="protein motif:PFAM:PF00298"
FT   misc_feature    327543..327590
FT                   /note="PS00359 Ribosomal protein L11 signature."
FT                   /inference="protein motif:Prosite:PS00359"
FT   CDS             327597..328301
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="YE0282"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:YE0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10415"
FT                   /db_xref="GOA:A1JIH7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH7"
FT                   /protein_id="CAL10415.1"
FT                   /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKEAGAELVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDSEKLKENLESLVVALKRAKPATAKGVYIKKISLSTTMGAGV
FT                   AIDQSGLSAVVN"
FT   misc_feature    327639..328259
FT                   /note="Pfam match to entry PF00687 Ribosomal_L1, Ribosomal
FT                   protein L1p/L10e family, score 432.6, E-value 2.3e-127"
FT                   /inference="protein motif:PFAM:PF00687"
FT   misc_feature    327957..328013
FT                   /note="PS01199 Ribosomal protein L1 signature."
FT                   /inference="protein motif:Prosite:PS01199"
FT   CDS             328676..329179
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="YE0283"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:YE0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10416"
FT                   /db_xref="GOA:A1JIH8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH8"
FT                   /protein_id="CAL10416.1"
FT                   /translation="MALNLQGKQAIVAEVKEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVHMQVVRNTLLSRAVEGTPFECLKDTFVGPTLIAFSSEHPGAAARLFKAFAKDNA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEAIARLMGTMKEAAAGKLVRTLAALRDQKE
FT                   AEAA"
FT   misc_feature    328682..328978
FT                   /note="Pfam match to entry PF00466 Ribosomal_L10,Ribosomal
FT                   protein L10, score 126.4, E-value 3.5e-35"
FT                   /inference="protein motif:PFAM:PF00466"
FT   misc_feature    328760..328801
FT                   /note="PS01109 Ribosomal protein L10 signature."
FT                   /inference="protein motif:Prosite:PS01109"
FT   CDS             329248..329616
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="YE0284"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:YE0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10417"
FT                   /db_xref="GOA:A1JIH9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIH9"
FT                   /protein_id="CAL10417.1"
FT                   /translation="MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAA
FT                   AAEAVEEQTEFNVVLASFGDNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDE
FT                   AESLKKSLEEAGAAVEIK"
FT   misc_feature    329410..329613
FT                   /note="Pfam match to entry PF00542 Ribosomal_L12,Ribosomal
FT                   protein L7/L12 C-terminal domain, score 126.0,E-value
FT                   4.4e-35"
FT                   /inference="protein motif:PFAM:PF00542"
FT   CDS             329960..333988
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /gene_synonym="groN"
FT                   /gene_synonym="nitB"
FT                   /gene_synonym="rif"
FT                   /gene_synonym="ron"
FT                   /gene_synonym="stl"
FT                   /gene_synonym="stv"
FT                   /gene_synonym="tabD"
FT                   /locus_tag="YE0286"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:YE0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10418"
FT                   /db_xref="GOA:A1JII0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JII0"
FT                   /protein_id="CAL10418.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVKECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNFTTAQILD
FT                   LFFEKVVFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKARRITARHIRQLEKDG
FT                   IDRIEVPVEYIAGKVVAKDYIDENTGELICAANMELSLDLLAKLSQAGHKQIETLFTND
FT                   LDHSAYISETLRVDPTSDRLSALVEIYRMMRPGEPPTREAAENLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKEDITEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDGVVTDEINYLSAIEEGNFVIAQANSNLDEDGRFIEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTSVAKRGGTVQYVDASRIVIKVNEDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVNLGEPIERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHAVLVSGGIEADKL
FT                   SKLPRDRWLELGLTDEDKQNQLEQLAEQYDEMKSEFEKKMDAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKKQEEVAKLREFIQKAYDLGDSVCQKVDLSTFTD
FT                   DEVLRLAENLKKGMPIATPVFDGATEKEIKELLQLGGLPTSGQITLFDGRTGEQFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLLKEIRSLGINIELEEE"
FT   misc_feature    330191..333856
FT                   /note="Pfam match to entry PF00562 RNA_pol_B, RNA
FT                   polymerase beta subunit, score 2023.1, E-value 0"
FT                   /inference="protein motif:PFAM:PF00562"
FT   misc_feature    333146..333184
FT                   /note="PS01166 RNA polymerases beta chain signature."
FT                   /inference="protein motif:Prosite:PS01166"
FT   CDS             334125..338345
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /gene_synonym="tabB"
FT                   /locus_tag="YE0287"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:YE0287"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10419"
FT                   /db_xref="GOA:A1JII1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JII1"
FT                   /protein_id="CAL10419.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEAECEILREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEEIRNTEGESTSRTSIIDTTVGR
FT                   AILWMIVPKGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARS
FT                   GASVGIDDMVIPEAKAGIIEEAETEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMDNLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHNGIVMTPVIEGGDVKEPLRDRVLGRVTAEEVIKPGTADILVPRNTLLDEKWCDL
FT                   LEENSVDSVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSLKLSNVKFVTNAAGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAVMAKGDGAEVQGGETVANWDPHIMPVVTEVSGFIRFADMIDGQTITR
FT                   QTDELTGLSSLVVLDSAERTGSGKDLRPALKIVDAKGDDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGIQIGAGDTLARIPQESSGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEIVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVDAGSTDFLEGEQAEMSR
FT                   VKIANRKLAAEGKIEATFTRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRKAQGEAPVVPQVSADEATANLAELLNAGFG
FT                   NSKD"
FT   misc_feature    334827..336617
FT                   /note="Pfam match to entry PF00623 RNA_pol_A, RNA
FT                   polymerase alpha subunit, score 989.5, E-value 5.3e-295"
FT                   /inference="protein motif:PFAM:PF00623"
FT   misc_feature    336846..336950
FT                   /note="Pfam match to entry PF01854 RNA_pol_A2, RNA
FT                   polymerase A/beta/A subunit, score 44.9, E-value 3.7e-13"
FT                   /inference="protein motif:PFAM:PF01854"
FT   misc_feature    338091..338213
FT                   /note="Pfam match to entry PF01854 RNA_pol_A2, RNA
FT                   polymerase A/beta/A subunit, score 37.2, E-value 5.7e-11"
FT                   /inference="protein motif:PFAM:PF01854"
FT   repeat_region   338388..338403
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1660"
FT   repeat_region   complement(338388..339814)
FT                   /note="IS4-like insertion sequence element IS1660"
FT   stem_loop       complement(338389..338420)
FT   CDS             complement(338397..339731)
FT                   /transl_table=11
FT                   /locus_tag="YE0288"
FT                   /product="transposase for insertion sequence element
FT                   IS1660"
FT                   /note="Highly similar to many transposases from the IS
FT                   element IS4 including: Escherichia coli transposase InsG
FT                   for insertion sequence element IS4 SWALL:INSG_ECOLI
FT                   (SWALL:P03835) (442 aa) fasta scores: E(): 6.4e-165,89.31
FT                   38d in 440 aa, and to Pantoea agglomerans insertion element
FT                   protein SWALL:P71168 (EMBL:X81894) (440 aa) fasta scores:
FT                   E(): 9.5e-86, 52.19 38d in 433 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10420"
FT                   /db_xref="GOA:A1JII2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII2"
FT                   /inference="similar to sequence:INSDC:X81894"
FT                   /inference="similar to sequence:UniProtKB:P03835"
FT                   /protein_id="CAL10420.1"
FT                   /translation="MHIGQALDLVSRYDSLRNPLTTLGDYLDPQLISRCLAESGTVTLR
FT                   KRRLPLEMMVWCIVGMALERKEPLHQIVNRLDIMLPGDRPFVAPSAVIQARQRLGSEAV
FT                   RRVFSQTAQLWHGSVTHPHWCGLTLLAVDGVVWRTPDTPENDTAFPRQTYAGQPGLYPQ
FT                   VKMVCQMELTSHLLTAAAFGTMKESEYTLAEQLIDQTADNTLTLMDKGYYSLGLLNAWS
FT                   QAGEHRHWMIPLKKGAQYEEIRKLGKGDHLVKLKTSPQARKKWPELGTEMTARLLTITR
FT                   KGKVYHLLTSMTDTMRYPGGEMADLYGHRWEIELDYREIKQTMQLSRLTLRSKKPELVE
FT                   QELWGVLLAYNLVRYQMIKMAGALKGYWPNQLSFSESCGMVMRMLMTLQGASPGRIPEL
FT                   MRDMESMAQMVKLPIRRERAFPRVVKERPYKYGKARNKNASQLLN"
FT   misc_feature    complement(338676..339353)
FT                   /note="Pfam match to entry PF01609
FT                   Transposase_11,Transposase DDE domain, score 155.9, E-value
FT                   4.6e-44"
FT                   /inference="protein motif:PFAM:PF01609"
FT   repeat_region   complement(339799..339814)
FT                   /rpt_type=INVERTED
FT                   /note="Inverted repeat for IS4-like element IS1660"
FT   CDS             complement(339869..340999)
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="YE0289"
FT                   /product="thiamine biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:YE0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10421"
FT                   /db_xref="GOA:A1JII3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII3"
FT                   /protein_id="CAL10421.1"
FT                   /translation="MSEGFSQRWQQLNWDDISLRINSKTAADVERAINAVKPNRDDLMA
FT                   LISPAALAYLEPMAQKAQQLTRQRFGNTVSFYVPLYLSNLCANDCTYCGFSMSNRIKRK
FT                   TLDETEIIRECEAIKALGFEHLLLVTGEHQAKVGMDYFRRHFPTIRNQFSSLMMEVQPL
FT                   AQEEYAELKTLGLDGVMVYQETYHPATYQQHHLRGHKQDFHWRLATPDRLGRAGIDKIG
FT                   LGALIGLSSSWRTDCYMLAEHLFYLQQTYWQSRYSISFPRLRPCAGGIAPASLMSEPQL
FT                   LQLICAFRLFAPDVELSLSTRESPFFRDNVIPLAINNVSAGSKTQPGGYADNHPELEQF
FT                   APHDNRTPEQVAQALTLAGLQPVWKDWDRHFGRISQ"
FT   CDS             complement(340992..341780)
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="YE0290"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10422"
FT                   /db_xref="GOA:A1JII4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JII4"
FT                   /protein_id="CAL10422.1"
FT                   /translation="MLKIADTTFTSRLFTGTGKFATAELMLEALRASGSQLITMAMKRV
FT                   DLQAGNDAILAPLRQLGVRLLPNTSGAKTAQEAVFAARLAREALGTHWVKLEIHPDVKY
FT                   LLPDPIETLKAAEILVKEGFVVLPYCGADPVLCKRLEEAGCAAVMPLGAPIGSNLGLRT
FT                   RDFLQIIIAQAKVPVVVDAGIGAPSHALEAIELGADAVLVNTAIAVARSPVKMAHAFRL
FT                   AVESGELACQAGLGNRQFDRAIATSPLTGFLSQLEEENHV"
FT   CDS             complement(341782..341997)
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="YE0290A"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0290A"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10423"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII5"
FT                   /protein_id="CAL10423.1"
FT                   /translation="MKSDHINIVLNDQPFEVECTITVEKLLQQLNRHQPGTALAVNQVI
FT                   VPRTDWEKCQLHAGDNILLFQAIAGG"
FT   CDS             complement(341994..342776)
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="YE0291"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0291"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10424"
FT                   /db_xref="GOA:A1JII6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR007901"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII6"
FT                   /protein_id="CAL10424.1"
FT                   /translation="MINKHELSDSEFLRYSRQLLLEDIGPEGQLKLKSACVLIIGLGGL
FT                   GSPAALYLAAAGIGKLLLADDDQLDLSNLQRQILYRTTDINQTSASNQTKVRLAQRHLQ
FT                   NLNPLVEIVSFDIRLTDAALADAVANADLVLDCSDNMTTRHQVNAACITAQKPLISGSA
FT                   VGFSGQLLVIEPPYSQGCYACLYPDKELPQRNCRTAGVLGPVVGVIGTLQALEAIKILA
FT                   GLPSALSGKLRLFDGKQQSWSTLQLTRAKYCPACGGSQ"
FT   misc_feature    complement(342258..342482)
FT                   /note="Pfam match to entry PF00899 ThiF, ThiF family ,score
FT                   65.6, E-value 6.2e-18"
FT                   /inference="protein motif:PFAM:PF00899"
FT   CDS             complement(342760..343371)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="YE0292"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10425"
FT                   /db_xref="GOA:A1JII7"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII7"
FT                   /protein_id="CAL10425.1"
FT                   /translation="MYPVVDSVLWIERLLAAGVTTIQLRIKDLDDAQVEQDIAAAIALG
FT                   KRYQARLFINDYWRLAIKHGAYGVHLGQEDLETTDLAAIQQAGLRLGVSTHDEHELAIA
FT                   KAVRPSYIAMGHIFPTQTKQMPSSPQGLAVLKQMVENTPDYPTVAIGGISIERVPAVLA
FT                   AGVGSVAVVSAITQAEDWQQATAQLLRLIEGKELSDDKQA"
FT   misc_feature    complement(342796..343371)
FT                   /note="Pfam match to entry PF02581 TMP-TENI, Thiamine
FT                   monophosphate synthase/TENI, score 276.6, E-value 2.1e-80"
FT                   /inference="protein motif:PFAM:PF02581"
FT   misc_feature    complement(342889..342918)
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS             complement(343427..345313)
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="YE0293"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:YE0293"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10426"
FT                   /db_xref="GOA:A1JII8"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="UniProtKB/TrEMBL:A1JII8"
FT                   /protein_id="CAL10426.1"
FT                   /translation="MQGVTFPNSQRIYLQGSRPDIQVPMREIQLSPTLIGGGKDSPHYE
FT                   DNEAIPVYDTSGPYGDPSAKLDVHAGLPKLRDSWIADRQDTAALTSVSSGFTQQRLADE
FT                   GLDHLRFEHLPRPKKAVEGKCVTQLHYARQGIITPEMEFIALRENMGRERIRGEVLRQQ
FT                   HPGQSFGAHLPDNITAEFVRQEVAAGRAIIPANINHPESEPMIIGRNFLVKVNANIGNS
FT                   AVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYIHETREWILRNSPVPIGTVPIYQALEK
FT                   VNGVAENLTWEMFRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAKRLTGIVSRGGSIMAK
FT                   WCLSHHQENFLYQHFREICQICATYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELT
FT                   KIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAPFYTLGPLTTDIAPGYDHFTSG
FT                   IGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAKGHPGAQIRDN
FT                   AMSKARFEFRWEDQFNLALDPETARAYHDETLPQESGKVAHFCSMCGPKFCSMKISQEV
FT                   RDYAAKQEQAAAQPIEVLQSGMDQMSAEFRSRGSELYLSPVNLKAEADNETI"
FT   misc_feature    complement(343583..344935)
FT                   /note="Pfam match to entry PF01964 ThiC, ThiC family ,score
FT                   1170.5, E-value 0"
FT                   /inference="protein motif:PFAM:PF01964"
FT   misc_feature    complement(343907..343939)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_RNA        complement(345526..345651)
FT                   /note="TPP riboswitch (THI element) (RF00059) as predicted
FT                   by Rfam, score 80.91, positions 1 to 105"
FT   CDS             complement(345825..346328)
FT                   /transl_table=11
FT                   /gene="rsd"
FT                   /locus_tag="YE0295"
FT                   /product="regulator of sigma D"
FT                   /db_xref="EnsemblGenomes-Gn:YE0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10427"
FT                   /db_xref="GOA:A1JII9"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JII9"
FT                   /protein_id="CAL10427.1"
FT                   /translation="MLNRLESLTQRVGGSNELIDQWLHARKELLVSYCTVIGIKPQKGK
FT                   HTPLNEKALENFCHNLVDYLSSGHFHIYDRIIKQVEGASSPKMALTTKVYPALKNNTQT
FT                   IMAFHDRYTNIEIDDDSCTEFQQALSDIGEALDARFRLEDQLIQWAAESWQAAKPVIQA
FT                   GQVK"
FT   CDS             346420..347205
FT                   /transl_table=11
FT                   /locus_tag="YE0296"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10428"
FT                   /db_xref="GOA:A1JIJ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIJ0"
FT                   /protein_id="CAL10428.1"
FT                   /translation="MELQLTGKESGWWIVSHENKLWLPKGELPQGNAANWSLQGATARQ
FT                   IGEWQGQAVWLIRQMMSTDMGSVRQLLDVDRGLFQLAGRGVQLAEFYRSHRYCGYCGHQ
FT                   MHASRTEWACLCNHCRERYYPQIAPCVIVAIRRGDEILLAQHVRHRGGINTVLAGFVEV
FT                   GETLEQAVSREVLEESNIHIKNLRYVTSQPWPFPHSLMMAFMAEYDSGELRHDPKELLN
FT                   AGWYRYDQLPLLPPPGTVARRLIEDTVVLCREEQFDDGE"
FT   misc_feature    346738..346803
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1040.000, SD 2.73 at aa 107-128, sequence
FT                   ASRTEWACLCNHCRERYYPQIA"
FT   misc_feature    346798..347160
FT                   /note="Pfam match to entry PF00293 NUDIX, NUDIX domain
FT                   ,score 91.2, E-value 1.3e-24"
FT                   /inference="protein motif:PFAM:PF00293"
FT   misc_feature    346894..346953
FT                   /note="PS00893 mutT domain signature."
FT                   /inference="protein motif:Prosite:PS00893"
FT   CDS             347286..348353
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="YE0297"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10429"
FT                   /db_xref="GOA:A1JIJ1"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIJ1"
FT                   /protein_id="CAL10429.1"
FT                   /translation="MNELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAIAGD
FT                   FMSLCKNAELACEVTMQPLRRYPLDAAILFSDILTIPDAMGLGLYFETGEGPRFQSPIT
FT                   CRADVEKLPIPDPEQELGYVMNAVRTIRRELAGAVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTKLKKMMYAEPQTLHLLLDKLADSVILYLNAQIKAGAQSVMVFDTWGGVLTGRDYAEF
FT                   SLNYMHKIVDGLIRENDGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSILYAPAARIEEEVSTILAGFGQGEGHVFNLGHGIHQDVPPEHAGA
FT                   FVKAVHALSKPYHQK"
FT   misc_feature    347295..348329
FT                   /note="Pfam match to entry PF01208 URO-D, Uroporphyrinogen
FT                   decarboxylase (URO-D), score 699.3, E-value 1.2e-207"
FT                   /inference="protein motif:PFAM:PF01208"
FT   misc_feature    347349..347378
FT                   /note="PS00906 Uroporphyrinogen decarboxylase signature 1."
FT                   /inference="protein motif:Prosite:PS00906"
FT   misc_feature    347712..347759
FT                   /note="PS00907 Uroporphyrinogen decarboxylase signature 2."
FT                   /inference="protein motif:Prosite:PS00907"
FT   CDS             348377..349081
FT                   /transl_table=11
FT                   /gene="nfi"
FT                   /locus_tag="YE0298"
FT                   /product="endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:YE0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10430"
FT                   /db_xref="GOA:A1JIJ2"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIJ2"
FT                   /protein_id="CAL10430.1"
FT                   /translation="MVDTKALRAEQLQRASEISLQDDIASESVRFIAGADVGFEQQGEV
FT                   TRAAIAVLRYPSLELVEYQVARVATSLPYIPGLLSFREYPALLAAWAQIQQRPQLVFVD
FT                   GQGIAHPRRLGVASHFGLLVDVPTIGVAKSRLCGNFEPLGDDNGALQPLVDADEQLGWV
FT                   WRSKSRCNPLFISPGHRVSVGSALEWVQHCIAGYRLPEPTRWADAIASNRPQFQRWVRK
FT                   SPDLLGKHRDMI"
FT   CDS             349127..349717
FT                   /transl_table=11
FT                   /locus_tag="YE0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10431"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ3"
FT                   /protein_id="CAL10431.1"
FT                   /translation="MIRNPIHLRLEKLESWQHLTFMACLCERMYPNYQQFCLETEFGDP
FT                   AVYRRILDLIWETLVVKDAKVNFDSQLEKLEEAIPSADDYAIYGVYPAIDACIALSEAI
FT                   HSRLSGETLEHAIAISETSIRTVAMLEMTLAGKEMTDEELKILPAIEEEWDIQWEIFRL
FT                   LADCEERDLDLIKGLRSDLREAAVSNIGINLTQ"
FT   CDS             349906..350181
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="YE0300"
FT                   /product="DNA-binding protein HU-alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YE0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10432"
FT                   /db_xref="GOA:A1JIJ4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ4"
FT                   /protein_id="CAL10432.1"
FT                   /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVKS"
FT   misc_feature    349906..350175
FT                   /note="Pfam match to entry PF00216
FT                   Bac_DNA_binding,Bacterial DNA-binding protein, score 179.7,
FT                   E-value 3e-51"
FT                   /inference="protein motif:PFAM:PF00216"
FT   misc_feature    350041..350100
FT                   /note="PS00045 Bacterial histone-like DNA-binding proteins
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00045"
FT   CDS             350186..350887
FT                   /transl_table=11
FT                   /gene="yjaH"
FT                   /locus_tag="YE0301"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10433"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ5"
FT                   /protein_id="CAL10433.1"
FT                   /translation="MSVKIINGGVAKPLLFMQRVLMTLGLAFGLSACSSQSGSPQFSAS
FT                   GYIADSGVVRLWRQDNAQQQPQVLMSVYSPYSGGNTRVTFYEYQHGVLREIRRNDLGDD
FT                   PQSVELRFDEQGQVSFMQRQLATRREQLSVDNIAVYQLEAKRILELSSALRAGNVQLIQ
FT                   GRWQDGIVTTCAGKTLRLSLDDNSQAWLSKRGANSAEPLGVAWLDSSEGQQLLLVANQD
FT                   FCRWEPKAGSL"
FT   sig_peptide     350186..350296
FT                   /gene="yjaH"
FT                   /locus_tag="YE0301"
FT                   /note="Signal peptide predicted for YE0301 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.973) with cleavage site
FT                   probability 0.630 between residues 37 and 38"
FT   misc_feature    350252..350284
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(350982..352277)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="YE0302"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10434"
FT                   /db_xref="GOA:A1JIJ6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ6"
FT                   /protein_id="CAL10434.1"
FT                   /translation="MNILIIGNGGREHALGWKAAQSPLADKIYVAPGNAGTALEPTLEN
FT                   VDIAATDIAGLLAFAQSHDIGLTIVGPEAPLVIGVVDAFRAAGLTIFGPTQAAAQLEGS
FT                   KAFTKDFLARHNIPTAFYQNFTEVEPALAYVRKIGAPIVIKADGLAAGKGVIVAMTLEE
FT                   AETAVHDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTDEVHQRVMDQVIWPTVRGMAAEGNVYSGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRMRSDLVELCLAGAQGKLNEKTSDWDERPSLGVVLAAGG
FT                   YPADYRQGDIIHGLPQQEVADGKVFHAGTKLDSNNNVVTSGGRVLCVTALGATVAQAQQ
FT                   HAYKLAEKIQWEGAFCRKDIGYRAITRENSGS"
FT   misc_feature    complement(351003..351290)
FT                   /note="Pfam match to entry PF02843
FT                   GARS_C,Phosphoribosylglycinamide synthetase, C domain,
FT                   score 178.5, E-value 7.3e-51"
FT                   /inference="protein motif:PFAM:PF02843"
FT   misc_feature    complement(351300..351719)
FT                   /note="Pfam match to entry PF01071
FT                   GARS,Phosphoribosylglycinamide synthetase, ATP-grasp (A)
FT                   domain, score 325.2, E-value 5e-95"
FT                   /inference="protein motif:PFAM:PF01071"
FT   misc_feature    complement(351387..351410)
FT                   /note="PS00184 Phosphoribosylglycinamide synthetase
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00184"
FT   misc_feature    complement(351720..351968)
FT                   /note="Pfam match to entry PF02842
FT                   GARS_B,Phosphoribosylglycinamide synthetase, B domain,
FT                   score 181.3, E-value 9.9e-52"
FT                   /inference="protein motif:PFAM:PF02842"
FT   misc_feature    complement(351972..352277)
FT                   /note="Pfam match to entry PF02844
FT                   GARS_N,Phosphoribosylglycinamide synthetase, N domain,
FT                   score 212.4, E-value 4.3e-61"
FT                   /inference="protein motif:PFAM:PF02844"
FT   CDS             complement(352303..353892)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="YE0303"
FT                   /product="bifunctional purine biosynthesis protein PurH
FT                   [includes: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase and IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10435"
FT                   /db_xref="GOA:A1JIJ7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIJ7"
FT                   /protein_id="CAL10435.1"
FT                   /translation="MQQRRPIRRALLSVSDKAGIIEFATALSQRGIELLSTGGTARLLA
FT                   DAGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDGIMAQHDIQPIDIVVVN
FT                   LYPFAQTVARPDCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYPAIIAELDEN
FT                   DGSLTYPTRFNLAIKAFEHTAAYDSMIANYFGALVPAYHGDTEQPSGRFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEEDVKEASVATALQLQGKALSYNNIADTDAALECVKEFSEP
FT                   ACVIVKHANPCGVAIADSLLAAYDKAYKTDPTSAFGGIIAFNRELDAETASAIISRQFV
FT                   EVIIAPSVSTEALALLAAKQNVRVLTCGQWQERSAGLDFKRVNGGLLVQDRDLGMVTEA
FT                   DLRVVSQRQPTEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAADEGLEVAGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAADEHGI
FT                   AMIFTDMRHFRH"
FT   misc_feature    complement(352510..353484)
FT                   /note="Pfam match to entry PF01808
FT                   AICARFT_IMPCHas,AICARFT/IMPCHase bienzyme, score 696.9,
FT                   E-value 6.1e-207"
FT                   /inference="protein motif:PFAM:PF01808"
FT   misc_feature    complement(353497..353865)
FT                   /note="Pfam match to entry PF02142 MGS, MGS-like domain
FT                   ,score 194.5, E-value 1.1e-55"
FT                   /inference="protein motif:PFAM:PF02142"
FT   rRNA            354706..356194
FT                   /gene="16S rRNA"
FT                   /product="16S ribosomal RNA"
FT                   /note="match to 16S_rRNA 1..1461 (Y.enterocolitica 16S)"
FT   tRNA            356419..356494
FT                   /gene="tRNA-Glu (TTC)"
FT                   /product="transfer RNA-Glu (TTC)"
FT   rRNA            356873..359866
FT                   /gene="23S rRNA"
FT                   /product="23S ribosomal RNA"
FT                   /note="match to 23S_rRNA 1..2994 (Y. enterocolitica 23S
FT                   EMBL:U77925, Y.pestis KIM 98 38dentity, Citrobacter
FT                   freundii 23S EMBL:U77928 94 38dentity)"
FT   rRNA            359866..360103
FT                   /gene="5S rRNA"
FT                   /product="5S ribosomal RNA"
FT                   /note="match to 5SrRNA 1..240 Y.enterocolitica"
FT   repeat_region   360254..361556
FT                   /note="Insertion sequence element IS1669"
FT   CDS             360392..360706
FT                   /transl_table=11
FT                   /locus_tag="YE0304"
FT                   /product="IS1669 hypothetical protein"
FT                   /note="Similar to several including: Yersinia pestis
FT                   hypothetical protein Ypo2009A SWALL:Q8ZEY6 (EMBL:AJ414151)
FT                   (104 aa) fasta scores: E(): 6.5e-31, 87.5 38d in 104 aa,and
FT                   in part to Salmonella typhimurium putative cytoplasmic
FT                   protein Stm0948 SWALL:Q8ZQE1 (EMBL:AE008740) (133 aa) fasta
FT                   scores: E(): 3.8e-16, 53 38d in 100 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10436"
FT                   /db_xref="GOA:A1JIJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ8"
FT                   /inference="similar to sequence:INSDC:AJ414151"
FT                   /inference="similar to sequence:INSDC:AE008740"
FT                   /protein_id="CAL10436.1"
FT                   /translation="MTYRQAQDRYGIQGRSTVLTWLRKFGQLDWLSPSPARMYGINMPK
FT                   MPLTPEQRIKELEQQLAESEVKAQFFEAVVKVMNTEFGATLTKKQLATLSRKRKRGDSQ
FT                   "
FT   CDS             360724..361521
FT                   /transl_table=11
FT                   /locus_tag="YE0305"
FT                   /product="putative transposase for insertion element
FT                   IS1669"
FT                   /note="Similar to Shigella sonnei insertion element IS600
FT                   hypothetical protein SWALL:YIS2_SHISO (SWALL:P16940) (272
FT                   aa) fasta scores: E(): 5.9e-25, 37.4 38d in 270
FT                   aa,Pseudomonas aeruginosa hypothetical protein Pa0257
FT                   SWALL:Q9I6N2 (EMBL:AE004463) (263 aa) fasta scores: E():
FT                   8.6e-70, 66.16 38d in 263 aa and to Porphyromonas
FT                   gingivalis transposase Orf2 SWALL:Q9L796 (EMBL:AF224744)
FT                   (312 aa) fasta scores: E(): 9.8e-27, 37.26 38d in 271 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10437"
FT                   /db_xref="GOA:A1JIJ9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIJ9"
FT                   /inference="similar to sequence:INSDC:AE004463"
FT                   /inference="similar to sequence:INSDC:AF224744"
FT                   /inference="similar to sequence:UniProtKB:P16940"
FT                   /protein_id="CAL10437.1"
FT                   /translation="MGISRQAWYQSLQRERGREKQAQRIVEQVTAIRLQQPRLGTRKLH
FT                   YLLRQQAEPALHVGRDRLFQILRCSRLLVMPKRAYHKTTNSHHRFYRHPNLLKSGANQV
FT                   IASRPEQVWVADITYLPLRTGTAYVSLVTDAWSRKIVGYHVHESLHTRHVAAALKMALV
FT                   SRRTASALIHHSDRGIQYCSTEYQALHQRHGVICSMTDGYDCYQNALAERVNGILKLEY
FT                   LLVKPKDIGQARKMVRESVEIYNTRRPHLSLKYKTPDEVHQAF"
FT   misc_feature    361036..361512
FT                   /note="Pfam match to entry PF00665 rve, Integrase core
FT                   domain, score 121.4, E-value 1.1e-33"
FT                   /inference="protein motif:PFAM:PF00665"
FT   CDS             361779..362948
FT                   /transl_table=11
FT                   /locus_tag="YE0306"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10438"
FT                   /db_xref="GOA:A1JIK0"
FT                   /db_xref="InterPro:IPR025890"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK0"
FT                   /protein_id="CAL10438.1"
FT                   /translation="MNAGLLVYTAITAILATTLTCTAVQASPVTYQKAAITESNLPVFY
FT                   PQLKKQMTYQSSWLAGKYTDFALWKSDTRKILRQALLTPDSTIAFSAEKIDQQERGSYI
FT                   AEKIVFNITDESRVQGLLLTPKSKGPHPAIVLLHDHGSKFDIGKEKMIRPWGDSVQLAS
FT                   AQAWSDKFFSGKFIGDELAKRGYVVLSIDAIGWGDRGPISYEQQQAVASNFFNLGRSLA
FT                   GTMAYEDMRTVDFLATLPSVDPQRIGIVGFSMGAYRAWQLAALSDKVAATAAISWFGNY
FT                   QGLMTLGNNVLRGQSAFYMLHPGIANKLDFPDIASLAAPKPMLLFNGGKDKLFPSDAVQ
FT                   EAYNKVHAIWRSQNAESRLVTRNWPALGHVFYQEQQDVVFPWLDRWLKP"
FT   sig_peptide     361779..361856
FT                   /locus_tag="YE0306"
FT                   /note="Signal peptide predicted for YE0306 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.976 between residues 26 and 27"
FT   misc_feature    361791..361859
FT                   /note="1 probable transmembrane helix predicted for YE0306
FT                   by TMHMM2.0 at aa 5-27"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    362472..362600
FT                   /note="Pfam match to entry PF01738 DLH, Dienelactone
FT                   hydrolase family, score 25.8, E-value 1.6e-07"
FT                   /inference="protein motif:PFAM:PF01738"
FT   CDS             complement(362987..364642)
FT                   /transl_table=11
FT                   /locus_tag="YE0307"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10439"
FT                   /db_xref="GOA:A1JIK1"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIK1"
FT                   /protein_id="CAL10439.1"
FT                   /translation="MKTRHWSVLSLLALPALSQAEAITGEVHRQPLNIEAIVMFVLFVG
FT                   ATLYITYWASKRTRSRGDYYTAGGRITGFQNGLAIAGDFMSAASFLGISALVYTSGYDG
FT                   LIYSIGFLIGWPIILFLIAERLRNLGRYTFADVASYRLKQRPIRTLSACGSLVVVALYL
FT                   IAQMVGAGKLIELLFGLNYHVAVVLVGILMVMYVLFGGMLATTWVQIIKAVLLLAGASF
FT                   MALMVMKSVNFNFNTLFSEAVKVHPKGLSIMSPGGLVSDPISALSLGLALMFGTAGLPH
FT                   ILMRFFTVSDAKEARKSVFYATGFIGYFYILTFIIGFGAILLVGPNPAFKDAAGALLGG
FT                   NNMAAVHLADAVGGSFFLGFISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKAN
FT                   ERDELKVSKITVVVLGFVAIGLGILFEKQNIAFMVGLAFSIAASCNFPIIFISMYWEKL
FT                   TTRGAMIGGWLGLLTAVILMILGPTIWVTILGHAKPIYPYEYPALFSMIVAFVGIWFFS
FT                   ITDNSEEGQQERLRFKAQFVRSQTGLGASQSSSH"
FT   misc_feature    complement(join(363086..363139,363182..363250,
FT                   363287..363355,363368..363427,363488..363556,
FT                   363677..363745,363782..363850,363959..364027,
FT                   364040..364108,364136..364204,364265..364333,
FT                   364346..364414,364475..364543))
FT                   /note="13 probable transmembrane helices predicted for
FT                   YE0307 by TMHMM2.0 at aa 34-56, 77-99, 104-126,
FT                   147-169,179-201, 206-228, 265-287, 300-322, 363-385,
FT                   406-425,430-452, 465-487 and 502-519"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(363227..363289)
FT                   /note="PS00457 Sodium:solute symporter family signature 2."
FT                   /inference="protein motif:Prosite:PS00457"
FT   misc_feature    complement(363233..364453)
FT                   /note="Pfam match to entry PF00474 SSF, Sodium:solute
FT                   symporter family, score 603.9, E-value 6.2e-179"
FT                   /inference="protein motif:PFAM:PF00474"
FT   misc_feature    complement(363311..363343)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    complement(364031..364108)
FT                   /note="PS00456 Sodium:solute symporter family signature 1."
FT                   /inference="protein motif:Prosite:PS00456"
FT   sig_peptide     complement(364583..364642)
FT                   /locus_tag="YE0307"
FT                   /note="Signal peptide predicted for YE0307 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.885 between residues 20 and 21"
FT   CDS             complement(364639..364950)
FT                   /transl_table=11
FT                   /locus_tag="YE0308"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10440"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK2"
FT                   /protein_id="CAL10440.1"
FT                   /translation="MNDNIYQEIENNPRFKELVQKRSHFAWLLSLITLALYVGFIFLIA
FT                   FEPQWLGTPLYAGATITRGIPVGVGLIVISFVLTGIYVIRANGEFDRLTAEILREVKQ"
FT   misc_feature    complement(join(364702..364770,364813..364881))
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0308 by TMHMM2.0 at aa 24-46 and 61-83"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(365004..366962)
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="YE0309"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10441"
FT                   /db_xref="GOA:A1JIK3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIK3"
FT                   /protein_id="CAL10441.1"
FT                   /translation="MSQIHKHPIPTAIAEHALINPEQYHQYYQQSVQNPDEFWGEHGKI
FT                   IDWIKPYKTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQ
FT                   SKTVTYKQLHHDVCQFANVLKKLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIF
FT                   GGFSPDAVAGRIIDSNSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQR
FT                   TGNASYWKDGRDVWWHDLIKDASVDCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYAALTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVN
FT                   RLGQVIDKHQVNILYTAPTAIRALMAEGDKAIEGTKRTSLRIMGSVGEPINPEAWEWYY
FT                   NKIGNSKCPIVDTWWQTETGGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEG
FT                   AAEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVSHPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELY
FT                   TEVRNWVRKEIGPIATPDILHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADP
FT                   GVVDKLLEEKQSMQAPS"
FT   misc_feature    complement(365322..366638)
FT                   /note="Pfam match to entry PF00501 AMP-binding,AMP-binding
FT                   enzyme, score 458.8, E-value 3e-135"
FT                   /inference="protein motif:PFAM:PF00501"
FT   misc_feature    complement(366147..366182)
FT                   /note="PS00455 Putative AMP-binding domain signature."
FT                   /inference="protein motif:Prosite:PS00455"
FT   CDS             367882..369195
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /locus_tag="YE0310"
FT                   /product="proton glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10442"
FT                   /db_xref="GOA:A1JIK4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK4"
FT                   /protein_id="CAL10442.1"
FT                   /translation="MKSVKISLAWQILIALVLGILVGAVLHNQIESREWLVNNILSPAG
FT                   DIFIRLIKMIVVPIVISTLIVGIAGVGDAKKLGRIGLKTIIYFEVITTVAIIVGITLAN
FT                   VFQPGHGIDMSALTVVDISQYEKTTEQVQSGSHSLVSTILSLIPANVFASMAKGDMLPI
FT                   IFFSVLFGLGLSSLPKETKEPLLNVFKAVSESMFKVTHMIMRYAPIGVFGLISVTVANF
FT                   GFASLIPLAKLVVLVYAAIIFFALVILGTVARLCKLRIWTLIRILKDELILAYSTASSE
FT                   TVLPRIIEKMEAYGAPKAITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIELSIGQE
FT                   IILVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWEHQFDHKKAKAYEKTLFAPKQTPVQN"
FT   sig_peptide     367882..367965
FT                   /gene="gltP"
FT                   /locus_tag="YE0310"
FT                   /note="Signal peptide predicted for YE0310 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.923) with cleavage site
FT                   probability 0.848 between residues 28 and 29"
FT   misc_feature    join(367900..367968,368026..368094,368131..368199,
FT                   368359..368412,368497..368565,368578..368646,
FT                   368857..368925,368968..369036)
FT                   /note="8 probable transmembrane helices predicted for
FT                   YE0310 by TMHMM2.0 at aa 7-29, 49-71, 84-106,
FT                   160-177,206-228, 233-255, 326-348 and 363-385"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    367903..369114
FT                   /note="Pfam match to entry PF00375 SDF,Sodium:dicarboxylate
FT                   symporter family, score 723.0,E-value 8.8e-215"
FT                   /inference="protein motif:PFAM:PF00375"
FT   misc_feature    368008..368055
FT                   /note="PS00713 Sodium:dicarboxylate symporter family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00713"
FT   misc_feature    368797..368868
FT                   /note="PS00714 Sodium:dicarboxylate symporter family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00714"
FT   CDS             complement(369338..369970)
FT                   /transl_table=11
FT                   /locus_tag="YE0311"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YE0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10443"
FT                   /db_xref="GOA:A1JIK5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK5"
FT                   /protein_id="CAL10443.1"
FT                   /translation="MNTKLLIVDDHELIINGIKNMLAAYPRYQIVGEAENGLDVYNLCR
FT                   QTEPDIVIIDLGLPGMDGLDVIIQLRRRWPGMKILALTARHEEHYASRTLNNGALGYVL
FT                   KKSPQQILMAAIQTVAAGKRYIDPALNSALLSQLTQDCETNQTILTPRERQILKLITEG
FT                   SCNRMIASQLSISQKTVETHRLNMMKKLDVHKVAELIHWSYRLGLNE"
FT   misc_feature    complement(369344..369535)
FT                   /note="Pfam match to entry PF00196 GerE, Bacterial
FT                   regulatory proteins, luxR family, score 73.5, E-value
FT                   3e-19"
FT                   /inference="protein motif:PFAM:PF00196"
FT   misc_feature    complement(369401..369484)
FT                   /note="PS00622 Bacterial regulatory proteins, luxR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00622"
FT   misc_feature    complement(369599..369964)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 125.8, E-value 5.3e-35"
FT                   /inference="protein motif:PFAM:PF00072"
FT   CDS             370458..371078
FT                   /transl_table=11
FT                   /locus_tag="YE0312"
FT                   /product="putative AraC-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10444"
FT                   /db_xref="GOA:A1JIK6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK6"
FT                   /protein_id="CAL10444.1"
FT                   /translation="MITDEQARVSSFSQNTFTSILCHPIDLLPLYKNLASNMAQPNKSR
FT                   LPQNVYERCKILPANNDIICAAEKLVDIDRTLSLRFLYLYCLGLDYVYFSRLLESIVGT
FT                   NNKLLEFFEKNRLNPWTVSRYASELGISTRKLNFLFYEKFGMSAKQWLLEQRLKKGCEL
FT                   LLSTRLRVADIAMECGFSNHAHFSDSFRRRFQQCPSRMRTLME"
FT   misc_feature    370779..370916
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   6.5, E-value 0.53"
FT                   /inference="protein motif:PFAM:PF00165"
FT   misc_feature    370935..371066
FT                   /note="Pfam match to entry PF00165 HTH_AraC, Bacterial
FT                   regulatory helix-turn-helix proteins, araC family, score
FT                   31.5, E-value 1.3e-06"
FT                   /inference="protein motif:PFAM:PF00165"
FT   CDS             371296..372123
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0313"
FT                   /product="inner membrane protein (pseudogene)"
FT                   /note="The 5' end of this CDS appears to have been deleted"
FT                   /db_xref="PSEUDO:CAL10445.2"
FT   misc_feature    join(371353..371421,371497..371556,371569..371622,
FT                   371683..371751,371764..371832,371869..371931,
FT                   371989..372057)
FT                   /note="7 probable transmembrane helices predicted for
FT                   YE0313 by TMHMM2.0 at aa 20-42, 68-87, 92-109,
FT                   130-152,157-179, 192-212 and 232-254"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             372183..372404
FT                   /transl_table=11
FT                   /locus_tag="YE0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10446"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK7"
FT                   /protein_id="CAL10446.1"
FT                   /translation="MPDYRLDMVGEPCPYPAVATLEAMPQLKPGEILEVISDCPQSINN
FT                   IPLDARNYGYTVLDIQQDGPTIRYLIQR"
FT   misc_feature    372183..372401
FT                   /note="Pfam match to entry PF01206 UPF0033,Uncharacterized
FT                   protein family UPF0033, score 145.4,E-value 6.5e-41"
FT                   /inference="protein motif:PFAM:PF01206"
FT   misc_feature    372198..372236
FT                   /note="PS01148 Uncharacterized protein family UPF0033
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01148"
FT   CDS             complement(372693..373490)
FT                   /transl_table=11
FT                   /locus_tag="YE0315"
FT                   /product="putative membrane protein"
FT                   /note="Similar to many TonB membrane transport proteins:
FT                   Pseudomonas putida TonB protein SWALL:TONB_PSEPU
FT                   (SWALL:Q05613) (243 aa) fasta scores: E(): 2.3e-17, 36.88
FT                   id in 244 aa, Pseudomonas putida TonB SWALL:Q93PQ7
FT                   (EMBL:AF315582) (243 aa) fasta scores: E(): 4.6e-18,36.88
FT                   38d in 244 aa, and to Salmonella typhimurium TonB or
FT                   Stm1737 SWALL:TONB_SALTY (SWALL:P25945) (242 aa) fasta
FT                   scores: E(): 0.00013, 28.94 38d in 228 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10447"
FT                   /db_xref="GOA:A1JIK8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK8"
FT                   /inference="similar to sequence:INSDC:AF315582"
FT                   /inference="similar to sequence:UniProtKB:Q05613"
FT                   /inference="similar to sequence:UniProtKB:P25945"
FT                   /protein_id="CAL10447.1"
FT                   /translation="MSIIKNNHDFRMDLPLGRPRTRWSISLLLGVGLHLLAAAFMLGWI
FT                   NKMAPQGVLPPAVMIELTLYQQAKSAPREIPQGLQQSMAAPDDAPPEKRLEELPKLTHS
FT                   AKGTHAIRPEKVVQKKKIEPTKPRTATPLPVVAEKAAPTTSAPLPGESHKNTATFASDA
FT                   SAAISGKASWQSDVLAHLSRYKRYPREALRYRLEGISHVRFVVDHKGKVLTAELFTSSG
FT                   AKMLDREAMILISRAQPLPIPPAELLRNGVIELIAPIAYNVKG"
FT   misc_feature    complement(373356..373424)
FT                   /note="1 probable transmembrane helix predicted for YE0315
FT                   by TMHMM2.0 at aa 23-45"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             373868..374410
FT                   /transl_table=11
FT                   /locus_tag="YE0316"
FT                   /product="putative DNA-binding protein"
FT                   /note="Similar to many proposed RNA polymerase sigma
FT                   factors including: Escherichia coli probable FecI or b4293
FT                   SWALL:FECI_ECOLI (SWALL:P23484) (173 aa) fasta scores: E():
FT                   1e-11, 31.84 38d in 179 aa, Pseudomonas aeruginosa putative
FT                   Pa1300 SWALL:Q9I444 (EMBL:AE004559) (175 aa) fasta scores:
FT                   E(): 2.5e-29, 51.72 38d in 174 aa and Shigella flexneri 2a
FT                   FecI SWALL:AAL08458 (EMBL:AF326777) (173 aa) fasta scores:
FT                   E(): 1e-11, 31.84 38d in 179 aa. Also similar to several
FT                   Iron uptake regulators including:Bordetella pertussis heme
FT                   uptake regulator HurI SWALL:AAM34715 (EMBL:AF508979) (169
FT                   aa) fasta scores: E(): 3.8e-11, 32.51 38d in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10448"
FT                   /db_xref="GOA:A1JIK9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIK9"
FT                   /inference="similar to sequence:INSDC:AE004559"
FT                   /inference="similar to sequence:INSDC:AF326777"
FT                   /inference="similar to sequence:INSDC:AF508979"
FT                   /inference="similar to sequence:UniProtKB:P23484"
FT                   /protein_id="CAL10448.1"
FT                   /translation="MDKPPSNKVSLAYQNTYGQLVSFFRKRLDNASDATDLSHDVFTLW
FT                   LKRAKQTPVEHSRAFLFKIAHRVLIDHWRAAGKQRMALAQSHEDDDAEQEMAPSGADPQ
FT                   HVLEQQQRLSRLEQALNSLSPRRREAFLMHRFDGLSQIEVAERMGISVSMVEKHIAGAL
FT                   LHCKRHVAEQGSKQHDE"
FT   misc_feature    374282..374347
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1853.000, SD 5.50 at aa 181-202, sequence
FT                   LSQIEVAERMGISVSMVEKHIA"
FT   CDS             374403..375368
FT                   /transl_table=11
FT                   /locus_tag="YE0317"
FT                   /product="putative two-component system sensor protein"
FT                   /note="Similar to many two-component system sensor proteins
FT                   including: Escherichia coli protein FecR controlling iron
FT                   dicitrate transport SWALL:FECR_ECOLI (SWALL:P23485) (317
FT                   aa) fasta scores: E(): 3.5e-10, 24.24 id in 297 aa, and to
FT                   Pseudomonas aeruginosa probable transmembrane sensor Pa1301
FT                   SWALL:Q9I443 (EMBL:AE004559) (327 aa) fasta scores: E():
FT                   3.1e-37, 39.74 38d in 312 aa,and to Agrobacterium
FT                   tumefaciens transmembrane sensor Atu5310 or agr_pat_bx251
FT                   SWALL:Q8UK14 (EMBL:AE008953) (311 aa) fasta scores: E():
FT                   5.5e-17, 27.5 38d in 309 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10449"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL0"
FT                   /inference="similar to sequence:INSDC:AE004559"
FT                   /inference="similar to sequence:INSDC:AE008953"
FT                   /inference="similar to sequence:UniProtKB:P23485"
FT                   /protein_id="CAL10449.1"
FT                   /translation="MNESRSLSAEIDEQAALWFSRSQARRLTTQEQQQLDTWLQCSPSH
FT                   AQAYRQMQQIWGDCALIPRPASAPQPEKSTRGWRPLRSCAAGIFFLFALLLPMSQLPSL
FT                   LTNDMSLQTTDYSREIVLSDGTRVHVNRHSQVRVHYAKDNRQLWLDQGEIYLQVAANKA
FT                   RPFIVYAGESEVKVVGTAFDVRYDLGEVAVAVKEGIVAMTGRPNMAAVMLHAGDRVQLL
FT                   PAQKRLLLSKIAVAEIGQWRSGQLLFRNRPLGELVTELRRYRPGKIELTDTSLAQLPVS
FT                   GSLDLNHPDEFLDSLPLLLAVNVVHDEQGNVMIFRNLNKK"
FT   CDS             375471..378245
FT                   /transl_table=11
FT                   /locus_tag="YE0318"
FT                   /product="putative exported iron receptor protein"
FT                   /note="Similar to many including: Pseudomonas putida
FT                   ferric-pseudobactin 358 receptor precursor PupA
FT                   SWALL:PUPA_PSEPU (SWALL:P25184) (819 aa) fasta scores: E():
FT                   2.8e-05, 22.09 38d in 543 aa, Haemophilus influenzae
FT                   hypothetical protein Hi1369 SWALL:YDDB_HAEIN (SWALL:P45182)
FT                   (839 aa) fasta scores: E(): 2e-41, 28.09 id in 833 aa and
FT                   Escherichia coli hypothetical protein YddB or b1495
FT                   SWALL:YDDB_ECOLI (SWALL:P31827) (790 aa) fasta scores: E():
FT                   3.5e-25, 29.04 38d in 785 aa."
FT                   /db_xref="EnsemblGenomes-Gn:YE0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10450"
FT                   /db_xref="GOA:A1JIL1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL1"
FT                   /inference="similar to sequence:UniProtKB:P25184"
FT                   /inference="similar to sequence:UniProtKB:P45182"
FT                   /inference="similar to sequence:UniProtKB:P31827"
FT                   /protein_id="CAL10450.1"
FT                   /translation="MMINNKKKVSGVPVLTALALATLLTTQGVMAADVSFNLTAQPLAN
FT                   AITQVAQQGQLHVIFDESDVRNLRAPALSGNYSAQGALQQLLAGSGLELVASGKGYVVR
FT                   PMLVSGATAGSMVLPTTSVMGEAGGRAAVDNVMSAPQVVTSEEIRQRPTGNGNITELLR
FT                   TNPAVQFSNSDNTSLTQGEIKPGAISIHGSSSYQNAYNLDGVSFNNDIDPASDGNGETI
FT                   TRIDSSDQGMYIDSRLIDSVTVFDNNIPVEFGGFTGGTLDVSSRRWRGENSAHAFYRET
FT                   RSSWNKVFTDPDMEFDSSKNDTSRPARYQPKYNKQSFGGWFEAGITDNMGIVFSASQRL
FT                   SDIPTYTTGGSGLQLSPNNELEVVSVTPGYRSQKRVSDNYFAKLSWDANERTSAHLSAN
FT                   YSAYTSTLFSSSVINSGYDNDHNGLSTTLQLEHRFDIANLDFTAGYQQLKDERTNDVKD
FT                   FFTLEDYMTDWRNPQFYNNGGQGDLTTRQNSASAKGVLRFNEFNALGLQHSPNLGFELN
FT                   KTTARYIRDRDYYRYKFSAAADDIASLTEASYITRFRAGNYEAGYTNYALFLDDSMQYS
FT                   RLTVRPGVRLDRDDFVQKTNIAPRLSSSLDLFGTGDTVLIAGANRYYGRSMLTYALYEA
FT                   QNAGMEHCYYFCSLDPSENDWDGVKDFEGIDSLKTPYNDELSFALQQQVMQSTWRLQYV
FT                   HREGYDEVRSRTKYRNPNSASQARIRTFDNGGRSSNDQVSLSVSNSKPWELAATTHAFT
FT                   GSLTWQQSKSNTPKDQGYAFFDPNTKLDSDKVWYDGKVINASDLPSTNFNSPWRLNLEL
FT                   TSEWQEYSLTFYNLWQWRSSRDQAVRYQNEYYTDTSTGTQMLKYEKTHFASNFRWDTKV
FT                   TWQPAFAYGAGISIEVNNLLNKRNVSDTFVYGDRVLHSYDPGRQFWLQVSYDL"
FT   sig_peptide     375471..375563
FT                   /locus_tag="YE0318"
FT                   /note="Signal peptide predicted for YE0318 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.995 between residues 31 and 32"
FT   misc_feature    377583..377630
FT                   /note="PS00036 bZIP transcription factors basic domain
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00036"
FT   sig_peptide     378334..378483
FT                   /note="Signal peptide predicted for YE0319 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.676) with cleavage site
FT                   probability 0.417 between residues 50 and 51"
FT   CDS             378373..380079
FT                   /transl_table=11
FT                   /locus_tag="YE0319"
FT                   /product="putative membrane transport protein ATP-binding
FT                   component"
FT                   /note="Similar to Haemophilus influenzae high-affinity zinc
FT                   uptake system ATP-binding protein ZnuC or hi0408
FT                   SWALL:ZNUC_HAEIN (SWALL:P44692) (268 aa) fasta scores: E():
FT                   5.3e-08, 35.59 38d in 177 aa, and to Escherichia coli
FT                   O157:H7 putative ATP-binding component of a transport
FT                   system YddA or z2212 or ecs2101 SWALL:Q8XAW0
FT                   (EMBL:AE005355) (561 aa) fasta scores: E(): 3.4e-53,35.29
FT                   38d in 544 aa, and to Escherichia coli, and Escherichia
FT                   coli O157:H7 high-affinity zinc uptake system ATP-binding
FT                   protein znuc znuc or b1858 or z2910 or ecs2568
FT                   SWALL:ZNUC_ECOLI (SWALL:P52648) (251 aa) fasta scores: E():
FT                   1.8e-06, 34.48 38d in 174 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10451"
FT                   /db_xref="GOA:A1JIL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL2"
FT                   /inference="similar to sequence:INSDC:AE005355"
FT                   /inference="similar to sequence:UniProtKB:P44692"
FT                   /inference="similar to sequence:UniProtKB:P52648"
FT                   /protein_id="CAL10451.1"
FT                   /translation="MKTLKQFYYLARPFWGIRSALLAWLLLLVVLALSLSSVWFNVQLN
FT                   QWNGNFYNALQQLNSQALYQLLQHFILLVSALILVVVFADYLKQRLIMRWRIGMTEHIL
FT                   ARWLSHKGQHYALKINALVPDNPDQRIAEDVRLLIESSLRLLITFLHSLLTLISFATIL
FT                   WQLSGSISFSLAQHSFTLPGYMFWVCILYTVLGIGLTHWIGYPLRQLNMDRQRREADYR
FT                   SGLIARREASDAIAGQRGEYHERAALLQRFRAVADNWYQLIRYEKNLSFFTVGYQQLSA
FT                   LAPIFFALPKFLAGELLLGGLMQIRQSFAQVAGALGWFIFSYREIAAWQATVTRLYNFV
FT                   VLLDAEPVSPVESAPDDGLPLRAALDLYTADGAMLLSNITLNASAGSLTLIQGRSGIGK
FT                   STLLRTLSGHWPHYQGRIQRSDSVSWLPQRLYLPHERLDDLLAYPAQREDFTEAQLQQV
FT                   LVQVGLPQLNYQLALSTDWQQRLSGGEQQRLMFARLLLNKPRLILLDETTAALDAASAR
FT                   HLLQLLRQQLPNSAVLLVSHQTFLADIADHQYHIEDSSDVIQGVATPCLTN"
FT   misc_feature    join(378430..378498,378556..378624,378808..378876,
FT                   378919..378987,379174..379242)
FT                   /note="5 probable transmembrane helices predicted for
FT                   YE0319 by TMHMM2.0 at aa 33-55, 75-97, 159-181, 196-218 and
FT                   281-303"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    379528..380034
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 149.5, E-value 3.8e-42"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    379549..379572
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    379813..379857
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             380064..382850
FT                   /transl_table=11
FT                   /locus_tag="YE0320"
FT                   /product="probable exported Zinc protease"
FT                   /note="Similar to many proposed Zinc proteases including:
FT                   Escherichia coli probable zinc protease PqqL or b1494
FT                   SWALL:PQQL_ECOLI (SWALL:P31828) (931 aa) fasta scores: E():
FT                   6.4e-50, 26.11 38d in 938 aa and Haemophilus influenzae
FT                   probable zinc protease PqqL or hi1368 SWALL:PQQL_HAEIN
FT                   (SWALL:P45181) (926 aa) fasta scores: E(): 3.6e-52, 24.01
FT                   38d in 937 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10452"
FT                   /db_xref="GOA:A1JIL3"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL3"
FT                   /inference="similar to sequence:UniProtKB:P31828"
FT                   /inference="similar to sequence:UniProtKB:P45181"
FT                   /protein_id="CAL10452.1"
FT                   /translation="MFNQLVRTLFVCLFVGCVLPVSAQEQTLPVRADLQHFTLGNGMQV
FT                   YLLPRDQPGVELRLLVNSGSLQESEQQRGLAHFVEHMAFKGTRHFPGTSSFKSLEKQGI
FT                   TLGSHVNAVTSLNATTYKLSLPNADEKQLTLGLRILSDWAQGISFEPAAFDKERQVIVE
FT                   EWRLRQGVGFRINQALEQLRYHGSRYAERDPIGLLAVVRQAPVSEAVNYYQQWYQPQRM
FT                   ALVVVGQFKVKDLRKQINELFAIPVPEKLAKDDASWSKFAQQPGLMLSTVFDAEQGTRI
FT                   IQLALQRDLAAPLNSDNGQWRDLLDTLWLTIFNQRLSLLVDNDLLSVASINQQGALLDK
FT                   RRIQHLMIARPQGSDYNGTLRQLFTELQRMATAPVSEAELNAARQQILIKLSQQAASES
FT                   RYQHGYLADNLTTAIEFELPMLNKQQQFAMTKTWLEAIGPQHVQAQVAELLQEGSARLA
FT                   LIGPDSDKSLVDNQQLATMWNSIRQSAPGPFTLKPKPVTLTVTPPPAGKIVQRQVLPIP
FT                   DTQLWTLSNGIRVIVKANNRLKDDVQLSLRIPGGRSLEDDSRVGEVNWAMRLPEVSGYS
FT                   QYNPRQLAQLGKQTEVAIAPYDEMLFHGLRGSAPADKLEPLLQLLYLKISAPQFSAEKL
FT                   AQQKQSFGLGLEKQPVERRFLDSITQAGYQHGDRLLVTATGPWRNFTVAGLEQRHRQLF
FT                   SATQDMTVTLSGALDEKRLQPLVEKWLGSLPRSEQRLHWRDLAIKPLNQAMSLDYPLAS
FT                   SPKTMVSMQFSADANWSQPNLLALQLLDKIVTLRLRYDMREQASGIYTLGFSQLLAKLP
FT                   QPYYLARLNFTSAPERSQEMAQMAQKVLQQIATAGVTQSELDKAKKAWWIEQDASRSSA
FT                   SYWTDALAQVASDDGNFALLAQEEQQVKAVTLEQVNVLAAKWLGRNPKVFSLSPAKM"
FT   sig_peptide     380064..380132
FT                   /locus_tag="YE0320"
FT                   /note="Signal peptide predicted for YE0320 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.953 between residues 23 and 24"
FT   misc_feature    380190..380621
FT                   /note="Pfam match to entry PF00675 Peptidase_M16,Insulinase
FT                   (Peptidase family M16), score 83.6, E-value 2.5e-22"
FT                   /inference="protein motif:PFAM:PF00675"
FT   misc_feature    380253..380324
FT                   /note="PS00143 Insulinase family, zinc-binding region
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00143"
FT   CDS             382982..383233
FT                   /transl_table=11
FT                   /locus_tag="YE0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Escherichia coli hypothetical protein
FT                   YefM or b2017 SWALL:YEFM_ECOLI (SWALL:P46147) (83 aa) fasta
FT                   scores: E(): 2.8e-23, 76.54 38d in 81 aa and to Rhodococcus
FT                   erythropolis hypothetical protein SWALL:AAK11726
FT                   (EMBL:AY026386) (85 aa) fasta scores: E(): 1.5e-11, 44.44
FT                   38d in 81 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10453"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL4"
FT                   /inference="similar to sequence:INSDC:AY026386"
FT                   /inference="similar to sequence:UniProtKB:P46147"
FT                   /protein_id="CAL10453.1"
FT                   /translation="MRTISYSEARQNLSTTMVQTVEDRAPILITRQNGTSCVLMSLEEY
FT                   ESLEETAYLLRSPANAKHLMDSIEELRAGKGIQRELEA"
FT   misc_feature    382985..383227
FT                   /note="Pfam match to entry PF02604 DUF172, Uncharacterized
FT                   ACR, COG2161, score 126.1, E-value 4.3e-35"
FT                   /inference="protein motif:PFAM:PF02604"
FT   CDS             complement(383508..386036)
FT                   /transl_table=11
FT                   /locus_tag="YE0322"
FT                   /product="putative inner-membrane transport protein"
FT                   /note="Similar to several proposed proteins of unknown
FT                   function and efflux proteins including: Escherichia coli
FT                   potassium efflux system KefA or b0465 SWALL:KEFA_ECOLI
FT                   (SWALL:P77338) (1120 aa) fasta scores: E(): 3.1e-19,24.28
FT                   38d in 803 aa and to Pseudomonas aeruginosa hypothetical
FT                   protein Pa1408 pa1408 SWALL:Q9I3T6 (EMBL:AE004570) (807 aa)
FT                   fasta scores: E(): 4.7e-100,41.48 38d in 793 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10454"
FT                   /db_xref="GOA:A1JIL5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR022249"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL5"
FT                   /inference="similar to sequence:INSDC:AE004570"
FT                   /inference="similar to sequence:UniProtKB:P77338"
FT                   /protein_id="CAL10454.1"
FT                   /translation="MCHNKYQASIPTQINGLIVVFTFGLTGFMKKNEHVVSLRHYPLFC
FT                   LLFTLICASLTVMSTTGSVLAATTSDTTTENDEEPAKPAVSVQLISLQKQLDKLKQNVS
FT                   VSTSDNQLNALNETAIALVKDVDILLAELKPKREQLQTQLDVLGPPPAAGTLTETPIVA
FT                   QQRRALNTRKIQLEGQHDQALSIKANAENLETQIIALRRTALKSQIALNSGSILGAKFW
FT                   APIVNPNTDDDKRLKDFIQELTDAWNAAWQPEWRTGTAIYLLLALLIGALGFKFLDKLT
FT                   GWFCTKCLPQGPLRRSFMASATTLYTVLITVTIAQCIIQAFTRTSDVSQVVMDFALAFI
FT                   QLMFFSALVAGLGRAFLSNQRPSWRLPAIADEVAASLKLFPPLLASCIMIFGAIDQMNN
FT                   MINISVSGTIFGNGISALLVALTAAIIPLRANRIRRNLVVNGEKPEAYSTLAGLIHLAI
FT                   GITAIAILLSLLVGYIALAKFLSYKLVWVCLVLSCLYLLTHLCVDLAESLFSPTSSAGK
FT                   AIKQTLNIDDRHLAQVATLLSATSKVTLILLAIIALFNGTFGSTTPVSLLQKTVELLGG
FT                   EGLEKLNIVPTNLFNAALCLLIGLYALNVARRWLSNEFLPKTQMDTGIKTSAVTLFSNI
FT                   GYVLVILLTLSVLGIQWNKLAWIVSALSVGIGFGLQEIVKNFISGIILLTERPVKVGDL
FT                   ISISGVEGDIRRINVRATEIQLSDRSTVIVPNSQLISQNVRNATMANAQGVVTIALTFP
FT                   LDLDVELAQELLIAAYEEHESILDTPAPSVKFSQLSPDGIVLSVTGLVPSPRMVSNTKS
FT                   ELLFSILKRLRAAGVSLEMAVPLRTLPTAN"
FT   misc_feature    complement(383547..384152)
FT                   /note="Pfam match to entry PF00924
FT                   MS_channel,Mechanosensitive ion channel, score 164.9,
FT                   E-value 8.9e-47"
FT                   /inference="protein motif:PFAM:PF00924"
FT   misc_feature    complement(join(384015..384074,384093..384161,
FT                   384219..384287,384336..384404,384531..384599,
FT                   384618..384686,384759..384827,384966..385034,
FT                   385077..385145,385206..385274,385359..385412,
FT                   385839..385907,385950..386018))
FT                   /note="13 probable transmembrane helices predicted for
FT                   YE0322 by TMHMM2.0 at aa 7-29, 44-66, 209-226,
FT                   255-277,298-320, 335-357, 404-426, 451-473, 480-502,
FT                   545-567,584-606, 626-648 and 655-674"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             386263..388395
FT                   /transl_table=11
FT                   /gene="foxA"
FT                   /locus_tag="YE0323"
FT                   /product="ferrioxamine receptor precursor"
FT                   /note="Previously sequenced as Yersinia enterocolitica
FT                   ferrioxamine receptor precursor FoxA SWALL:FOXA_YEREN
FT                   (SWALL:Q01674) (710 aa) fasta scores: E(): 0, 99.29 38d in
FT                   710 aa. Also highly similar to Salmonella typhimurium
FT                   ferrioxamine B receptor precursor FoxA or stm0364
FT                   SWALL:FOXA_SALTY (SWALL:Q56145) (702 aa) fasta scores: E():
FT                   4.3e-96, 41.33 38d in 704 aa and to Erwinia chrysanthemi
FT                   ferrichrysobactin receptor precursor Fct SWALL:FCT_ERWCH
FT                   (SWALL:Q47162) (735 aa) fasta scores: E(): 5.3e-70, 37.08
FT                   38d in 728 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10455"
FT                   /db_xref="GOA:A1JIL6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL6"
FT                   /inference="similar to sequence:UniProtKB:Q01674"
FT                   /inference="similar to sequence:UniProtKB:Q56145"
FT                   /inference="similar to sequence:UniProtKB:Q47162"
FT                   /protein_id="CAL10455.1"
FT                   /translation="MFSAFIIKRSAILCSLAMFIPLASIADDTIEVTAKAGHEADLPTL
FT                   GYTATTTKGATKTDQPLILTAQAVSVVTRQQMDDQNVATVNQALNYTPGVFTGFSGGAT
FT                   RYDTVALRGFHGGDVNNTFLDGLRLLSDGGSYNVLQVDPWFLERIDVIKGPSSALYGQS
FT                   IPGGVVMMTSKRPQFTSEGHFRLTAGNNNTQVAAFDYTDAISEHWAFRLTGITRNSDTM
FT                   YDHQREERYAIAPSLLWQPDENTSLLLRANLQKDPSGGYHSAVPADGSIYGQKLSRGFF
FT                   DGESNHNVFKRWQQIYSYEFSHKFDDVWSFRQNASYTHSNTQLEQVYQGGWNSDRTLMN
FT                   RYYSGEDSSLNAFAVDNQLEADFATAAVKHKVLLGVDFQKFRNNLRSDSAYATPLNPYT
FT                   GVSGGSTLYSDYLLTTPGINTSYLSRRYEQSGVYLQDEMTLDNWHLNLSGRYDRMKTEN
FT                   INNTANSTDERTDNHASGRASLLYSFDSGISPYVSYSQAITPSLFPDAQQKLLKPMTSE
FT                   QYEVGIKYQPPGSTSLYSAALYDLTQNDVANRAVPATYYVPAGKVNSQGLELEARSQIS
FT                   DRLSVIAGYTYNRVKFKDAIDGNDGNTPVLAPSNMASLWAQYEAGYGINVGAGIRYIGK
FT                   QWADDANTLRVPSYTLGDASVRADLGTWAASLKGAFVQLNVNNIADKKYVAACYSTSYC
FT                   YWGAERSVQATVGYDF"
FT   sig_peptide     386263..386340
FT                   /gene="foxA"
FT                   /locus_tag="YE0323"
FT                   /note="Signal peptide predicted for YE0323 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 26 and 27"
FT   misc_feature    386263..386367
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   misc_feature    388066..388392
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 130.0,E-value
FT                   2.9e-36"
FT                   /inference="protein motif:PFAM:PF00593"
FT   misc_feature    388339..388392
FT                   /note="PS01156 TonB-dependent receptor proteins signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS01156"
FT   CDS             388865..390373
FT                   /transl_table=11
FT                   /locus_tag="YE0324"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="Similar to many including: Pseudomonas aeruginosa
FT                   probable transcriptional regulator Pa2032 SWALL:Q9I283
FT                   (EMBL:AE004629) (474 aa) fasta scores: E(): 1.2e-119,64.25
FT                   38d in 470 aa, Escherichia coli O157:H7 putative regulator
FT                   YjiR or z5941 or ecs5302 SWALL:Q8XB83 (EMBL:AE005665) (470
FT                   aa) fasta scores: E(): 2.9e-104,56.47 38d in 471 aa, and
FT                   Escherichia coli hypothetical protein YdcR or b1439
FT                   SWALL:YDCR_ECOLI (SWALL:P77730) (468 aa) fasta scores: E():
FT                   2.9e-47, 33.68 38d in 472 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10456"
FT                   /db_xref="GOA:A1JIL7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL7"
FT                   /inference="similar to sequence:INSDC:AE004629"
FT                   /inference="similar to sequence:INSDC:AE005665"
FT                   /inference="similar to sequence:UniProtKB:P77730"
FT                   /protein_id="CAL10456.1"
FT                   /translation="MTRYQQLADILSQRIKAGLYAAGERLPSVRLLSSEHGVSISTVQQ
FT                   AYRQLEECLLIEARAKSGYFVRCSSNLPSLPATCTHAQRPVEISQWENTLAFLQKSDQE
FT                   DVIHLGAGSPDLSGPGLKILSRLLSRVSLHQSEEVLEYDNIYGSPVLREQIARLMLDSG
FT                   NHQSAENIIITSGCHGALAIALGAVCQSGDIVAVDSPSFHGAMQTLKGMGMKVIEIPTD
FT                   PVVGISLEALEMALDQWPIKAVQLTPTCNNPLGYNMPDERKKALLTLAQRYDIAIIEDD
FT                   VYGALAYQYPRPPTIASFDDDGRVLLCSSFSKTVAPGLRIGWISPGRYLDKALHMKYIS
FT                   AGRVASLPQLAMAEFIKQGHYMQHLRRMRRQYQRNRDIMTGWVMKYFPPNTCLSRPQGS
FT                   FMLWVELPHGFDSLRLNRCLLPLGVQVAAGFISSASGKYRNCLRLSYSKPMTAEIERAV
FT                   QKVGKTIYELLEEGGLSIGTEKPNQPGVGEVNDKVPVTVKTGRS"
FT   misc_feature    388883..389062
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 55.3, E-value
FT                   8.5e-14"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    389333..390247
FT                   /note="Pfam match to entry PF00155
FT                   aminotran_1_2,Aminotransferase class I and II, score 28.0,
FT                   E-value 3.2e-08"
FT                   /inference="protein motif:PFAM:PF00155"
FT   misc_feature    390233..390256
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(390519..391319)
FT                   /transl_table=11
FT                   /gene="hemV"
FT                   /locus_tag="YE0327"
FT                   /product="hemin transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10457"
FT                   /db_xref="GOA:A1JIL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL8"
FT                   /protein_id="CAL10457.1"
FT                   /translation="MVDTAVVDTALLEANQLSYHVQGQKLINNVSLQIASGEMVAIIGP
FT                   NGAGKSTLLRLLTGYLAPSEGHCQLLGKNLNSWQPQALARTRAVMRQYSDLAFPFSVSE
FT                   VIQMGRAPYGAAQNRQALQEVMAQTDCLALAQRDYRALSGGEQQRVQLARVLAQLWQPE
FT                   PTPRWLFLDEPTSALDLYHQQHTLRLLRQLTLEEPLAVCCVLHDLNLAALYADRILLLA
FT                   QGELVACGTPEEVLNAETLTRWYQADLGISRHPESALPQIYLRQ"
FT   misc_feature    complement(390648..391211)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 136.0, E-value 4.4e-38"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(390852..390896)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(391167..391190)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(391312..392316)
FT                   /transl_table=11
FT                   /gene="hemU"
FT                   /locus_tag="YE0328"
FT                   /product="hemin transport system permease protein HmuU"
FT                   /db_xref="EnsemblGenomes-Gn:YE0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10458"
FT                   /db_xref="GOA:A1JIL9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR029022"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIL9"
FT                   /protein_id="CAL10458.1"
FT                   /translation="MNCRIHPRLMLSILLMILIILALGSANMGALTLSFRTLWHASLDD
FT                   AMWHIWLNIRLPRVLLAVVVGCALAVSGAIMQGLFRNPLADPGLLGISSGAALCVGLII
FT                   VMPFSLPPLLALYSHMVGAFIGSLAISAIIFTLSRWGHGNLSRLLLAGIAINALCGAAV
FT                   GVLTYISDDQQLRQFSLWSMGSLGQAQWSTLMVAASLILPACVLGLLQARQLNLLQLGD
FT                   EEAHYLGVNVKQAKLRLLLLSAILIGAAVAVSGVIGFIGLVVPHLIRMRIGADHRWLLP
FT                   GAALGGACLLLTADTLARTLVAPAEMPVGLITSLLGGPYFLWLILRQREQRSG"
FT   misc_feature    complement(391336..392232)
FT                   /note="Pfam match to entry PF01032 FecCD, FecCD transport
FT                   family, score 495.9, E-value 2e-146"
FT                   /inference="protein motif:PFAM:PF01032"
FT   misc_feature    complement(join(391339..391398,391534..391602,
FT                   391681..391749,391807..391875,391912..391980,
FT                   391993..392052,392089..392157,392215..392283))
FT                   /note="8 probable transmembrane helices predicted for
FT                   YE0328 by TMHMM2.0 at aa 12-34, 54-76, 89-108,
FT                   113-135,148-170, 190-212, 239-261 and 307-326"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(391450..391482)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(392233..392316)
FT                   /gene="hemU"
FT                   /locus_tag="YE0328"
FT                   /note="Signal peptide predicted for YE0328 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.588 between residues 28 and 29"
FT   CDS             complement(392313..393152)
FT                   /transl_table=11
FT                   /gene="hemT"
FT                   /locus_tag="YE0329"
FT                   /product="hemin-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10459"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM0"
FT                   /protein_id="CAL10459.1"
FT                   /translation="MRLRLLSLPFILSLSACLLPLNSFAAERIVTIGGDVTEIAYALGA
FT                   GGEIVARDSTSLQPQAVQKLPDVGYMRMLNAEGILAMKPTMLLVSELAQPSLVLKQVAD
FT                   SGVNVVTVPGQTTPESVAVKINAVASALHQQEKGQALIKDYQQRLAAVNNTPLPVKVLF
FT                   VMSHGGLTPMAAGQNTAADAMIRAAGGSNAMQGFSRYRPLSQEGVIASAPDLLLITSDG
FT                   VRALGGSEGIWKLPGMALTPAGKNKRLLVVDDMALLGFGLETPQVLSQLRKGMEQAQ"
FT   misc_feature    complement(392388..393083)
FT                   /note="Pfam match to entry PF01497 Peripla_BP_2,Periplasmic
FT                   binding protein, score 210.7, E-value 1.4e-60"
FT                   /inference="protein motif:PFAM:PF01497"
FT   sig_peptide     complement(393078..393152)
FT                   /gene="hemT"
FT                   /locus_tag="YE0329"
FT                   /note="Signal peptide predicted for YE0329 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 25 and 26"
FT   misc_feature    complement(393102..393134)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(393149..394186)
FT                   /transl_table=11
FT                   /gene="hemS"
FT                   /locus_tag="YE0330"
FT                   /product="hemin transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10460"
FT                   /db_xref="GOA:A1JIM1"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM1"
FT                   /protein_id="CAL10460.1"
FT                   /translation="MSKSIYEQYLQAKADNPGKYARDLATLMGISEAELTHSRVSHDAK
FT                   RLKGDARALLAALEAVGEVKAITRNTYAVHEQMGRYENQHLNGHAGLILNPRNLDLRLF
FT                   LNQWASAFTLTEETRHGVRHSIQFFDHQGDALHKVYVTEQTDMPAWEALLAQFITTENP
FT                   ELQLEPLSAPEVTEPTATDEAVDAEWRAMTDVHQFFQLLKRNNLTRQQAFRAVGNDLAY
FT                   QVDNSSLTQLLNIAQQEQNEIMIFVGNRGCVQIFTGMIEKVTPHQDWINVFNQRFTLHL
FT                   IETTIAESWITRKPTKDGFVTSLELFAADGTQIAQLYGQRTEGQPEQTQWREQIARLNN
FT                   KDIAA"
FT   CDS             complement(394303..396366)
FT                   /transl_table=11
FT                   /gene="hemR"
FT                   /locus_tag="YE0331"
FT                   /product="hemin receptor precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10461"
FT                   /db_xref="GOA:A1JIM2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM2"
FT                   /protein_id="CAL10461.1"
FT                   /translation="MPRSTSDRFRWSPLSLAIACTLPLAVQAADTSSTQTNSKKRTADT
FT                   MVVTATGNERSSFEAPMMVTVVEADTPTSETATSATDMLRNIPGLTVTGSGRVNGQDVT
FT                   LRGYGKQGVLTLVDGIRQGTDTGHLNSTFLDPALVKRVEIVRGPSALLYGSGALGGVIS
FT                   YETVDAADLLLPGQNSGYRVYSAAATGDHSFGLGASAFGRTDDVDGILSFGTRDIGNIR
FT                   QSDGFNAPNDETISNVLAKGTWRIDQIQSLSANLRYYNNSALEPKNPQTSAASSTNLMT
FT                   DRSTIQRDAQLKYNIKPLDQEWLNATAQVYYSEVEINARPQGTPEEGRKQTTKGGKLEN
FT                   RTRLFTDSFASHLLTYGTEAYKQEQTPSGATESFPQADIRFGSGWLQDEITLRDLPVSI
FT                   LAGTRYDNYRGSSEGYADVDADKWSSRGAVSVTPTDWLMLFGSYAQAFRAPTMGEMYND
FT                   SKHFSMNIMGNTLTNYWVPNPNLKPETNETQEYGFGLRFNDLMMAEDDLQFKASYFDTN
FT                   AKDYISTGVTMDFGFGPGGLYCKNCSTYSTNIDRAKIWGWDATMTYQTQWFNLGLAYNR
FT                   TRGKNQNTNEWLDTINPDTVTSTLDVPVANSGFAVGWIGTFADRSSRVSSSGTPQAGYG
FT                   VNDFYVSYKGQEQFKGMTTTVVLGNAFDKEYYAPQGVPQDGRNAKFFVSYQW"
FT   misc_feature    complement(394306..394611)
FT                   /note="Pfam match to entry PF00593 TonB_boxC, TonB
FT                   dependent receptor C-terminal region, score 76.4, E-value
FT                   3.9e-20"
FT                   /inference="protein motif:PFAM:PF00593"
FT   misc_feature    complement(396214..396366)
FT                   /note="PS00430 TonB-dependent receptor proteins signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00430"
FT   sig_peptide     complement(396283..396366)
FT                   /gene="hemR"
FT                   /locus_tag="YE0331"
FT                   /note="Signal peptide predicted for YE0331 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 28 and 29"
FT   CDS             complement(396539..396784)
FT                   /transl_table=11
FT                   /gene="hemP"
FT                   /locus_tag="YE0332"
FT                   /product="hemin uptake protein"
FT                   /note="Previously sequenced as: Yersinia enterocolitica
FT                   hemin uptake protein HemP SWALL:HEMP_YEREN (SWALL:P31516)
FT                   (81 aa) fasta scores: E(): 1.3e-31, 100 38d in 81 aa. Also
FT                   similar to Salmonella typhimurium, and Salmonella typhi
FT                   putative cytoplasmic protein YdiE or stm1346 or sty1764
FT                   SWALL:Q8XGW6 (EMBL:AE008758) (63 aa) fasta scores: E():
FT                   0.019, 41.27 38d in 63 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10462"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM3"
FT                   /inference="similar to sequence:INSDC:AE008758"
FT                   /inference="similar to sequence:UniProtKB:P31516"
FT                   /protein_id="CAL10462.1"
FT                   /translation="MIDNAYHIDSGYHYLVCNMDKQLNKAPTMNDEPAAKPPAGNKPLS
FT                   VSSEQLLGEHGVAFIIHQGECYQLRQTKAGKLILTK"
FT   CDS             complement(396816..397466)
FT                   /transl_table=11
FT                   /locus_tag="YE0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10463"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM4"
FT                   /protein_id="CAL10463.1"
FT                   /translation="MKPWLIFGAGHGVGAHLLALANQHANAAQNPRSVTLLIRNPQQAE
FT                   ELRSKGLTVVCGDACDPGSVYQACQLAGPDAAIISTLGSRTADYQGNRLIIDTAEKLGL
FT                   KRMLLVTSIGCGDSWPTLSPAARAAFGQAVREKSLAESWLQTSNLTYTLIRPGGLLDQS
FT                   ATGKAIRLQTEAHGLVTREDVAIHLSQMVEDPATYHQIYALVDPGLVREVKIN"
FT   CDS             complement(397463..398008)
FT                   /transl_table=11
FT                   /locus_tag="YE0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10464"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM5"
FT                   /protein_id="CAL10464.1"
FT                   /translation="MNAPTLQNKPSLAEFLATQPDGTLEQIAQDYQVSPLDVVRELPKR
FT                   VLVSAEHFDRVWDSMTEWGDVTTLVHTADIILEHKGPLPSGFHRHGYFNLREKQGLSGH
FT                   IRAQNCQAIALLERPFMGMATASVQFFNQQGDVMLKVYVGRDEHRQLLTDGLAAFHQLA
FT                   QQLAQESSIFDKKIKETP"
FT   CDS             complement(398005..399318)
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="YE0335"
FT                   /product="putative coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10465"
FT                   /db_xref="GOA:A1JIM6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR026332"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM6"
FT                   /protein_id="CAL10465.1"
FT                   /translation="MNIDLMPYHARQGPLPFPKRWATMPWRDSRPLPAESLQDSWQALL
FT                   QKALPPNKRLLYLHIPFCATHCTFCGFYQNPLQTDSTARYTDYLLRELSMEASSPLLQG
FT                   GPIHAIYFGGGTPSALSAQQLHSIISQLRKSLPLAPDCEITVEGRIFNFDDERIDACLE
FT                   AGANRFSVGIQTFNTRIRQRMGRKASRDEAIHFLTNLASRDRAAVVCDLMFGLPHQTPE
FT                   TWQEDLAIVRQLPLDGVDLYALNLLPTTPLAKSVENNRIELPTLAQQCDFYCSGAENLA
FT                   QAGWHQLSNSHWARTTRERNLYNLLIKQGADCLALGSGAGGSLQGHAYMQHRSLDNYYR
FT                   LIDSGQKPLMMMTQASGEHPWRAKLQSGIEVGRLDLSELITDPYPLMPLIAQWHQSHLL
FT                   KDDSFCLRLTDSGRFWASNIMQALQNIIPSLITTESHS"
FT   misc_feature    complement(398287..399018)
FT                   /note="Pfam match to entry PF02473
FT                   Coprogen_an_ox,Oxygen-independent Coproporphyrinogen III
FT                   oxidase, score -17.3, E-value 2.3e-14"
FT                   /inference="protein motif:PFAM:PF02473"
FT   CDS             399955..400947
FT                   /transl_table=11
FT                   /gene="tdcB"
FT                   /locus_tag="YE0336"
FT                   /product="threonine dehydratase catabolic"
FT                   /EC_number="4.3.1.19"
FT                   /note="Similar to Escherichia coli, and Escherichia coli
FT                   O157:H7 threonine dehydratase catabolic TdcB or b3117 or
FT                   z4469 or ecs3997 SWALL:THD2_ECOLI (SWALL:P05792) (329 aa)
FT                   fasta scores: E(): 1.1e-96, 78.83 38d in 326 aa, and to
FT                   Salmonella typhimurium threonine dehydratase catabolic TdcB
FT                   or stm3244 SWALL:THD2_SALTY (SWALL:P11954) (329 aa) fasta
FT                   scores: E(): 1.5e-96, 79.14 38d in 326 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0336"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10466"
FT                   /db_xref="GOA:A1JIM7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIM7"
FT                   /inference="similar to sequence:UniProtKB:P05792"
FT                   /inference="similar to sequence:UniProtKB:P11954"
FT                   /protein_id="CAL10466.1"
FT                   /translation="MKIYSNLPITINDVIEAQKRLQGHIYKTGLARSNYLSERCHGEIY
FT                   LKFENMQRTGSFKIRGAFNKLSSLSEEQRKQGVVACSAGNHAQGVSLSCAMLGINSKVV
FT                   MPNCAPKSKIAATSEYSAEVVLHGENFNDTIAKASEIIEMENRIFIHPFDDEKVIAGQG
FT                   TIGLEILEDLYDVDNVIVPIGGGGLISGIALAIKSINPTINIIGVQSENVHGMAASYYS
FT                   GSITNHRKASTLADGCDVARPGTLPFEIVKALVTDIVLVSEDEIRRSMVDLIQRNKIIT
FT                   EGAGALASAALLSGKLKYYITGKKTVSIISGGNIDLSRVSQITGLGSIS"
FT   misc_feature    400015..400893
FT                   /note="Pfam match to entry PF00291 PALP,Pyridoxal-phosphate
FT                   dependent enzyme, score 299.5,E-value 2.6e-87"
FT                   /inference="protein motif:PFAM:PF00291"
FT   misc_feature    400099..400140
FT                   /note="PS00165 Serine/threonine dehydratases
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00165"
FT   misc_feature    400204..400236
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             400972..402300
FT                   /transl_table=11
FT                   /gene="tdcC"
FT                   /locus_tag="YE0337"
FT                   /product="threonine/serine transporter"
FT                   /note="Highly similar to many threonine/serine transporters
FT                   including: Escherichia coli, and Escherichia coli O157:H7
FT                   threonine/serine transporter TdcC or b3116 or z4468 or
FT                   ecs3996 SWALL:TDCC_ECOLI (SWALL:P11867) (443 aa) fasta
FT                   scores: E(): 1.4e-148, 85.64 38d in 439 aa and Salmonella
FT                   typhimurium haaap family, L-threonine/ l-serine permease,
FT                   anaerobically inducible TdcC or stm3243 SWALL:Q8ZLW1
FT                   (EMBL:AE008849) (443 aa) fasta scores: E(): 3.4e-148, 85.64
FT                   38d in 439 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10467"
FT                   /db_xref="GOA:A1JIM8"
FT                   /db_xref="InterPro:IPR004694"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="InterPro:IPR023726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIM8"
FT                   /inference="similar to sequence:INSDC:AE008849"
FT                   /inference="similar to sequence:UniProtKB:P11867"
FT                   /protein_id="CAL10467.1"
FT                   /translation="MHIDNAITTTIETKTWRKSDTTWTLGLFGTAIGAGVLFFPIRAGF
FT                   GGLIPILIMLVLAYPIAFLCHRALARLCLSGSNCSGNITETVEEHFGKTGGVVITFLYF
FT                   FAICPLLWIYGVTITNTFMTFWENQLQLAPLNRGVVALALLLLMAVVIYFGKDLMVKVM
FT                   SFLVFPFIACLVLISLSLIPYWNASVIEQVDLSQISLLGHDGILVTVWLGISIMVFSFN
FT                   FSPIVSSFVVSKREEYEPEFGREYTEKKCSQIISRASILMVAVVMFFAFSCLFTLSPQN
FT                   MAEAKAQNIPVLSYLANHFSSMAGSRSTFSITLEYAASLIALVAIFKSFFGHYLGTLEG
FT                   LNGLVIKFGYKGDKTKISSGKLNLISMFFIMGSTWLVAYINPNILDLIEAMGAPIIASL
FT                   LCLLPMYAIHKLPSLARFRGRPENYFVTIVGLLTIFNIVYKLL"
FT   misc_feature    join(401032..401100,401113..401181,401257..401325,
FT                   401368..401436,401455..401523,401602..401670,
FT                   401731..401799,401917..401985,402043..402111,
FT                   402139..402198,402235..402288)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0337 by TMHMM2.0 at aa 21-43, 48-70, 96-118,
FT                   133-155,162-184, 211-233, 254-276, 316-338, 358-380,
FT                   390-409 and 422-439"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    401758..401790
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             402319..403575
FT                   /transl_table=11
FT                   /gene="tdcD"
FT                   /locus_tag="YE0338"
FT                   /product="propionate kinase"
FT                   /EC_number="2.7.2.-"
FT                   /note="Similar to many kinases including: Escherichia coli
FT                   propionate kinase TdcD or b3115 SWALL:TDCD_ECOLI
FT                   (SWALL:P11868) (402 aa) fasta scores: E(): 6.3e-102,66.83
FT                   38d in 389 aa, Salmonella typhimurium propionate kinase
FT                   TdcD or oxd-2 or stm3242 SWALL:TDCD_SALTY (SWALL:O06961)
FT                   (402 aa) fasta scores: E(): 1.1e-101,66.83 38d in 389 aa
FT                   and Neisseria meningitidis acetate kinase AckA1 or nma1718
FT                   SWALL:Q9JTM0 (EMBL:AL162756) (408 aa) fasta scores: E():
FT                   2.3e-69, 47.16 38d in 405 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10468"
FT                   /db_xref="GOA:A1JIM9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="InterPro:IPR024917"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIM9"
FT                   /inference="similar to sequence:INSDC:AL162756"
FT                   /inference="similar to sequence:UniProtKB:P11868"
FT                   /inference="similar to sequence:UniProtKB:O06961"
FT                   /protein_id="CAL10468.1"
FT                   /translation="MFYPMKHGRSNHMTLNPTVLVINCGSSSIKFSVLTADNCEAVISG
FT                   IADGIGTEKPFLRIDRVTQFQLAKWNYSDALAAIADELDKRGLSKSISLIGHRIAHGGE
FT                   IFSESVLIDDRVVEEIKKVSPLAPLHNYANLHGVGAARQLFPGIKQVAVFDTGFHQTLK
FT                   PEAYLYALPYRYFREQGVRRYGFHGTSYRYVVGEAASFLGFDGSDCGLIIAHLGNGASL
FT                   CAVQDGKSVDTSMGMTPLEGLIMGTRSGDVDYGALAYLARQTGQSLEDLDHMVNKESGL
FT                   LGISGLSADMRVLENAYHEGHEGARLAINTFVHRLARHIGGHASSLRRFDALIFTGGIG
FT                   ENSSLIRQLTLEHLAVFGIDIDHAKNKRLQHGTSQIITTARSRVTAAVIPTNEEKMIAL
FT                   DAIRLGYAQQGTVVLEAVI"
FT   misc_feature    402370..403515
FT                   /note="Pfam match to entry PF00871
FT                   Acetate_kinase,Acetokinase family, score 653.9, E-value
FT                   5.4e-194"
FT                   /inference="protein motif:PFAM:PF00871"
FT   misc_feature    402373..402408
FT                   /note="PS01075 Acetate and butyrate kinases family
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS01075"
FT   misc_feature    402577..402618
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00105"
FT   misc_feature    402949..403002
FT                   /note="PS01076 Acetate and butyrate kinases family
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS01076"
FT   CDS             403626..405920
FT                   /transl_table=11
FT                   /gene="tdcE"
FT                   /locus_tag="YE0339"
FT                   /product="keto-acid formate acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="Highly similar to many including: Escherichia coli
FT                   keto-acid formate acetyltransferase TdcE or b3114
FT                   SWALL:TDCE_ECOLI (SWALL:P42632) (746 aa) fasta scores: E():
FT                   0, 85.83 38d in 741 aa and to Yersinia pestis formate
FT                   acetyltransferase 1 PflB or ypo1383 SWALL:Q8ZGC0
FT                   (EMBL:AJ414148) (760 aa) fasta scores: E(): 0, 75.92 38d in
FT                   756 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10469"
FT                   /db_xref="GOA:A1JIN0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN0"
FT                   /inference="similar to sequence:INSDC:AJ414148"
FT                   /inference="similar to sequence:UniProtKB:P42632"
FT                   /protein_id="CAL10469.1"
FT                   /translation="MKIDVDISNKKYADAWLGFSGNDWRDEINVRDFIQKNYLPYEGNE
FT                   SFLSEATPATQKLWEQVMEGIRQENATHAPVDFDDDIATTITAHDAGYIEQGLEKIVGL
FT                   QTDKPLKRALHPFGGINMVQSAFDAYGREMNDDFKYIFTDLRKTHNQGVFDVYSPEMLK
FT                   CRKSGILTGLPDGYGRGRIIGDYRRIALYGIDYLVRERELQFADLQPQLEQGIELESVI
FT                   RLREELAEHRHALLQIKTMAARYGFDISSPAQNAREAIQWLYFGYLAAVKSQNGGAMSL
FT                   GRTATFLDIYIERDLASGLLNEQAAQELVDHFIMKIRMVRFLRTPEFDSLFSGDPIWAT
FT                   EVLGGMGLDGRTLVTKNTFRYLHTLDTMGPAPEPNLTILWSEALPAAFKSYAANVSIQT
FT                   SSLQYENDDLMRPDFNSDDYAIACCVSPMVLGKQMQFFGARANLAKTLLYCINGGVDEK
FT                   LKIQVGPKCAPMTDEVLDYERVMVSLDVFMDWLAVQYISALNLIHYMHDKYSYEASLMA
FT                   LHDRDVYRTMACGIAGLSVAADSLSAIKYAKVKPIRDTDGLAIDFAIEGEYPQYGNNDE
FT                   RVDAIACDLVERFMKKISKLPTYRHAVPTQSILTITSNVVYGQKTGNTPDGRRSGMPFA
FT                   PGANPMHGRDRKGAIASLTSVSKLPFKYAKDGISYTFSIVPAALGKDSAVRNNNLVGLL
FT                   DGYFHHDAAMEGGQHLNINVMNRDMLLDAIAHPENYPNLTIRVSGYAVRFNALTSEQQQ
FT                   DVISRTFTNAL"
FT   misc_feature    403812..405479
FT                   /note="Pfam match to entry PF02901 PFL, Pyruvate formate
FT                   lyase, score 1026.8, E-value 0"
FT                   /inference="protein motif:PFAM:PF02901"
FT   misc_feature    405525..405863
FT                   /note="Pfam match to entry PF01228 Gly_radical, Glycine
FT                   radical, score 212.3, E-value 4.7e-61"
FT                   /inference="protein motif:PFAM:PF01228"
FT   CDS             complement(406648..407421)
FT                   /transl_table=11
FT                   /locus_tag="YE0341"
FT                   /product="putative dehydrogenase/reductase"
FT                   /note="Similar to many putative oxidoreductases: Rhizobium
FT                   loti glucose dehydrogenase Mlr5280 SWALL:Q98C63
FT                   (EMBL:AP003006) (250 aa) fasta scores: E(): 1.2e-39,44.98
FT                   38d in 249 aa and Streptomyces coelicolor putative
FT                   dehydrogenase/reductase Sco2651 or sc8e4a.21C SWALL:Q9L1Y4
FT                   (EMBL:AL138662) (245 aa) fasta scores: E(): 3.2e-29,38.55
FT                   38d in 249 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10471"
FT                   /db_xref="GOA:A1JIN2"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN2"
FT                   /inference="similar to sequence:INSDC:AP003006"
FT                   /inference="similar to sequence:INSDC:AL138662"
FT                   /protein_id="CAL10471.1"
FT                   /translation="MTTQSLKGRIALVTGGTTGLGFGAAKRLVEHGATVYITGRRQNVL
FT                   DEAVNKLGTSARAICADVSSKEDMLRAAATIKAEQGHLDILFANAGGGHATPLEELTED
FT                   QIDSELSINIKGVVLTMQSMLDVLRDGSSVVLNASITADMGLPGFAVYAATKAAVRSLA
FT                   RSWTTDLKGRDIRINTISPSVIPTEGYSNEQKMSDNDIASYVERVSAEIPAGRVGTVED
FT                   IADALIFLVSDSSTYIRGIDLIVDGGMTRVYAGKN"
FT   misc_feature    complement(406675..407403)
FT                   /note="Pfam match to entry PF00106 adh_short, short chain
FT                   dehydrogenase, score 217.1, E-value 1.7e-62"
FT                   /inference="protein motif:PFAM:PF00106"
FT   CDS             complement(407491..408471)
FT                   /transl_table=11
FT                   /locus_tag="YE0342"
FT                   /product="putative aldo/keto reductase"
FT                   /note="Similar to Yersinia pestis putative aldo/keto
FT                   reductase Ypo2806 SWALL:Q8ZCZ6 (EMBL:AJ414153) (329 aa)
FT                   fasta scores: E(): 1.1e-80, 67.47 38d in 329 aa, and to
FT                   Xanthomonas campestris pv. campestris str. ATCC 33913
FT                   oxidoreductase Xcc2679 SWALL:AAM41951 (EMBL:AE012380) (327
FT                   aa) fasta scores: E(): 1.7e-76, 62.69 38d in 327 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10472"
FT                   /db_xref="GOA:A1JIN3"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN3"
FT                   /inference="similar to sequence:INSDC:AJ414153"
FT                   /inference="similar to sequence:INSDC:AE012380"
FT                   /protein_id="CAL10472.1"
FT                   /translation="MQKRQLGNSGLEVSALGLGCMGLTFGYGPATDKAEAIKLIRAAYE
FT                   RGVTLFDTAEAYGQVNEEMVGEAVAPFRDQIVIATKFGFKDGNAAAGLDSRPERIRTVV
FT                   EQSLKRLKTDYIDLFYQHRVDPNVPMEDVAGAVRDLIQEGKVKYFGMCEAGVKAIRDAH
FT                   AVQPLSALQSEYSMFTREPEDVIIPTLEELGIGFIPFSPLGKGFLTGKIDGATTFADGD
FT                   VRNNLPRFADEARQANHNLVALIGKVAERKQATPAQIALAWLLAQKPWIAPIPGTTKLH
FT                   RLEENVGGAAVELTTADLQEIADVLAKVPVQGERYNAAMMKSINR"
FT   misc_feature    complement(407545..408453)
FT                   /note="Pfam match to entry PF00248 aldo_ket_red, Aldo/keto
FT                   reductase family, score 214.2, E-value 1.2e-61"
FT                   /inference="protein motif:PFAM:PF00248"
FT   CDS             408604..409497
FT                   /transl_table=11
FT                   /locus_tag="YE0343"
FT                   /product="putative lysr-family transcriptional regulatory
FT                   protein"
FT                   /note="Similar to many proposed LysR-family transcriptional
FT                   regulators including: Yersinia pestis putative LysR-family
FT                   transcriptional regulatory protein PtxR or Ypo2807
FT                   SWALL:Q8ZCZ5 (EMBL:AJ414153) (297 aa) fasta scores: E():
FT                   1.2e-63, 54.23 38d in 295 aa, and to Ralstonia solanacearum
FT                   probable transcription regulator protein rsp1471 or rs03073
FT                   SWALL:Q8XQ15 (EMBL:AL646085) (297 aa) fasta scores: E():
FT                   5.8e-71, 59.18 38d in 294 aa,and to Xanthomonas axonopodis
FT                   pv. citri str. 306 transcriptional regulator lysr family
FT                   xac0302 SWALL:AAM35194 (EMBL:AE011655) (317 aa) fasta
FT                   scores: E(): 4.1e-66, 56.27 38d in 295 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10473"
FT                   /db_xref="GOA:A1JIN4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN4"
FT                   /inference="similar to sequence:INSDC:AJ414153"
FT                   /inference="similar to sequence:INSDC:AL646085"
FT                   /inference="similar to sequence:INSDC:AE011655"
FT                   /protein_id="CAL10473.1"
FT                   /translation="MDHTDFNHLAVFITVAREKSFTRAAAHLGVSQSAISHSIRGLEER
FT                   LGIRLLTRTTRGAVPTEAGERLLANLTPYYDGIETELATLGELREKPGGTIRISSHDHP
FT                   ATTILWPKLSKLLKEYPDITLEINVDYGLIDIVAGRFDAGVRIGDQIAKDMIAMRISPD
FT                   FRMIVVGSPDYFSRHPKPETPHDLTSHNCANLRLSTHGGLFAWEFEKGGQEVKVQVPGQ
FT                   MIFNTSPQLLTAALEGYGLAYAPEDVVQRYIKEGRLMPVLEEWSPLLPGYHLYYPSRRQ
FT                   ALPAFTLILNALRYVN"
FT   misc_feature    408619..408798
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   109.9, E-value 3.3e-30"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    408658..408723
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1902.000, SD 5.66 at aa 19-40, sequence
FT                   KSFTRAAAHLGVSQSAISHSIR"
FT   misc_feature    408661..408753
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    408868..409494
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 133.3, E-value 2.9e-37"
FT                   /inference="protein motif:PFAM:PF03466"
FT   CDS             410078..411052
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0344"
FT                   /product="putative HlyD-family secretion protein
FT                   (fragment)"
FT                   /note="Similar in part to Escherichia coli microcin h47
FT                   secretion protein MchE SWALL:MCHE_ECOLI (SWALL:Q9EXN6) (424
FT                   aa) fasta scores: E(): 1.4e-80, 70.46 38d in 325 aa and to
FT                   Pasteurella haemolytica leukotoxin secretion protein D LktD
FT                   SWALL:HLYD_PASHA (SWALL:P16534) (478 aa) fasta scores: E():
FT                   4e-05, 25.24 38d in 313 aa. This CDS appears to lack both
FT                   5' and 3' regions and is thought to be a gene remnant."
FT                   /inference="similar to sequence:UniProtKB:Q9EXN6"
FT                   /inference="similar to sequence:UniProtKB:P16534"
FT   misc_feature    410135..411061
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein, score 32.4, E-value 6.9e-07"
FT                   /inference="protein motif:PFAM:PF00529"
FT   CDS             411054..411212
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0345"
FT                   /product="integrase (fragment)"
FT                   /note="Similar to in parts to Yersinia pestis integrase
FT                   Ypo0961 SWALL:Q8ZHD9 (EMBL:AJ414145) (102 aa) fasta scores:
FT                   E(): 2.7e-16, 94.34 38d in 53 aa and Pseudomonas aeruginosa
FT                   XerC SWALL:Q9F771 (EMBL:AF285416) (427 aa) fasta scores:
FT                   E(): 0.0049, 44.18 38d in 43 aa"
FT                   /inference="similar to sequence:INSDC:AJ414145"
FT                   /inference="similar to sequence:INSDC:AF285416"
FT   tRNA            complement(411468..411543)
FT                   /gene="tRNA-Phe (GAA)"
FT                   /product="transfer RNA-Phe (GAA)"
FT   CDS             complement(411687..412262)
FT                   /transl_table=11
FT                   /locus_tag="YE0346"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10476"
FT                   /db_xref="GOA:A1JIN5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR015893"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN5"
FT                   /protein_id="CAL10476.1"
FT                   /translation="MQREQVLSSALNLLEQKGLANTTLEMLAEEVSAEVSDLTRFWPDR
FT                   EALLYDCLRYHGQQIDTWRRQLQLDETLSPKQKLLARYQTLSEQVQNQRYPGCLFIAAC
FT                   SFYPNDDHPIHQLAEQQKQASLNYTQELLHEMDADDAGMVAQQMELILEGCLSKLLVKR
FT                   QLQDVEVAKRLAEDILEVAQCRKNGALS"
FT   misc_feature    complement(412077..412124)
FT                   /note="PS00225 Crystallins beta and gamma 'Greek key' motif
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00225"
FT   misc_feature    complement(412107..412247)
FT                   /note="Pfam match to entry PF00440 tetR, Bacterial
FT                   regulatory proteins, tetR family, score 21.9, E-value
FT                   4.3e-05"
FT                   /inference="protein motif:PFAM:PF00440"
FT   CDS             412574..413737
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="YE0347"
FT                   /product="putative glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10477"
FT                   /db_xref="GOA:A1JIN6"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN6"
FT                   /protein_id="CAL10477.1"
FT                   /translation="MKIVIAPDSYKESLSALEVAVQIEAGFRTQFPDAEYIKLPVADGG
FT                   EGTVEAMVAATAGRVIKANVTGPLGEEVDAFYGVSGDEKCAFIEMAAASGLELVPPPLR
FT                   NPLKTTSYGTGELIGKALNQGVKHIIIGIGGSATNDGGAGMVQALGVKLLDKHGKQLGF
FT                   GGGKLAELDRIDISELDPRIKSCRIEVACDVTNPLTGSAGASVVFGRQKGATPAMIAQL
FT                   DEGLRHYADVIKRHLGIDVDQVEGAGAAGGLGAALLAFCGATLSPGIDIVTDALGLDAL
FT                   VRDATFVITGEGRMDSQTIHGKVPVGVARVAKRYNKPVIGIAGSLTDDVDVVYEHGLDA
FT                   VFSVIDTICTLDQALDNAADNVFRAARNIAATLAIGMTVGKAENTSG"
FT   misc_feature    412574..413707
FT                   /note="Pfam match to entry PF02595 DUF168, Uncharacterized
FT                   BCR, COG1929, score 795.4, E-value 1.4e-236"
FT                   /inference="protein motif:PFAM:PF02595"
FT   CDS             complement(413785..415521)
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /gene_synonym="cycZ"
FT                   /locus_tag="YE0348"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10478"
FT                   /db_xref="GOA:A1JIN7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIN7"
FT                   /protein_id="CAL10478.1"
FT                   /translation="MAQRFITLILLLCSILLAPHSAQASLFGDNSSFGQKSSQSRFIPV
FT                   DQAFAFDFRQQGDQLALSWQIHPDYYLYRQQIKIVPNNATFGAFTLPEGIAHRDEFYGE
FT                   VAIFKQQLTLKIPITQAGERASVSVTYQGCAEAGFCYPPETRVVPLSAITAGSSAVTAP
FT                   PIAAPATPAPAELPFSPLWALLIGIGIAFTPCVLPMYPLISAIILGREKPHSQRRILLL
FT                   AIVYVQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSALFVLLALSMFGLYSLQLP
FT                   SSLQTRLVQWSSSQRGGSLAGVFAMGALAGLICSPCTTAPLSAILLYIAQSGNMLAGGG
FT                   TLYLYALGMGIPLVIVTLFGNKLLPRSGPWMQYVKEAFGFVILALPVFLLERVLGDVWG
FT                   LRLWSLLAIAFFGWAFILSLKAHSGWARAFQLLLLAALLIAARPLQDWAFGSPTQQSEI
FT                   KHLAFKQVADLPQLQAALAQAKGKPVMLDLYADWCVACKEFEKYTFSDEQVQRQLADTV
FT                   LLQADVTANSAEHAALLKELNVLGLPTILFFDAPGNEIPAARVTGFMNASGFLQHLQNL
FT                   PR"
FT   misc_feature    complement(414013..414069)
FT                   /note="PS00194 Thioredoxin family active site."
FT                   /inference="protein motif:Prosite:PS00194"
FT   misc_feature    complement(join(414199..414252,414271..414330,
FT                   414340..414393,414430..414498,414556..414624,
FT                   414688..414756,414799..414867,414904..414972,
FT                   415441..415509))
FT                   /note="9 probable transmembrane helices predicted for
FT                   YE0348 by TMHMM2.0 at aa 5-27, 184-206, 219-241,
FT                   256-278,300-322, 342-364, 377-394, 398-417 and 424-441"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(414349..414975)
FT                   /note="Pfam match to entry PF02683 DsbD, Cytochrome C
FT                   biogenesis protein transmembrane region, score 36.8,E-value
FT                   3.3e-08"
FT                   /inference="protein motif:PFAM:PF02683"
FT   sig_peptide     complement(415450..415521)
FT                   /gene="dsbD"
FT                   /gene_synonym="cycZ"
FT                   /locus_tag="YE0348"
FT                   /note="Signal peptide predicted for YE0348 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 24 and 25"
FT   CDS             complement(415497..415799)
FT                   /transl_table=11
FT                   /locus_tag="YE0349"
FT                   /product="putative cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10479"
FT                   /db_xref="GOA:A1JIN8"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN8"
FT                   /protein_id="CAL10479.1"
FT                   /translation="MVLCTAPDEASAQDLAAQVLGEKLAACATLLPGATSIYSWEGKLQ
FT                   QEYEVQLLFKSNTRHQQALLSYIKQHHPYQTPELLVLPVRDGDKDYLSWLNASLL"
FT   misc_feature    complement(415500..415799)
FT                   /note="Pfam match to entry PF03091 CutA1, CutA1 divalent
FT                   ion tolerance protein, score 158.3, E-value 8.4e-45"
FT                   /inference="protein motif:PFAM:PF03091"
FT   CDS             complement(416005..417306)
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /gene_synonym="genA"
FT                   /gene_synonym="b4138"
FT                   /locus_tag="YE0350"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YE0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10480"
FT                   /db_xref="GOA:A1JIN9"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIN9"
FT                   /protein_id="CAL10480.1"
FT                   /translation="MIAVELVIVLLAIFLGARLGGIGIGFAGGIGVLVLAIIGVKPGSI
FT                   PFDVISIIMAVIAAISAMQVAGGMDYLVQQTEKLLRKNPKHITILAPLVTYFLTIFAGT
FT                   GNISLSALPVIAEVAKEQGIKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGVS
FT                   YLHLLMIVIPSTLLAVFVMSLIVSWCFNSKLSDDPIYIKRLEEGLVTLRGDTVKVIKPR
FT                   AKTSVLLFLAGVLCVVAYAIINSPSVGLVATPLMNTTNAILIIMLSVATITTMVCSVDT
FT                   DSILNSSTFKAGMSACICILGVAWLGDTFVQHNLDWIKETAGSLIQAHSWLLAVIFFFC
FT                   SALLYSQAATAKALMPMAMALNVSPLAAIASFAAVSGLFILPTYPTLVAAVQMDDTGTT
FT                   RIGRFVFNHPFFIPGTIGVALAVCFGFVMGGLVL"
FT   misc_feature    complement(join(416011..416079,416137..416205,
FT                   416266..416334,416392..416460,416497..416565,
FT                   416578..416631,416740..416808,416851..416919,
FT                   416980..417048,417091..417159,417196..417264))
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0350 by TMHMM2.0 at aa 15-37, 50-72, 87-109,
FT                   130-152,167-189, 226-243, 248-270, 283-305, 325-347,
FT                   368-390 and 410-432"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(416212..417294)
FT                   /note="Pfam match to entry PF03605 Dcu, Anaerobic
FT                   c4-dicarboxylate membrane transporter, score 746.3,E-value
FT                   8.5e-222"
FT                   /inference="protein motif:PFAM:PF03605"
FT   CDS             complement(417426..418862)
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="YE0351"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10481"
FT                   /db_xref="GOA:A1JIP0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP0"
FT                   /protein_id="CAL10481.1"
FT                   /translation="MSNNIRIEEDLLGTREVPAEAYYGVHTLRAIENFYISNSKISDVP
FT                   EFVRGMVMVKKAAAMANKELHTIPRKIADVIIQACDEVLDKGKCMDQFPVDVFQGGAGT
FT                   SLNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYASIMKL
FT                   IDAINQLKEGFERKSKEFEKILKMGRTQLQDAVPMTLGQEFKAFAVLLKEETKNLQRTA
FT                   ELLLEVNLGATAIGTALNTPEGYSQLAIQKLSEISGLPCVPAEDLIEATSDCGAYVMVH
FT                   GALKRLAVKMSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVIPEVVNQVC
FT                   FKVIGNDTCITMAAEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCINGITANKE
FT                   VCERYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKNVREVVLERGLLTEAELDDIFS
FT                   VENLMHPAYKAKRYTDENEQ"
FT   misc_feature    complement(417483..418826)
FT                   /note="Pfam match to entry PF00206 lyase_1, Lyase, score
FT                   705.1, E-value 2.1e-209"
FT                   /inference="protein motif:PFAM:PF00206"
FT   misc_feature    complement(417876..417905)
FT                   /note="PS00163 Fumarate lyases signature."
FT                   /inference="protein motif:Prosite:PS00163"
FT   CDS             419304..419831
FT                   /transl_table=11
FT                   /locus_tag="YE0352"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10482"
FT                   /db_xref="GOA:A1JIP1"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP1"
FT                   /protein_id="CAL10482.1"
FT                   /translation="MRWLPLALIFLLAYIEISIFIKVAAVLGVLVTLLLVIFSSCVGIS
FT                   LVRNQGIKTFMQMQQKLAAGESPAAEMVKSVSLVLAGFLLLIPGFFTDFLGLLLLLPPI
FT                   QKSLTLKLMPHLNIYRGGFSAGGFNHNNSGPMGGGNTFDGEFQRKTDDHFIVEHRPDED
FT                   DKSTDSRFKDDK"
FT   sig_peptide     419304..419375
FT                   /locus_tag="YE0352"
FT                   /note="Signal peptide predicted for YE0352 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.700) with cleavage site
FT                   probability 0.290 between residues 24 and 25"
FT   misc_feature    join(419313..419366,419379..419447,419538..419606)
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0352 by TMHMM2.0 at aa 4-21, 26-48 and 79-101"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    419394..419426
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             420084..420377
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /gene_synonym="hsp10"
FT                   /gene_synonym="crpB"
FT                   /locus_tag="YE0353"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:YE0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10483"
FT                   /db_xref="GOA:A1JIP2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIP2"
FT                   /protein_id="CAL10483.1"
FT                   /translation="MKIRPLHDRVIVKRKEVESKSAGGIVLTGTAAGKSTRGEVLAVGN
FT                   GRILDNGEIKPLDVKVGDIVIFNDGYGVKSEKIDHEEVLIMSESDILAIVEA"
FT   misc_feature    420084..420371
FT                   /note="Pfam match to entry PF00166 cpn10, Chaperonin 10 Kd
FT                   subunit, score 184.5, E-value 1.1e-52"
FT                   /inference="protein motif:PFAM:PF00166"
FT   misc_feature    420090..420164
FT                   /note="PS00681 Chaperonins cpn10 signature."
FT                   /inference="protein motif:Prosite:PS00681"
FT   CDS             420434..422086
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /gene_synonym="mopA"
FT                   /gene_synonym="hsp60"
FT                   /gene_synonym="crpA"
FT                   /locus_tag="YE0354"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:YE0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10484"
FT                   /db_xref="GOA:A1JIP3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIP3"
FT                   /protein_id="CAL10484.1"
FT                   /translation="MAAKDVKFGNDARIKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   SPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKKLSVPCSDSKAIAQVGTISANSDSTVGELIA
FT                   QAMEKVGKEGVITVEEGSGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTAGTVISEEIGLELEKTTLEDLGQAKRVVINKDTTIIIDGVGDEA
FT                   AIQGRVAQIRQQIEDATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALIRAASAITAAGLKGDNEDQNVGIKVALRAMESPLRQIVV
FT                   NAGEEASVIANNVKAGSGSYGYNAYSEEYGDMIAMGILDPTKVTRSALQYAASIAGLMI
FT                   TTECMITDLPRDDKGADMGAGGMGGMGGMGGMM"
FT   misc_feature    420500..422014
FT                   /note="Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60
FT                   chaperonin family, score 629.8, E-value 9.8e-187"
FT                   /inference="protein motif:PFAM:PF00118"
FT   misc_feature    421646..421681
FT                   /note="PS00296 Chaperonins cpn60 signature."
FT                   /inference="protein motif:Prosite:PS00296"
FT   CDS             422468..422806
FT                   /transl_table=11
FT                   /locus_tag="YE0355"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10485"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP4"
FT                   /protein_id="CAL10485.1"
FT                   /translation="MRIKVLLGLSAALLLAGCSSTNQLSSAGEQVKFSDTKPGSECQLV
FT                   GQVTGTQSNWISSGESSSMRGAANDLRNKAAAMGGNVIYGATSPSETFLSSFAPLDSKM
FT                   VGEVYKCP"
FT   sig_peptide     422468..422548
FT                   /locus_tag="YE0355"
FT                   /note="Signal peptide predicted for YE0355 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.628 between residues 27 and 28"
FT   misc_feature    422489..422521
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(422874..423911)
FT                   /transl_table=11
FT                   /locus_tag="YE0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10486"
FT                   /db_xref="GOA:A1JIP5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP5"
FT                   /protein_id="CAL10486.1"
FT                   /translation="MASIVTRNMPIREDWLQQLADVITDPDELLRILQLNEHPNLQQGT
FT                   AARRLFPLRVPRAFVARMQPGNPSDPLLLQVLTAREEFIAAPGFTNDPLDEQRSVVPGL
FT                   LHKYRNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWRQALDYVRQHPELDEIIFS
FT                   GGDPLMAKDSELSWLLDEIENISHIKRLRIHTRLPVVIPARITAELCQRLSDSRLQVLM
FT                   VTHINHANEIDASFRDSMAQLKRAGVTLLNQSVLLRGVNDDDEVLAALSNALFDAGILP
FT                   YYIHVLDKVQGAAHFMVDDDEARQLMKGLLSRVSGYLVPRLAREIGGQPSKTPLDLRLM
FT                   QDELQ"
FT   misc_feature    complement(422910..423857)
FT                   /note="Pfam match to entry PF02587 DUF160, Radical SAM
FT                   superfamily protein (COG1509), score 553.1, E-value
FT                   1.2e-163"
FT                   /inference="protein motif:PFAM:PF02587"
FT   CDS             423947..424513
FT                   /transl_table=11
FT                   /gene="efP"
FT                   /gene_synonym="b4147"
FT                   /locus_tag="YE0357"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:YE0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10487"
FT                   /db_xref="GOA:A1JIP6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIP6"
FT                   /protein_id="CAL10487.1"
FT                   /translation="MASYYSNDFRPGLKIMFEGEPYAVESSEFVKPGKGQAFARVKMRR
FT                   LLTGGRVEKTFKSTDSLEGADVNDLNLTYLYNDGEFWHFMNNETYEQLQADAKAIGDNA
FT                   KWLIDQAECIVTLWNGQPISVTPPNFIELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQVGEVIKVDTRSGEYVSRVK"
FT   misc_feature    423953..424507
FT                   /note="Pfam match to entry PF01132 EFP, Elongation factor P
FT                   (EF-P), score 395.7, E-value 3e-116"
FT                   /inference="protein motif:PFAM:PF01132"
FT   misc_feature    424400..424459
FT                   /note="PS01275 Elongation factor P signature."
FT                   /inference="protein motif:Prosite:PS01275"
FT   CDS             424699..424830
FT                   /transl_table=11
FT                   /gene="ecnB"
FT                   /locus_tag="YE0358"
FT                   /product="entericidin B precursor"
FT                   /note="Similar to Citrobacter freundii entericidin B
FT                   precursor EcnB SWALL:ECNB_CITFR (SWALL:P56550) (48 aa)
FT                   fasta scores: E(): 1.2e-07, 64.1 38d in 39 aa and to
FT                   Escherichia coli, and Escherichia coli O157:H7 entericidin
FT                   B precursor EcnB or b4147.2 or z5754 or ecs5128.2
FT                   SWALL:ECNB_ECOLI (SWALL:P56549) (48 aa) fasta scores: E():
FT                   3.3e-07, 55.81 38d in 43 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0358"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10488"
FT                   /db_xref="GOA:A1JIP7"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP7"
FT                   /inference="similar to sequence:UniProtKB:P56550"
FT                   /inference="similar to sequence:UniProtKB:P56549"
FT                   /protein_id="CAL10488.1"
FT                   /translation="MLKKSIAIIFSLIVISSLSACNTTKGVGKDVQSAGSAIERSAE"
FT   sig_peptide     424699..424758
FT                   /gene="ecnB"
FT                   /locus_tag="YE0358"
FT                   /note="Signal peptide predicted for YE0358 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.932 between residues 20 and 21"
FT   misc_feature    424729..424761
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             425009..425323
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="YE0359"
FT                   /product="putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:YE0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10489"
FT                   /db_xref="GOA:A1JIP8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP8"
FT                   /protein_id="CAL10489.1"
FT                   /translation="MAWIILVIAGLLEVIWAIGLKYSHGFTRLTPSIVTLVAMAASVFL
FT                   LAYAMKTLPAGTAYAVWTGIGAVGTAILGIVLLGESASLARVFSLGLILAGIIGLKLAS
FT                   "
FT   misc_feature    425009..425287
FT                   /note="Pfam match to entry PF00893 DUF7, Integral membrane
FT                   protein DUF7, score 173.4, E-value 2.5e-49"
FT                   /inference="protein motif:PFAM:PF00893"
FT   misc_feature    join(425012..425065,425093..425152,425171..425239,
FT                   425252..425308)
FT                   /note="4 probable transmembrane helices predicted for
FT                   YE0359 by TMHMM2.0 at aa 2-19, 29-48, 55-77 and 82-100"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(425325..425864)
FT                   /transl_table=11
FT                   /locus_tag="YE0360"
FT                   /product="lipoprotein"
FT                   /note="Similar to many lipoproteins including: Escherichia
FT                   coli, and Escherichia coli O157:H7 outer membrane
FT                   lipoprotein Blc precursor or b4149 or z5756 or ecs5130
FT                   SWALL:BLC_ECOLI (SWALL:P39281) (177 aa) fasta scores: E():
FT                   6.4e-44, 61.49 38d in 174 aa and to Salmonella typhi
FT                   putative lipoprotein Blc or sty4699 SWALL:Q8Z199
FT                   (EMBL:AL627283) (177 aa) fasta scores: E(): 5.8e-46,63.79
FT                   38d in 174 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0360"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10490"
FT                   /db_xref="GOA:A1JIP9"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR011038"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIP9"
FT                   /inference="similar to sequence:INSDC:AL627283"
FT                   /inference="similar to sequence:UniProtKB:P39281"
FT                   /protein_id="CAL10490.1"
FT                   /translation="MRLWSKLSVITATLLSVACGVTPPKDVKIVDNFQLPRYLGTWYEI
FT                   ARLNHSFERGLDYVTANYSPRDDGGVKVINRGYNTKKQQWQESIGKAYFIGSPQQAALK
FT                   VSFFGPFYGGYNVIDLDDEYQHALIAGPNREYLWILSRTPTIDNQTRDRLVSVAKHYGF
FT                   PVEELIWVKQGELPPL"
FT   misc_feature    complement(425808..425840)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   sig_peptide     complement(425811..425864)
FT                   /locus_tag="YE0360"
FT                   /note="Signal peptide predicted for YE0360 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.984) with cleavage site
FT                   probability 0.746 between residues 18 and 19"
FT   CDS             complement(426013..426369)
FT                   /transl_table=11
FT                   /gene="frdD"
FT                   /gene_synonym="b4151"
FT                   /locus_tag="YE0361"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10491"
FT                   /db_xref="GOA:A1JIQ0"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIQ0"
FT                   /protein_id="CAL10491.1"
FT                   /translation="MNQVPKRSDEPIFWGLFGAGGMWSAIIAPAVILLVAILLPLGAFP
FT                   GEALSYERVLAFCQSFIGRVFLLLMIILPLWCGLHRIHHAMHDLNIHVPAGKWVFYGLA
FT                   AILSVVAIIGVLTL"
FT   misc_feature    complement(join(426019..426078,426139..426207,
FT                   426265..426333))
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0361 by TMHMM2.0 at aa 13-35, 55-77 and 98-117"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(426019..426369)
FT                   /note="Pfam match to entry PF02313 Fumarate_red_D,Fumarate
FT                   reductase subunit D, score 279.8, E-value 2.3e-81"
FT                   /inference="protein motif:PFAM:PF02313"
FT   CDS             complement(426386..426778)
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /gene_synonym="b4152"
FT                   /locus_tag="YE0362"
FT                   /product="fumarate reductase hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10492"
FT                   /db_xref="GOA:A1JIQ1"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIQ1"
FT                   /protein_id="CAL10492.1"
FT                   /translation="MTTKRKAYVRTMAPNWWQQLGFYRFYMLREGTSVPTVWFSILLIY
FT                   GVFALKSGPAGWEGFVGFLQNPLVLLINIITLLAAVLHTKTWFELAPKAANIIVKDEKM
FT                   GPEPVIKALWVVTIVATAIILAVALL"
FT   misc_feature    complement(426389..426775)
FT                   /note="Pfam match to entry PF02300 Fumarate_red_C,Fumarate
FT                   reductase subunit C, score 286.8, E-value 1.8e-83"
FT                   /inference="protein motif:PFAM:PF02300"
FT   misc_feature    complement(join(426392..426445,426533..426601,
FT                   426629..426688))
FT                   /note="3 probable transmembrane helices predicted for
FT                   YE0362 by TMHMM2.0 at aa 31-50, 60-82 and 112-129"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(426795..427529)
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /gene_synonym="b4153"
FT                   /locus_tag="YE0363"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10493"
FT                   /db_xref="GOA:A1JIQ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIQ2"
FT                   /protein_id="CAL10493.1"
FT                   /translation="MTDMKLLKMEVMRYNPERDSEPHFETFEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLREYTGGMKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNDRKPKDGPNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGKNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   misc_feature    complement(427035..427106)
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 16.6, E-value 0.00044"
FT                   /inference="protein motif:PFAM:PF00037"
FT   misc_feature    complement(427050..427085)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00198"
FT   misc_feature    complement(427278..427472)
FT                   /note="Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur
FT                   cluster binding domain, score 15.7, E-value 0.00081"
FT                   /inference="protein motif:PFAM:PF00111"
FT   misc_feature    complement(427332..427358)
FT                   /note="PS00197 2Fe-2S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00197"
FT   CDS             complement(427522..429345)
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /gene_synonym="b4154"
FT                   /locus_tag="YE0364"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YE0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10494"
FT                   /db_xref="GOA:A1JIQ3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIQ3"
FT                   /protein_id="CAL10494.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDTFDYHFHDTVAGGDWLCEQDVVDHFVHSCPEEMAQLEIWGCPW
FT                   SRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGQARGVVAMNMMEGTRVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAFHHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTIATPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNQQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAGEQAALRAMESTPANGSALDAQARDVETRLSNLMKQEGTENWSKIRDEMGL
FT                   SMEEGCGIYRTPELMQKTVDKLAELKERFKRVKITDNSSVFNTDLLYTIELGYGLDVAE
FT                   CMAHSALNRRESRGAHQRLDEGCTERDDVNFLKHTLAFHTPGGAPRLEYSDVKITKLAP
FT                   AKRVYGGEATAQDAKDAKDAKDLKDKEQAND"
FT   misc_feature    complement(427603..427989)
FT                   /note="Pfam match to entry PF02910 succ_DH_flav_C,Fumarate
FT                   reductase/succinate dehydrogenase flavoprotein C-terminal
FT                   domain, score 236.7, E-value 2.1e-68"
FT                   /inference="protein motif:PFAM:PF02910"
FT   misc_feature    complement(428047..429030)
FT                   /note="Pfam match to entry PF00890 FAD_binding_2, FAD
FT                   binding domain, score 675.6, E-value 1.7e-200"
FT                   /inference="protein motif:PFAM:PF00890"
FT   misc_feature    complement(429190..429219)
FT                   /note="PS00504 Fumarate reductase / succinate dehydrogenase
FT                   FAD-binding site."
FT                   /inference="protein motif:Prosite:PS00504"
FT   sig_peptide     complement(429271..429345)
FT                   /gene="frdA"
FT                   /gene_synonym="b4154"
FT                   /locus_tag="YE0364"
FT                   /note="Signal peptide predicted for YE0364 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.936) with cleavage site
FT                   probability 0.506 between residues 25 and 26"
FT   CDS             429789..430766
FT                   /transl_table=11
FT                   /gene="poxA"
FT                   /gene_synonym="genX"
FT                   /gene_synonym="b4155"
FT                   /locus_tag="YE0365"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10495"
FT                   /db_xref="GOA:A1JIQ4"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIQ4"
FT                   /protein_id="CAL10495.1"
FT                   /translation="MSETASWQPSAPIANLLKRAAIMAEIRRFFADRGVLEVETPTMSQ
FT                   ATVTDIHLVPFQTRFVGPGAADGLTLYMMTSPEYHMKRLLAAGSGSIYQLGRSFRNEEA
FT                   GRHHNPEFTMLEWYRPHYDMYRLMDEVEDLLQQILDCDSSERLSYQQAFLRHLDIDPLS
FT                   ADKAQLREAAAKLDLSNIADTEEDRDTLLQLLFTVGVEPHIGRDKPAFVYHFPASQASL
FT                   AVISTEDHRVAERFEVYFKGIELANGFHELTDGDEQLKRFEQDNRSREKRGLPQHPIDM
FT                   NLIDALKHGLPDCSGVALGVDRLVMLALGAEKLSDVIAFPVGRA"
FT   misc_feature    429789..430763
FT                   /note="Pfam match to entry PF00152 tRNA-synt_2, tRNA
FT                   synthetases class II (D, K and N), score 449.3, E-value
FT                   2.2e-132"
FT                   /inference="protein motif:PFAM:PF00152"
FT   misc_feature    430083..430136
FT                   /note="PS00179 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00179"
FT   misc_feature    430680..430709
FT                   /note="PS00339 Aminoacyl-transfer RNA synthetases class-II
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00339"
FT   CDS             complement(430861..434091)
FT                   /transl_table=11
FT                   /locus_tag="YE0366"
FT                   /product="putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10496"
FT                   /db_xref="GOA:A1JIQ5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIQ5"
FT                   /protein_id="CAL10496.1"
FT                   /translation="MKQAEANKGMANQAEIVQALQGALSWLADAKESDIRSQQYQKAID
FT                   DFPKLTRELRQQLAQEGDKPLPVPNNMSTSELEQQVLQISSQLLELSRLSQQEQDRARE
FT                   ISESLNQLPQQQSEARRILTEISSRLQAQNGPTTPATQAQLALLQAEAVARKAKVNELE
FT                   LSQLSANNRQELSRLRAELYKKRQERVDTQLQALRNTLNNQRQQAAEQALERTELLAEQ
FT                   GGDLPASITQQLQINRELSQALNQQAQRIDLISSQQRQAVSQTQQVRQALSTIREQAQW
FT                   LGVSTALGEALRAQVSRLPDVPKSQQLDRDMAQLRVQRLQYEDMLEKLQQQNVKLTQDD
FT                   GTPLTTEQQRILDAQWRTQRELLNSLLSGYDTQILELTKLKVANSQLVDALSEVREATH
FT                   RYLFWVADVSPISLSYPVNVAHDLTRLLSLDTLAQLSGAFVMMMTNQETLLPIIGALLF
FT                   VGFSISSRRHYHAFLERASSRVGKVTQDHFSLTLRTVFWSILMALPLPVLWAAVGYGLQ
FT                   NAWSYPMAIAIGNAVTATVPVLWVFMISASFAHPHGLFITHFRWSPTQVGRAMRFYRMS
FT                   VWLIIPLMMALITFENYNDREFAGTLGRLCFILLCIALSLVTNSLKRAGIPLYLDKKGS
FT                   GENIVNVALWGLLLSAPLIAALASALGYLTTSQALLARLETSVAIWFFLLVVYHIIRRW
FT                   MLIQRRRIAFDRAKQRRADILAQRARGEDDTPHNNSTEGSIDVEEPVIDLDVISAQSLR
FT                   LVRSILTMIALVSVIVLWSEIHSAFGFLENIRLWDVSSTINGIESVQAITMGSLLIAIL
FT                   VMIVTTQLVRNLPALLELALLQHLDLTPGTGYAISTITKYLLILFGSLLGFSMLGIEWA
FT                   KFQWLVAALGLGLGFGLQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTKINTRAT
FT                   TISDWDRKEIIVPNKAFITEQFINWSLSDSITRVVLTVPAPAETSSEEVTEVLLTAARR
FT                   CTLVLDNPPPEVYLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGYREHGITLP
FT                   FPPFQARLETLGRGRVVSSNRSRTPGSL"
FT   misc_feature    complement(430948..431553)
FT                   /note="Pfam match to entry PF00924
FT                   MS_channel,Mechanosensitive ion channel, score 259.4,
FT                   E-value 3.3e-75"
FT                   /inference="protein motif:PFAM:PF00924"
FT   misc_feature    complement(431230..431334)
FT                   /note="PS01246 Uncharacterized protein family UPF0003
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01246"
FT   misc_feature    complement(join(431383..431451,431479..431538,
FT                   431629..431697,431755..431823,432019..432087,
FT                   432100..432168,432229..432297,432325..432384,
FT                   432445..432513,432541..432609,432697..432750))
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0366 by TMHMM2.0 at aa 448-465, 495-517, 527-549,570-589,
FT                   599-621, 642-664, 669-691, 757-779, 799-821,852-871 and
FT                   881-903"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             complement(434261..435142)
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="YE0367"
FT                   /product="phosphatidylserine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:YE0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10497"
FT                   /db_xref="GOA:A1JIQ6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIQ6"
FT                   /protein_id="CAL10497.1"
FT                   /translation="MLDSIKIRLQYLLPKQGLTRLAGWGADKQAGWLTQLVIKAFARYY
FT                   KVNMQEAQDPEFSAYRTFNEFFVRPLRAGARPVVAEENLLAQPADGAISQLGTIHDGQI
FT                   LQAKGHDYSVEALLAGNYMLAAEFQNGQFVTTYLAPRDYHRVHMPCDGVLREMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICIFDTTFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIRRWTYPQAGAEGAITLEKGQEMGRFKLGSTVINLFAEGKVYLAPQLNSGSVTRMGE
FT                   VLAEAVPVTPPC"
FT   misc_feature    complement(434288..434956)
FT                   /note="Pfam match to entry PF02666
FT                   PS_Dcarbxylase,Phosphatidylserine decarboxylase, score
FT                   343.4, E-value 1.6e-100"
FT                   /inference="protein motif:PFAM:PF02666"
FT   CDS             complement(435251..436303)
FT                   /transl_table=11
FT                   /locus_tag="YE0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10498"
FT                   /db_xref="GOA:A1JIQ7"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIQ7"
FT                   /protein_id="CAL10498.1"
FT                   /translation="MSKNKLSKGQQRRVQANHQRRLRTDRKPELDDSQLGDAQEGIVIS
FT                   RFGQHADVEAADGVQHRCNIRRTIKSLVTGDRVVWRPGLQAQEGVRVKGIVEAVHERTS
FT                   VLTRPDLYDGVKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLDVEPLIVLNKIDL
FT                   LDADGRKFVDGMMDIYRRIGYNVLEVSSQTREGMEAFEQALAGRISIFAGQSGVGKSSL
FT                   LNALLPPTDNEILVNTVSDNSGLGQHTTTAARLYHFQHGGDVIDSPGVREFGLWHLAPE
FT                   QITQGFVEFRDYLGHCKFRDCSHTNDPGCALREAVEQGKIAEERFDNYHRILESMEQAK
FT                   PRKTSDSDEK"
FT   misc_feature    complement(435302..435769)
FT                   /note="Pfam match to entry PF03193 DUF258, Protein of
FT                   unknown function, DUF258, score 285.2, E-value 5.3e-83"
FT                   /inference="protein motif:PFAM:PF03193"
FT   misc_feature    complement(435644..435667)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             436481..437026
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /gene_synonym="b4162"
FT                   /locus_tag="YE0369"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10499"
FT                   /db_xref="GOA:A1JIQ8"
FT                   /db_xref="InterPro:IPR006055"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIQ8"
FT                   /protein_id="CAL10499.1"
FT                   /translation="MAENQNNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPV
FT                   LAVHQSDEQLGLMDEWNVRTHTGSGLVERVKASPFNDHDAELQTIEFLKQWVPAGTSPI
FT                   CGNSVGQDRRFLFRYMPELEAYFHYRYLDVSTLKELARRWKPEILAGFKKQNTHQALDD
FT                   IRESVAELAYYREHFIQK"
FT   misc_feature    436502..437017
FT                   /note="Pfam match to entry PF00929 Exonuclease,Exonuclease,
FT                   score 130.2, E-value 2.5e-36"
FT                   /inference="protein motif:PFAM:PF00929"
FT   tRNA            437336..437411
FT                   /gene="tRNA-Gly (GCC)"
FT                   /product="transfer RNA-Gly (GCC)"
FT   tRNA            437503..437578
FT                   /gene="tRNA-Gly (GCC)"
FT                   /product="transfer RNA-Gly (GCC)"
FT   tRNA            437653..437728
FT                   /gene="tRNA-Gly (GCC)"
FT                   /product="transfer RNA-Gly (GCC)"
FT   CDS             complement(438071..439225)
FT                   /transl_table=11
FT                   /locus_tag="YE0371"
FT                   /product="putative iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10500"
FT                   /db_xref="GOA:A1JIQ9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIQ9"
FT                   /protein_id="CAL10500.1"
FT                   /translation="MAHPLDLNQLAQHIKQWGQSLGFQQVGICDTDLSAEEPRLQAWLD
FT                   KQYHGEMAWMARHGMLRARAHELLPGTLRVISVRMNYLPAKAAFASTLKHSELGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDMIQSYCLEQTGDDINFRPFVDSAPIMERSLAAKAGIGWVG
FT                   KHSLILNRDAGSWFFLGELLIDLPLPVDKPQEEQCGRCVACITTCPTGAIVAPYTVDAR
FT                   RCISYLTIELEGAIPEEFRPLMGNRIYGCDDCQLICPWNRFSQLTDEEDFSPRAVLHTP
FT                   QLLDLFAWNEEKFLRVTEGSAIRRIGHLRWLRNISVALGNAPYLDNIVLALEARRGIDP
FT                   MLDEHIEWAISQQLKRRSTLIGDVQSPQKKRLVRAIEKGLPRDA"
FT   misc_feature    complement(438584..438655)
FT                   /note="Pfam match to entry PF00037 fer4, 4Fe-4S binding
FT                   domain, score 15.8, E-value 0.00059"
FT                   /inference="protein motif:PFAM:PF00037"
FT   misc_feature    complement(438599..438634)
FT                   /note="PS00198 4Fe-4S ferredoxins, iron-sulfur binding
FT                   region signature."
FT                   /inference="protein motif:Prosite:PS00198"
FT   CDS             439224..440738
FT                   /transl_table=11
FT                   /locus_tag="YE0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10501"
FT                   /db_xref="GOA:A1JIR0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR0"
FT                   /protein_id="CAL10501.1"
FT                   /translation="MTDHSKKQIGASLPHSVFSADWVRQNEAIAAAHFSLTLFDLMVRA
FT                   GNAAFELARKQYPAARHWLILCGHGNNGGDGYIVASRALAAGLNVTLIACPGNRPLPVE
FT                   AHQAQSQWLAAGGVINQPDIPWPQHIDLIIDGLLGIGLRAAPQGVYATLIDTANRHRAA
FT                   KIALDIPSGLSADSGAAPGSVIRADHTLTFVTLKPGLLTGQARDWVGHLHCNDLGLTPW
FT                   LSAQPLQIERMTADHLPQWLKPRRPCAHKGEHGRLLLVGGDKGFGGAIRMAGEAALRSG
FT                   AGLVRVLTHIEHVAPILAARPELMVQELTDETLVQGMSWADVLVVGPGLGQSDWGRNAL
FT                   NLLQQSDKPALWDADALNLLALNPLKRQNRVLTPHPGEAARLLGCRVADIESDRLLSAR
FT                   NIVKQYGGVVVLKGAGTLIASEQGEMAIADVGNAGMASGGMGDILSGIIGSLIAQKLVL
FT                   YDAACAGCVVHGVAADTLAEVQGTRGLLATDLLSVIPKYVNPELAK"
FT   misc_feature    439323..439820
FT                   /note="Pfam match to entry PF03853 YjeF_N, YjeF-related
FT                   protein N-terminus, score 199.2, E-value 4.3e-57"
FT                   /inference="protein motif:PFAM:PF03853"
FT   misc_feature    439476..439508
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    439992..440711
FT                   /note="Pfam match to entry PF01256 UPF0031,Uncharacterized
FT                   protein family UPF0031, score 311.7,E-value 5.8e-91"
FT                   /inference="protein motif:PFAM:PF01256"
FT   CDS             440749..441219
FT                   /transl_table=11
FT                   /locus_tag="YE0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10502"
FT                   /db_xref="GOA:A1JIR1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR1"
FT                   /protein_id="CAL10502.1"
FT                   /translation="MKELVLPLPDEAATVALGGALAHAFEGASVIYLFGDLGAGKTTFS
FT                   RGFLQALGHSGHVKSPTYTLVEPYALTPRPVYHFDLYRLADPEELEFMGIRDYFDKQAI
FT                   CLVEWPQLGAGFLPQADVELHLAYQAAGREARLVAISDVGADVLRRLAAVQG"
FT   misc_feature    440788..441156
FT                   /note="Pfam match to entry PF02367 UPF0079,Uncharacterised
FT                   P-loop hydrolase UPF0079, score 197.6,E-value 1.3e-56"
FT                   /inference="protein motif:PFAM:PF02367"
FT   misc_feature    440851..440874
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             441320..443182
FT                   /transl_table=11
FT                   /locus_tag="YE0374"
FT                   /product="putative N-acetylmuramoyl-L-alanine
FT                   amidase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10503"
FT                   /db_xref="GOA:A1JIR2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR2"
FT                   /protein_id="CAL10503.1"
FT                   /translation="MVIVGLFTLTSAFAAKLTDIKVNNGPTESRVTLSFDGQPVYAFFS
FT                   LNSPERVVLDVRQSGNLSGLPLEFSGQNLLKRIRSSTPKDAQSTRLVLELTQKVKTRAV
FT                   TQQSGNNYTVVMTMSAAASAPVRQTQPTLSQNQNNVSQNNVPLNQTNTPSPNAGRLTSQ
FT                   ASSTNTASRVTSVNTNSVAKNPFNNKPTVVVSSESVTTNTSRPIKTSSAANSSRVVVAI
FT                   DAGHGGQDPGAIGQNGLKEKNVTIAIARRLEALLNSDPMFKPVLTRNGDYFISVMGRSD
FT                   VARKQGANVLVSVHADAAPNRSATGASVWVLSNRRANSEMGNWLEQHEKQSELLGGAGD
FT                   VLANTASDPYLSQAVLDLQFGHSQRVGYDVATKVLNELQRVGDIHKRRPEHASLGVLRS
FT                   PDIPSLLVETGFISNSTEERLLGSSAYQEKIAQAIYKGLRSYFLAHPLQADPKVENRPL
FT                   IETAAVDSSSQRSGVNQPDPIVSNAQSGRVSTTKPAAAGAVTKNRSQIHKVQRGETLSG
FT                   IASQYGVSMAVLRQNDTLKNDVVWVGQRLKVPASGATVAAAAPKAVAKAKPSKSQPLKH
FT                   QVKRGDTLSAIAARYGVSMSEIERANKIKSGNVQLGQTLTIPQS"
FT   misc_feature    442157..442648
FT                   /note="Pfam match to entry PF01520
FT                   Amidase_3,N-acetylmuramoyl-L-alanine amidase, score 256.6,
FT                   E-value 2.2e-74"
FT                   /inference="protein motif:PFAM:PF01520"
FT   misc_feature    442838..442966
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,score
FT                   54.6, E-value 1.5e-13"
FT                   /inference="protein motif:PFAM:PF01476"
FT   misc_feature    443045..443173
FT                   /note="Pfam match to entry PF01476 LysM, LysM domain ,score
FT                   71.0, E-value 1.6e-18"
FT                   /inference="protein motif:PFAM:PF01476"
FT   misc_feature    443063..443128
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1170.000, SD 3.17 at aa 582-603, sequence
FT                   DTLSAIAARYGVSMSEIERANK"
FT   CDS             443198..445105
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /gene_synonym="b4170"
FT                   /locus_tag="YE0375"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10504"
FT                   /db_xref="GOA:A1JIR3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011186"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIR3"
FT                   /protein_id="CAL10504.1"
FT                   /translation="MPIQILPPQLANQIAAGEVVERPASVVKELVENSLDAGASRIDID
FT                   IERGGAKLIRIRDNGCGIGKDDLALALARHATSKISSLEDLEAILSMGFRGEALASISS
FT                   VSRLILTSRTAEQNEAWQAYAEGRDMAVTIKPAAHPVGSTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEVVRRIALARFDVAINLSHNGKLMRQYRAAPDPSQHERRLASICGPAFLQ
FT                   HALAISWQHGDLTIRGWVADPAASRTLSEMQYCYVNNRMMRDRLINHAIRQAYQDLLKD
FT                   DQQPAYVLYLDIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVTTVLQQTATPLLNIN
FT                   EDGEEIEAPRWQPENRVAAGANKYAQPEPANTVPVVRTSSPERTATTERSIARERTPTY
FT                   HAGEPYQKQQGELYRQLVQPAAVNKPAAVSQPSAASAPVARQISTDEPLHGDNYSFGRV
FT                   LTVFPPCYALIEYKQGIALLELTVAERWLKQAQLNPPAEGLRPQPLLIPLKLTLDKNEA
FT                   TACQRHQKLLATMGIELAVEHTRATLRAVSLPLRQQNLQKLIPELLGYLSQHEEISPDA
FT                   LATWISRHLGSEHEVWNVSQAIQLLTDVERLCPQLVKSPPAGLLQPIDIKAALATLTHE
FT                   "
FT   misc_feature    443249..443542
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 38.8,
FT                   E-value 8.2e-09"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    443474..443494
FT                   /note="PS00058 DNA mismatch repair proteins mutL / hexB /
FT                   PMS1 signature."
FT                   /inference="protein motif:Prosite:PS00058"
FT   misc_feature    443846..444187
FT                   /note="Pfam match to entry PF01119 DNA_mis_repair, DNA
FT                   mismatch repair protein, C-terminal domain, score
FT                   149.4,E-value 4e-42"
FT                   /inference="protein motif:PFAM:PF01119"
FT   CDS             445098..446039
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /gene_synonym="trpX"
FT                   /gene_synonym="b4171"
FT                   /locus_tag="YE0376"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10505"
FT                   /db_xref="GOA:A1JIR4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIR4"
FT                   /protein_id="CAL10505.1"
FT                   /translation="MNDIENLDQPPAIFIMGPTASGKTALSIALRQRLPVELVSVDSAL
FT                   IYRGMDIGTAKPSAEEQALAPHRLIDIRDPAESYSAADFRKDALKEMADITAAGRIPLL
FT                   VGGTMLYFKALLDGLSPLPSADPQVRQRIEQQAAELGWEALHQQLAEIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYQVHQFAIAPVSRELLHQRIELRFHQML
FT                   DAGFETEARALFDRGDLHTDMPAIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLAKR
FT                   QMTWLRGWGSVQWLDSDKPGEALDSVIQVVSA"
FT   misc_feature    445146..445169
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    445227..445991
FT                   /note="Pfam match to entry PF01715 IPPT, IPP transferase
FT                   ,score 529.6, E-value 1.4e-156"
FT                   /inference="protein motif:PFAM:PF01715"
FT   CDS             446155..446460
FT                   /transl_table=11
FT                   /gene="ymr"
FT                   /locus_tag="YE0377"
FT                   /product="yersinia multiple regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YE0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10506"
FT                   /db_xref="GOA:A1JIR5"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIR5"
FT                   /protein_id="CAL10506.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNPSGSTNNYHGSNPSAPQQPQQDSDDAE"
FT   misc_feature    446167..446346
FT                   /note="Pfam match to entry PF03329 Hfq, Host factor Hfq
FT                   ,score 153.0, E-value 3.5e-43"
FT                   /inference="protein motif:PFAM:PF03329"
FT   CDS             446559..447860
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="YE0378"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10507"
FT                   /db_xref="GOA:A1JIR6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR6"
FT                   /protein_id="CAL10507.1"
FT                   /translation="MFDRYEGGEQAVLVHIYFSQDKNSEDLREFEALVSSAGVEALQIV
FT                   TGSRKAPHPKFFVGEGKAVEIADAVKASGASVVLFDHALSAAQERNLERLCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHIATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRDRISLILSRLERVAKQREQGRRARTRADIPTVSLVGYTNAGKSSLFNKITAADV
FT                   YAADQLFATLDPTLRRINVADVGDTVLADTVGFIRHLPHDLVAAFKATLQETRQASLLL
FT                   HIIDAADPRVAENMAAVDSVLAEIEADEIPTLLVMNKIDLLDDFVPRIDRNEENLPVRV
FT                   WLSAQTGAGIPLLFQALTERLSGEIAHFELRLPPQAGRLRSRFYQLQAIEKEWIDEDGN
FT                   VGMVVRMPIVDWRRLCKQEQELVSYIISEPSSVN"
FT   misc_feature    447168..447191
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             448234..449241
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /gene_synonym="hflA"
FT                   /locus_tag="YE0379"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10508"
FT                   /db_xref="GOA:A1JIR7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR7"
FT                   /protein_id="CAL10508.1"
FT                   /translation="MVIWAASGFYTIKEAERGVVTRLGKLSHIVQPGLNWKPTFIDEVT
FT                   PVNVESVRELAASGVMLTSDENVVRIEMNVQYRVTDPAAYLFSVTNPDDSLRQATDSAV
FT                   RGVIGKYTMDKILTEGRTIVRSDTQRVLEETIRPYNMGITLLDVNFQAARPPEEVKAAF
FT                   DDAIAARENEQQYIREAEAYTNEVQPRANGQAQRLLEDARAYAARKVLEAQGEVAGFAK
FT                   LLPEYKAAPEITRERLYIETMEKVLGHTRKVLANDKGNSLMVLPLDQLMRGQGADKADG
FT                   SKDTSLIRLNPPSSANSSQESGASNTGTSSNSGSIMDQRRANAQRDTSTRVGRE"
FT   misc_feature    448255..448779
FT                   /note="Pfam match to entry PF01145 Band_7, SPFH domain /
FT                   Band 7 family, score 181.4, E-value 9.4e-52"
FT                   /inference="protein motif:PFAM:PF01145"
FT   CDS             449245..450249
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /gene_synonym="hflA"
FT                   /locus_tag="YE0380"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10509"
FT                   /db_xref="GOA:A1JIR8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR8"
FT                   /protein_id="CAL10509.1"
FT                   /translation="MRKSFLLIVVVVLVALYASLFVVQEGQRGIVLRFGKVLRDSDNKP
FT                   LVYAPGLHFKIPFIETVKTLDARIQTMDNQADRFVTNEKKDLIVDSYLKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLNVRDIVTDSRGRLTSDVRDALNTGSVGDE
FT                   AVTTEADDAIASAAARVEQETRGKQPAVNPNSMAALGIEVVDVRIKQINLPAEVSDAIF
FT                   QRMRAEREAVARRHRSQGQEEAEKLRATADYEVTRTLAEAERQARITRGGGDAEAARLF
FT                   ADAFSKDPDFYAFIRSLRAYENSFSSGNDVMVLSPDSDFFRYMKSPDNSSKRP"
FT   sig_peptide     449245..449313
FT                   /gene="hflC"
FT                   /gene_synonym="hflA"
FT                   /locus_tag="YE0380"
FT                   /note="Signal peptide predicted for YE0380 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.997) with cleavage site
FT                   probability 0.465 between residues 23 and 24"
FT   misc_feature    449257..449316
FT                   /note="1 probable transmembrane helix predicted for YE0380
FT                   by TMHMM2.0 at aa 5-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    449299..449970
FT                   /note="Pfam match to entry PF01145 Band_7, SPFH domain /
FT                   Band 7 family, score 202.0, E-value 5.9e-58"
FT                   /inference="protein motif:PFAM:PF01145"
FT   CDS             450388..450588
FT                   /transl_table=11
FT                   /locus_tag="YE0381"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10510"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIR9"
FT                   /protein_id="CAL10510.1"
FT                   /translation="MNSTILLALGLVLVLEGLGPMLYPKAWRKMILAMAQLPDATLRRF
FT                   GGGLVVAGVVIYYMLRSRMGG"
FT   misc_feature    join(450400..450468,450511..450567)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0381 by TMHMM2.0 at aa 5-27 and 42-60"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             450688..451986
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /gene_synonym="adeK"
FT                   /locus_tag="YE0382"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10511"
FT                   /db_xref="GOA:A1JIS0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIS0"
FT                   /protein_id="CAL10511.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVTSIIGNGVVLAPDALMKEMTDLEARGVPVRERLLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFNKETFAIKLK
FT                   EIVDYHNFQLVHYYKEEAVDYQKVLDEVLAIADILTAMVVDVSELLDSARKRGDFMMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLK
FT                   EVKLCVGYRMPDGREVDTTPLAAEGWEGIEPIYETMPGWSEVTFGVKEHSKLPQAALNY
FT                   IKRVEELTGVPVDIISTGPDREETMILRDPFDA"
FT   misc_feature    450694..451962
FT                   /note="Pfam match to entry PF00709
FT                   Adenylsucc_synt,Adenylosuccinate synthetase, score 1038.5,
FT                   E-value 0"
FT                   /inference="protein motif:PFAM:PF00709"
FT   misc_feature    450718..450741
FT                   /note="PS01266 Adenylosuccinate synthetase GTP-binding
FT                   site."
FT                   /inference="protein motif:Prosite:PS01266"
FT   misc_feature    451084..451119
FT                   /note="PS00513 Adenylosuccinate synthetase active site."
FT                   /inference="protein motif:Prosite:PS00513"
FT   CDS             452266..452691
FT                   /transl_table=11
FT                   /locus_tag="YE0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10512"
FT                   /db_xref="GOA:A1JIS1"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIS1"
FT                   /protein_id="CAL10512.1"
FT                   /translation="MQLTSFTDYGLRALTYMASLPEGQMTSISQVTEVYGVSRNHMVKI
FT                   INQLSRVGLVTAVRGKNGGIRLGKPADQIRIGDVVRQLEPLSLVNCSSDFCHITPACRL
FT                   KQVLNQAVQSFLNELDNYTLADMVQDNTPLYKLLFVE"
FT   misc_feature    452266..452622
FT                   /note="Pfam match to entry PF02082 UPF0074,Uncharacterized
FT                   protein family UPF0074, score 201.5,E-value 8.6e-58"
FT                   /inference="protein motif:PFAM:PF02082"
FT   misc_feature    452341..452406
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1116.000, SD 2.99 at aa 26-47, sequence
FT                   TSISQVTEVYGVSRNHMVKIIN"
FT   misc_feature    452410..452466
FT                   /note="PS01332 Uncharacterized protein family UPF0074
FT                   signature."
FT                   /inference="protein motif:Prosite:PS01332"
FT   CDS             452871..455417
FT                   /transl_table=11
FT                   /gene="rnr"
FT                   /gene_synonym="vacB"
FT                   /locus_tag="YE0384"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:YE0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10513"
FT                   /db_xref="GOA:A1JIS2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS2"
FT                   /protein_id="CAL10513.1"
FT                   /translation="MSQDPFLEREAEKYESPIPSREFILAHLAKRETPASREELANELN
FT                   LSGEEQLEALRRRLRAMERDGQLVFTRRQCYALPERLDLLRGTVIGHRDGFGFLRVEGS
FT                   KDDLYLSAEQMKTAIHGDVVLAQPVGADRKGRREARIVRVLVPKTSQIVGRYFTDAGTG
FT                   FVVPDDGRLSFDILIPPDAINGARMGYMVVVELTQRPTRRTKAVGKIVEVLGENMGTSM
FT                   AVDIALRTHEIPHTWPPQVEKQVADLKEQVPEEAKKGRVDLRSLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPRTALDDEARSRGNSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISAQGKLSSYKFYEAVMSSHARLTYTKVWRIIDGEESLREQ
FT                   YKPLVPHLLELHTMYKALDQARAERGGIAFETEEAKFIFNAERRIERIESTVRNDAHKL
FT                   IEECMILANIAAARFVEKHNEPALFRVHDRPSDDHISALRSVLSELGLTLGGGLKPEPK
FT                   DYAVLMDEVADRPDHEMLQTMLLRSMKQAIYDPENRGHFGLALASYGHFTSPIRRYPDL
FT                   AMHRAIKYQLAKEHGNVKERWTPTGGWHSEYEDMLQLGEHCSMTERRADEATRNVADWL
FT                   KCDFMQDQVGKVFTGIIASVTGFGFFVRLDDLFIDGLVHVSSLDNDYYRYDNIGQRLIG
FT                   ESSGQVYRLGDTVEIRVEAVHMDERKIDFALVSSTRKPRGEGKTARDKAKKADGQRTMR
FT                   DTSTGRGGRGSSSSSSRRDSAPAGSGQKRPRRAKKPANFEPDSAFRPADAAAKVDDKAL
FT                   AEKKAKAKAKRASAKTKKIAAATKAKRAKKKTSSDQ"
FT   misc_feature    453414..454520
FT                   /note="Pfam match to entry PF00773 RNB, RNB-like protein
FT                   ,score 474.4, E-value 6.2e-140"
FT                   /inference="protein motif:PFAM:PF00773"
FT   misc_feature    454791..455048
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 68.4, E-value 9.5e-18"
FT                   /inference="protein motif:PFAM:PF00575"
FT   CDS             455489..456229
FT                   /transl_table=11
FT                   /locus_tag="YE0385"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10514"
FT                   /db_xref="GOA:A1JIS3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS3"
FT                   /protein_id="CAL10514.1"
FT                   /translation="MSEIIYGIHSVKALLDNDPQRFLEVFILKGRDDRRLQPLIAELEA
FT                   AGLVIQVASRQWLDSQVEGGVHQGIVARVREGRQYQENDLPALLESVETPFLLVLDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPRDRSAQLNAIAKKVASGAAENVPLIKVTNLARTLRV
FT                   LQEHNVWIVGTAGEADHTLYQSKMTGPMALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGVCLFEAVRQRALKA"
FT   misc_feature    455771..456196
FT                   /note="Pfam match to entry PF00588 SpoU_methylase, SpoU
FT                   rRNA Methylase family, score 215.8, E-value 4.3e-62"
FT                   /inference="protein motif:PFAM:PF00588"
FT   CDS             456561..458204
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="YE0386"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10515"
FT                   /db_xref="GOA:A1JIS4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS4"
FT                   /protein_id="CAL10515.1"
FT                   /translation="MEEGMEWQTHLVFNQPEPLSNSNLYLSDMALREAVMREHAGWDGE
FT                   DLSRIGLQLGSQESLELGRLANANPPELLRYDAAGQRLDQVRFHPAWYVLMQELVNHRV
FT                   HNLPWQEDARIGSFVARAARFILHAQVEAGTLCPITMTFGAIPLLQQTLPPLFQSWIPA
FT                   LLSDRYDSHQIVGSQKRGLLIGMGMTEKQGGSDVLSNSTRAEPLQFRGNGEAYRLVGHK
FT                   WFFSVPQSDAHLVLAQAEGGLSCFFLPKILPDGTYNAIRLERLKEKLGNRSNASSEVEF
FT                   DNATAWLLGDEGDGIRQILKMGGYTRFDCALGSHGLMRRAFSIALYHAWQRQAFGKALV
FT                   DQPLMRQVLSRMALRLEGHTALLMRLASAWGKTGEVHEQVFSRLLTPAAKYRVCGLGSG
FT                   FVAEAMEVLGGIGYCEQSELPRIYREMPVNSIWEGSGNIMCLDVLRTFRKLPSAIEMLQ
FT                   QEFYSVRGQNRLFDRAWRQLQLRLKNPKEEQGRAITQQLFDLCCASQLLRFASPPLADA
FT                   WCRMTLDHRDQYMVPEAVCALLLSRGSGMK"
FT   misc_feature    456720..457115
FT                   /note="Pfam match to entry PF02771 Acyl-CoA_dh_N, Acyl-CoA
FT                   dehydrogenase, N-terminal domain, score 120.8, E-value
FT                   1.7e-33"
FT                   /inference="protein motif:PFAM:PF02771"
FT   misc_feature    457119..457157
FT                   /note="PS00072 Acyl-CoA dehydrogenases signature 1."
FT                   /inference="protein motif:Prosite:PS00072"
FT   misc_feature    457119..457427
FT                   /note="Pfam match to entry PF02770 Acyl-CoA_dh_M, Acyl-CoA
FT                   dehydrogenase, middle domain, score 105.7, E-value 6e-29"
FT                   /inference="protein motif:PFAM:PF02770"
FT   misc_feature    457437..457904
FT                   /note="Pfam match to entry PF00441 Acyl-CoA_dh, Acyl-CoA
FT                   dehydrogenase, C-terminal domain, score 139.9, E-value
FT                   3e-39"
FT                   /inference="protein motif:PFAM:PF00441"
FT   CDS             complement(458229..458537)
FT                   /transl_table=11
FT                   /locus_tag="YE0387"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0387"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10516"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS5"
FT                   /protein_id="CAL10516.1"
FT                   /translation="MNLKRVMVVLLITLGLSACSAFHVTPVPPPVAQPYAQEITRAQSL
FT                   NLQKVGTVSAQVFGSPMDIEAEIKRRANASGAPYYLIIMMSDSIYPGIWYANALLYK"
FT   misc_feature    complement(join(458235..458303,458460..458519))
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0387 by TMHMM2.0 at aa 7-26 and 79-101"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(458466..458537)
FT                   /locus_tag="YE0387"
FT                   /note="Signal peptide predicted for YE0387 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.585 between residues 24 and 25"
FT   misc_feature    complement(458481..458513)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             458723..459472
FT                   /transl_table=11
FT                   /locus_tag="YE0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0388"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10517"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS6"
FT                   /protein_id="CAL10517.1"
FT                   /translation="MIEMSLENINGIEVIHAAPAGQRQQPLPTIFFYHGYTSSKEVYSY
FT                   FAYAFAQAGFRTIAPDADRHGARFDGNETQRLSHFWEILKSNIDELPGLKQHYQQAGLI
FT                   DGDRMGVAGASLGGMTALGAFARYPWVSVAADFMGSGYFTSLAHSLFPPLDAGRELSPA
FT                   QLERRLAPLADYDLSHQLEKIAERPLLVWHGEADDVVPAAESARLVQALRVSRRDNHLT
FT                   YLTEAGIGHKITPTALNAGTRFFSKYL"
FT   CDS             complement(459557..459844)
FT                   /transl_table=11
FT                   /locus_tag="YE0389"
FT                   /product="putative exported protein"
FT                   /note="Similar to many exported proteins including:
FT                   Escherichia coli, and Escherichia coli O157:H7 hypothetical
FT                   protein YjfY precursor b4199 or z5808 or ecs5175
FT                   SWALL:YJFY_ECOLI (SWALL:P39307) (91 aa) fasta scores: E():
FT                   1.4e-06, 40 38d in 80 aa and to Salmonella typhimurium
FT                   putative outer membrane protein YhcN or Stm3361
FT                   SWALL:Q8ZLP6 (EMBL:AE008855) (87 aa) fasta scores: E():
FT                   2.8e-05, 43.95 38d in 91 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10518"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIS7"
FT                   /inference="similar to sequence:INSDC:AE008855"
FT                   /inference="similar to sequence:UniProtKB:P39307"
FT                   /protein_id="CAL10518.1"
FT                   /translation="MESPMKHTVAIAAALGLVLSTSTFAATEITAQQAMQQQRVSIGAL
FT                   SLGHNVISPDDATAQISKLADERGATSYQIIAMHEPGDNSSMHVNAVLYR"
FT   sig_peptide     complement(459770..459844)
FT                   /locus_tag="YE0389"
FT                   /note="Signal peptide predicted for YE0389 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.993 between residues 25 and 26"
FT   CDS             460435..460827
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="YE0392"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:YE0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10519"
FT                   /db_xref="GOA:A1JIS8"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIS8"
FT                   /protein_id="CAL10519.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSATITNAAGTIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVK
FT                   AKDERRERHDFASEANDDSEAGDSEE"
FT   misc_feature    460438..460710
FT                   /note="Pfam match to entry PF01250 Ribosomal_S6, Ribosomal
FT                   protein S6, score 171.7, E-value 8.1e-49"
FT                   /inference="protein motif:PFAM:PF01250"
FT   misc_feature    460561..460590
FT                   /note="PS01048 Ribosomal protein S6 signature."
FT                   /inference="protein motif:Prosite:PS01048"
FT   CDS             460832..461152
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="YE0393"
FT                   /product="primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:YE0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10520"
FT                   /db_xref="GOA:A1JIS9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIS9"
FT                   /protein_id="CAL10520.1"
FT                   /translation="MVTTNRLVLSGTVCKTPVRKVSPSGIPHCQFVLEHRSTQQEAGFS
FT                   RQTWCRMPIIVSGQQSQALTHSITVGSQLTVEGFISCHQGRNGLNKLVLHAEQIEFIDS
FT                   GD"
FT   CDS             461157..461384
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="YE0394"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:YE0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10521"
FT                   /db_xref="GOA:A1JIT0"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIT0"
FT                   /protein_id="CAL10521.1"
FT                   /translation="MARYFRRRKFCRFTAEGVVEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARCIKRARYLSLLPYTDRHQ"
FT   misc_feature    461199..461360
FT                   /note="Pfam match to entry PF01084 Ribosomal_S18,Ribosomal
FT                   protein S18, score 110.3, E-value 2.4e-30"
FT                   /inference="protein motif:PFAM:PF01084"
FT   misc_feature    461217..461288
FT                   /note="PS00057 Ribosomal protein S18 signature."
FT                   /inference="protein motif:Prosite:PS00057"
FT   CDS             461424..461876
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="YE0395"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:YE0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10522"
FT                   /db_xref="GOA:A1JIT1"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIT1"
FT                   /protein_id="CAL10522.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLAGVLAAAEARATKINELVSVTIASKAGDEGKLFGSIGTRDIADAVT
FT                   AAGVEVAKSEVRLPNGVLRTTGDHEVHFQVHSDVFAKLNVIVVPEA"
FT   misc_feature    461424..461579
FT                   /note="Pfam match to entry PF01281 Ribosomal_L9_N,Ribosomal
FT                   protein L9, N-terminal domain, score 106.5,E-value 3.4e-29"
FT                   /inference="protein motif:PFAM:PF01281"
FT   misc_feature    461460..461543
FT                   /note="PS00651 Ribosomal protein L9 signature."
FT                   /inference="protein motif:Prosite:PS00651"
FT   misc_feature    461607..461870
FT                   /note="Pfam match to entry PF03948 Ribosomal_L9_C,Ribosomal
FT                   protein L9, C-terminal domain, score 144.6,E-value 1.1e-40"
FT                   /inference="protein motif:PFAM:PF03948"
FT   CDS             complement(461952..462401)
FT                   /transl_table=11
FT                   /locus_tag="YE0396"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10523"
FT                   /db_xref="InterPro:IPR022231"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT2"
FT                   /protein_id="CAL10523.1"
FT                   /translation="MMKYKLPFALLLMPFSAFATQHCPAIDTIKHNNGVYTATTAGVGE
FT                   WIGTVQGEIPRDSAIKSFHEALLILNSDGGEDNIIDQGRFQKCTYNLQAEGKLMDMYFD
FT                   NQTWRASISGKPHWRYQQTTFLEIYSCSGVAPELCAFDIMLPAVP"
FT   sig_peptide     complement(462345..462401)
FT                   /locus_tag="YE0396"
FT                   /note="Signal peptide predicted for YE0396 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.996) with cleavage site
FT                   probability 0.879 between residues 19 and 20"
FT   CDS             complement(462544..463317)
FT                   /transl_table=11
FT                   /locus_tag="YE0397"
FT                   /product="putative membrane protein"
FT                   /note="Similar to Yersinia pestis hypothetical protein
FT                   Ypo3533 SWALL:Q8ZB86 (EMBL:AJ414157) (246 aa) fasta scores:
FT                   E(): 2.3e-46, 71.76 38d in 255 aa and Escherichia coli
FT                   hypothetical protein YtfB or b4206 SWALL:YTFB_ECOLI
FT                   (SWALL:P39310) (212 aa) fasta scores: E(): 7.9e-15, 47.39
FT                   id in 211 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10524"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT3"
FT                   /inference="similar to sequence:INSDC:AJ414157"
FT                   /inference="similar to sequence:UniProtKB:P39310"
FT                   /protein_id="CAL10524.1"
FT                   /translation="MGRIAPRRRKSTRVYQPLLHTWLSIRQRVLPGAKNTDDHNLMSEV
FT                   SVSEHISPADEIISAENNMPPETATTAVQNSRIKGVLLKIWHLPDNFEWMEPLPFFHRR
FT                   WVIVATTVLLLALLWPVSRDNTNNRFPVSAPSTEVPLQAQLQGNLDAPPPPTVAPPITP
FT                   EATPPLQGNWQSYQIQSGKTLAQLFRDNNLPVNEVFAMAQVEGQDKPLSNLKAGQEVKI
FT                   MLDAQGVVAALAIETTNSTEVLFTRQSDGSYRRVR"
FT   misc_feature    complement(462952..463005)
FT                   /note="possible transmembrane domain"
FT   CDS             463604..464224
FT                   /transl_table=11
FT                   /gene="fklB"
FT                   /locus_tag="YE0398"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10525"
FT                   /db_xref="GOA:A1JIT4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT4"
FT                   /protein_id="CAL10525.1"
FT                   /translation="MTTPSFDSVEAQASYGIGLQIGQQLQESGLEGLLPEALLAGLRDA
FT                   MEGNAPTVPVDVIHRALQEVHEKADKVRVERQQALVEEGKTFLEENAKRDDVTTTESGL
FT                   QFSVLQAGDGPIPSRQDRVRVHYTGRLVDGTVFDSSVERGQPAEFPVSGVIPGWIEALS
FT                   MMPVGSKWKLYIPHNLAYGERGAGATIPPFSALMFEVELLEIL"
FT   misc_feature    463838..463861
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    463853..463927
FT                   /note="Pfam match to entry PF01346 FKBP_N, Domain amino
FT                   terminal to FKBP-type peptidyl-prolyl isomerase, score
FT                   22.7, E-value 1.9e-05"
FT                   /inference="protein motif:PFAM:PF01346"
FT   misc_feature    463937..464212
FT                   /note="Pfam match to entry PF00254 FKBP, FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase, score 146.4, E-value
FT                   3.3e-41"
FT                   /inference="protein motif:PFAM:PF00254"
FT   misc_feature    463976..464023
FT                   /note="PS00453 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase signature 1."
FT                   /inference="protein motif:Prosite:PS00453"
FT   CDS             complement(464296..466269)
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="YE0399"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10526"
FT                   /db_xref="GOA:A1JIT5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT5"
FT                   /protein_id="CAL10526.1"
FT                   /translation="MEKAMFKRPLTLSLLASLIALTTSTAQAATVDLRVLETTDLHSNM
FT                   MDFDYYKDKPTEKFGLVRTASLIEAARQQATNSVLVDNGDLIQGSPLGDYMAANGLKVG
FT                   EIHPVYKAMNTLDYAVGNIGNHEFNYGLDYLKKSLAGAKFPYVNANVIDVKTGKPLFQP
FT                   YLIVDTPVKDRDGKSHNLRIGYIGFVPPQVMIWDKANLTGKVTVDDITETAKKWVPEMR
FT                   KQGANLVVAIPHSGLSSDPYKTMAENSVYYLSQVPGIDAIMFGHAHAVFPSKDFATIKG
FT                   ADIAQGTLNGIPAVMPGQWGDHLGVVDFVLNNDQGQWQVTQAKAEARPIFDKATQKSLA
FT                   AENANLMKVLAADHQGTRDFVSQPIGTASDNMYSYLSLIQDDPTVQIVNNAQRAYTEHF
FT                   IQGDPDLADLPVLSAAAPFKAGGRKNDPASFVEVEKGELTFRNAADLYLYPNTLVVVKA
FT                   SGADVKQWLECSAAQFNQIDVNSSKPQSLINWDSFRTYNFDVIDGVNYEIDVSQPARYD
FT                   GECALINDKAERIKNLTFNGKPIDPKATFLIATNNYRAYSGKFAGTGDSHIAFASPDEN
FT                   RAVLSAYISAETKKHGQVTPQADNNWRLATIDSKQPLDIRFETSPSAKAAEFIKQKAQY
FT                   PMKALGTDEIGFEVYQIDLQKK"
FT   misc_feature    complement(464575..465180)
FT                   /note="Pfam match to entry PF02872
FT                   5_nucleotidaseC,5'-nucleotidase, C-terminal domain, score
FT                   233.1, E-value 2.5e-67"
FT                   /inference="protein motif:PFAM:PF02872"
FT   misc_feature    complement(465460..466173)
FT                   /note="Pfam match to entry PF00149
FT                   Metallophos,Calcineurin-like phosphoesterase, score 65.4,
FT                   E-value 7.9e-17"
FT                   /inference="protein motif:PFAM:PF00149"
FT   misc_feature    complement(465883..465918)
FT                   /note="PS00786 5'-nucleotidase signature 2."
FT                   /inference="protein motif:Prosite:PS00786"
FT   misc_feature    complement(466135..466173)
FT                   /note="PS00785 5'-nucleotidase signature 1."
FT                   /inference="protein motif:Prosite:PS00785"
FT   sig_peptide     complement(466186..466269)
FT                   /gene="cpdB"
FT                   /locus_tag="YE0399"
FT                   /note="Signal peptide predicted for YE0399 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.998 between residues 28 and 29"
FT   CDS             466745..467488
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /gene_synonym="amtA"
FT                   /locus_tag="YE0400"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0400"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10527"
FT                   /db_xref="GOA:A1JIT6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT6"
FT                   /protein_id="CAL10527.1"
FT                   /translation="MMLEQICQLAREAGVAIMAVYQGEKPLDVAHKKDDSPVTAADLAA
FT                   HQIIKAGLAALTPDIPLLSEEDPPTWAVRQHWQRYWLVDPLDGTKEFLSRNGEFTVNIA
FT                   LIDQGVPVLGVVYAPASEVMYSAENGQAWKEECGRRMQIEVRDAIPPLVVVSRSHSDAE
FT                   LEDYLAQLGEHQTVAVGSSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVH
FT                   DWQGKPLSYIPRESFLNPGFRVSLF"
FT   misc_feature    466745..467482
FT                   /note="Pfam match to entry PF00459 inositol_P, Inositol
FT                   monophosphatase family, score 225.0, E-value 7.1e-65"
FT                   /inference="protein motif:PFAM:PF00459"
FT   misc_feature    466754..466819
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1151.000, SD 3.11 at aa 4-25, sequence
FT                   EQICQLAREAGVAIMAVYQGEK"
FT   misc_feature    466985..467026
FT                   /note="PS00629 Inositol monophosphatase family signature
FT                   1."
FT                   /inference="protein motif:Prosite:PS00629"
FT   misc_feature    467357..467401
FT                   /note="PS00630 Inositol monophosphatase family signature
FT                   2."
FT                   /inference="protein motif:Prosite:PS00630"
FT   CDS             complement(467491..468054)
FT                   /transl_table=11
FT                   /locus_tag="YE0401"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10528"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT7"
FT                   /protein_id="CAL10528.1"
FT                   /translation="MIKNSLLILSLLLTPFMVSALTIQVDQRVPPVGVSDKGELNYDKA
FT                   TDQFSYKNWNSSQLPGKVRVVQHIAGRTSAKELNAPLVEAIKHANLPHEHYQTTTIVNT
FT                   DDAIIGTAMFVRNSIESNKREFPWSQFVVDSNGSVKKAWGLAEKGSAIVVLDQQGNVKF
FT                   VKDGALTAEEVQQVIDQLHQLVKQ"
FT   sig_peptide     complement(467995..468054)
FT                   /locus_tag="YE0401"
FT                   /note="Signal peptide predicted for YE0401 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.958 between residues 20 and 21"
FT   CDS             468378..468581
FT                   /transl_table=11
FT                   /locus_tag="YE0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10529"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT8"
FT                   /protein_id="CAL10529.1"
FT                   /translation="MRIFQRYNPAKIAMYVKTLFRGRLYIKDMGAFEFDKGKILIPKVR
FT                   DKRHFEVMSEVNRQVMRLQTEI"
FT   CDS             complement(468666..469997)
FT                   /transl_table=11
FT                   /locus_tag="YE0403"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10530"
FT                   /db_xref="GOA:A1JIT9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIT9"
FT                   /protein_id="CAL10530.1"
FT                   /translation="MLNSILLILFLIAVSAFFSLSEISLAASRKIKLKLLADEGDINAL
FT                   RVLKLQETPGIFFTVVQIGLNAVAILGGIVGDAAFSPSFKVVFERFMSPELADQVSFIC
FT                   SFVLVTSLFILFADLTPKRIGMISPEAVAVRIVNPMRFCIMICRPLVWFFNGMANLIFR
FT                   LFKLPMVRNDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRESV
FT                   IYFDLRESEDSIKEKISTHPHSKFLVCDGHIDQVVGYVDSKDLLNRVLGNQSLVLSSGV
FT                   QIRSALIVPDTLTLSEALESFKTAGEDFAVILNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   QEEQIVARDENSWLIEGGTPIEDVMRVLHIDEFPQSGNYETIGGFMMYMLRKIPKRTDF
FT                   VKYAGYKFEVVDIDSYKIDQLLVTRFSDQPTPILPKAPHESSDA"
FT   misc_feature    complement(468720..468962)
FT                   /note="Pfam match to entry PF03471 CorC_HlyC, Transporter
FT                   associated domain, score 101.9, E-value 8.4e-28"
FT                   /inference="protein motif:PFAM:PF03471"
FT   misc_feature    complement(468999..469160)
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   28.1, E-value 1.3e-05"
FT                   /inference="protein motif:PFAM:PF00571"
FT   misc_feature    complement(469188..469352)
FT                   /note="Pfam match to entry PF00571 CBS, CBS domain, score
FT                   28.9, E-value 7.6e-06"
FT                   /inference="protein motif:PFAM:PF00571"
FT   misc_feature    complement(469407..469994)
FT                   /note="Pfam match to entry PF01595 DUF21, Domain of unknown
FT                   function DUF21, score 238.9, E-value 4.8e-69"
FT                   /inference="protein motif:PFAM:PF01595"
FT   misc_feature    complement(join(469515..469568,469647..469712,
FT                   469770..469838,469917..469985))
FT                   /note="4 probable transmembrane helices predicted for
FT                   YE0403 by TMHMM2.0 at aa 5-27, 54-76, 96-117 and 144-161"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(469920..469997)
FT                   /locus_tag="YE0403"
FT                   /note="Signal peptide predicted for YE0403 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.676 between residues 26 and 27"
FT   CDS             complement(470285..470923)
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /gene_synonym="pms"
FT                   /locus_tag="YE0404"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10531"
FT                   /db_xref="GOA:A1JIU0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIU0"
FT                   /protein_id="CAL10531.1"
FT                   /translation="MQNFDKTAVIDAANALPGRLTPMPVATLHVVNGHSMTHVPEGMEV
FT                   AIFAMGCFWGVERLFWQQPGVYSTAAGYSGGYTPNPTYHEVCSGRTAHAEVVRVVFDPA
FT                   IISYKQLLQIFWENHDPAQGMRQGGDVGTQYRSAIYVLTPEQETQAQESQALFQQAMTK
FT                   AGDSRAITSEIAAALPFYYAEDDHQQYLYKNPQGYCGLGGIGVCMPPNL"
FT   misc_feature    complement(470312..470794)
FT                   /note="Pfam match to entry PF01625 PMSR, Peptide methionine
FT                   sulfoxide reductase, score 315.2, E-value 5e-92"
FT                   /inference="protein motif:PFAM:PF01625"
FT   CDS             471364..473064
FT                   /transl_table=11
FT                   /locus_tag="YE0405"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10532"
FT                   /db_xref="GOA:A1JIU1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU1"
FT                   /protein_id="CAL10532.1"
FT                   /translation="MLATPIAYAANVRLQVEGLSGDLERNVRARLSTISTDEVTADGRF
FT                   RSRVDEAIRQGLRALGYYDPTITFDLQQRPAPARSVLIAKVVPGEPVLIAGVDIVLQGG
FT                   AKTDPDYLALVRRDTPKIGSVLNHGDFDNFKSSLTGLALRRGYFDANMIKSQLGVAAEL
FT                   REAFWDIDFDSGERYRFGKVIFQGSQIREDYLQNLVPFHEGELYTSDELAELNRRLSAT
FT                   NWFNSVVVSPDFRDAKKTKILPLDAVVTPRTENTVELGGGYATDVGPRLTASWRKPWVN
FT                   SYGHSLTTSTTLSAPEQTLDFSYRIPLLKNPLEQYYLLQGGFKRTDLNDTKSDTTTLNV
FT                   ARFWDLSSGWQRAINLRWSLDHFTQGSVTDTTMLLYPGVSINRTRQRGGAMPVWGDSQR
FT                   YSIDWSDTTWGSDVDFGTFQAQNVWIRTLGEKNRFVVRGNVGWIETNDFDRVPPSLRFF
FT                   AGGDRSIRGYKFRDISPRDSEGKLTGASKLATGSFEYQYNVTGRWWGAVFVDTGEAVND
FT                   IRKSDLKTGAGFGVRWASPVGPIKLDIAKPIGDNEAHGVQFYIGLGPEL"
FT   misc_feature    472843..472881
FT                   /note="PS00213 Lipocalin signature."
FT                   /inference="protein motif:Prosite:PS00213"
FT   CDS             473166..476945
FT                   /transl_table=11
FT                   /locus_tag="YE0406"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0406"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10533"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU2"
FT                   /protein_id="CAL10533.1"
FT                   /translation="MLIILLLVGTLAGLLGTTSGLHFVINSAARWVPGLDIASVSGGWR
FT                   DLTLKGIQYQMPGVTVKAGQFHLSLQLSCLKRSELCVNALTAQDVDVVVDTKAMEPTAP
FT                   APASTEPMAELSTPYPITLRLLSLNNVKVTIDDTAISLNEFRTGAHWQQRALNLMPTKI
FT                   SGLLIALPKTVPAIVPDAAKPAVETAIAVKEAVEQQAAAPAPAETPLGETLKELFAKPL
FT                   LPDLPDFRLPLDLQIKEISGQQLRLTGDTDVLITSLLLQASTQDNRITLDTLDIKSPQG
FT                   GLSARGEATLADTWPLSITVNSALNIAPLKGEKVKLTVGGGLREQLNVALNLSGPVSAQ
FT                   LEAETALAQAGLPMALTLQSKQLRWPLSGEPQFQLDNLRMRLNGQATDYALSIRSDFKG
FT                   TDLPPAIFTLDGKGNVEQFNLTRLRLAALQGNTDLTGVVDWSKAISWNSVLTLSGINTA
FT                   KQWPEWPAKLDGKIVTRGSIHGGSWQLQVPELTLDGNVKQNRVTARGSLTGNAAGQWHI
FT                   PGINLALGRNKLDVKGDLNDNWLLDANVDAPQLDGALPGLGGIVKGTLKLRGNLKAPQL
FT                   LADLTASRLQWQELTINRIKIDGDVRSTDQIQGQLAIRVEQLKQADLVVSLLTLDARGS
FT                   EKQHQLRLNMQGEPVSGQLALEGSFDRQQERWRGTLNNTRFDTPVGEWRLSRAIALDYQ
FT                   NTLERVTIGPHCWLNPNAELCVPRAIEAGPSGQASVVLNRFDLAMIKPFLGPDTTMSGV
FT                   FTGRADVSWKAGGSLPDVRVSLSGNGVKVQQMVQGNPLPIAFETLNLNGGLANGQVRAD
FT                   WLIKLVNNGQFSGQVQVADPEGRRNLSGNIAISNFSLAMINPILSDGEKASGLLNANLR
FT                   LGGNAKSPLVFGRLALDNVDVDGSWMPFDITEGRLVMNFDGMTSTLEGLIRTSQGQLNL
FT                   SGDADWRDINAWRARIAAKGNKLRVTVPPMVRIDVSPDIVFEATPQLFSLNGSVDIPWA
FT                   RITVQEVPESAVGVSPDEVMLNNDLQPISPRTAGIPINSNLVIHVGNDVRLNAFGLKAR
FT                   LQGDLKMIQDQRGLGLNGQINIPSGSFRAYGQDLIVNKGVLLFSGPPDQPLLNIEAIRN
FT                   PDATADGVTAGVRVTGMADSPRLEIFSDPAMSQQEALSYLLRGQGLGNSGADSGLMTSM
FT                   LVGMGVAQSGKLVGKIGEAFGVSNLALDTQGVGDSSQVVVSGYVTKDLQVKYGVGIFDS
FT                   LATLTLRYRLMPRLYLEAVSGIDQALDVLYQFEF"
FT   sig_peptide     473166..473252
FT                   /locus_tag="YE0406"
FT                   /note="Signal peptide predicted for YE0406 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.812) with cleavage site
FT                   probability 0.371 between residues 29 and 30"
FT   misc_feature    473169..473237
FT                   /note="1 probable transmembrane helix predicted for YE0406
FT                   by TMHMM2.0 at aa 2-24"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             476948..477310
FT                   /transl_table=11
FT                   /locus_tag="YE0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0407"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10534"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU3"
FT                   /protein_id="CAL10534.1"
FT                   /translation="MRIIVYGSLRRKQGNSHWMTDAQLLGEHDLEGFDMYNLGHYPAVV
FT                   PGDGTVHCEVYRINSSIMNELDELKSNTKDYRRELIQTPYGSAWIYLYRLPVEGLPRIY
FT                   SGDWLKRHEENDKPQR"
FT   misc_feature    476975..477283
FT                   /note="Pfam match to entry PF03674 UPF0131,Uncharacterised
FT                   protein family (UPF0131), score 110.6,E-value 2e-30"
FT                   /inference="protein motif:PFAM:PF03674"
FT   CDS             complement(477569..478096)
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="YE0408"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0408"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10535"
FT                   /db_xref="GOA:A1JIU4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU4"
FT                   /protein_id="CAL10535.1"
FT                   /translation="MSLNQVPAGKDLPEDIYVVIEIPANADPIKYEIDKETGSLFVDRF
FT                   MSTAMFYPCNYGYINNTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDA
FT                   KLVAVPHSKLTKEYDHVKDVQDLPELLKAQIKHFFEHYKDLETGKWVKVDGWEDAAAAK
FT                   AEILSSFERAKK"
FT   misc_feature    complement(477572..478048)
FT                   /note="Pfam match to entry PF00719
FT                   Pyrophosphatase,Inorganic pyrophosphatase, score 211.3,
FT                   E-value 9.2e-61"
FT                   /inference="protein motif:PFAM:PF00719"
FT   misc_feature    complement(477881..477901)
FT                   /note="PS00387 Inorganic pyrophosphatase signature."
FT                   /inference="protein motif:Prosite:PS00387"
FT   CDS             478386..479966
FT                   /transl_table=11
FT                   /locus_tag="YE0409"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="Similar to many including: Escherichia coli
FT                   methyl-accepting chemotaxis protein I Tsr or ched or b4355
FT                   SWALL:MCP1_ECOLI (SWALL:P02942) (551 aa) fasta scores: E():
FT                   2e-58, 42.61 38d in 528 aa and to Salmonella typhimurium
FT                   methyl-accepting chemotaxis protein I, serine sensor
FT                   receptor Tsr or stm4533 SWALL:Q8ZJY4 (EMBL:AE008913) (553
FT                   aa) fasta scores: E(): 1.1e-59,42.39 38d in 526 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0409"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10536"
FT                   /db_xref="GOA:A1JIU5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU5"
FT                   /inference="similar to sequence:INSDC:AE008913"
FT                   /inference="similar to sequence:UniProtKB:P02942"
FT                   /protein_id="CAL10536.1"
FT                   /translation="MLKKITIKNGLIAQLSLMSLILLIVSVIGINSIQESSRALQAINQ
FT                   IQGEELGSLSNSFTATLSARTEAALAIHQLEIGLIDESLQTAKQAEESLALSQREMARF
FT                   VSAVSERGEGQELATNIQKSYKNYVDKGVIPMLTAIKAGYADEYYEVLEKSITDISKAF
FT                   NNDVATFRSYELNAGHLQIDKANSAAKIKLAIIVAAGIITLISAVLAWFALKYIILQPL
FT                   EQSIHQLEYIADGDLTHNINSEGNTELARLAKALQTMQQSLVASVSNVRDVGGQIGIGS
FT                   RELAAGNNHLAERTEESASSLEQTAASMEQLTSTVKMNAENSDQANRLAMSVSDIASKG
FT                   SKVVSHVVDKMQAITTSSRRISDIIAVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRNLAQRSAQSAKEIKDLIVESQNRVREGADMAESAGKTMHEIADEVNRVTALMRE
FT                   ISAASYEQSSGIEQVNVAIAQMDQVAQQNATLVEQAAAATRSLEEQADALSASMAVFKL
FT                   QGDELAVVA"
FT   sig_peptide     478386..478511
FT                   /locus_tag="YE0409"
FT                   /note="Signal peptide predicted for YE0409 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.965) with cleavage site
FT                   probability 0.310 between residues 42 and 43"
FT   misc_feature    join(478413..478481,478956..479024)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0409 by TMHMM2.0 at aa 10-32 and 191-213"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    478971..479180
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,score
FT                   50.9, E-value 1.8e-12"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    479241..479939
FT                   /note="Pfam match to entry PF00015
FT                   MCPsignal,Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain, score 352.2, E-value 3.7e-103"
FT                   /inference="protein motif:PFAM:PF00015"
FT   CDS             complement(480178..481191)
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /gene_synonym="fdp"
FT                   /locus_tag="YE0410"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10537"
FT                   /db_xref="GOA:A1JIU6"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIU6"
FT                   /protein_id="CAL10537.1"
FT                   /translation="MKTLGEFIVEKQLDFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGASGVSNIQGEDQMKLDLFANEKLKAALKARGEVAGIASEEEDDIVIFDGGRAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPFGTPITEADFLQPGTKQVAAGYVVY
FT                   GSSTMLVYTTGYGVHTFTYDPSLGVFCLSGEKVRYPATGCMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDEATQRPYTSRYIGSLVADFHRNLLKGGIYIYPSTASHPQGKLRLLYECNPM
FT                   AFLAEQAGGKATDGVNRILDIVPEKLHQRAPFFVGTKSMVEDAEGFIAKFPDEEAK"
FT   misc_feature    complement(480199..481188)
FT                   /note="Pfam match to entry PF00316
FT                   FBPase,Fructose-1-6-bisphosphatase, score 668.2, E-value
FT                   2.7e-198"
FT                   /inference="protein motif:PFAM:PF00316"
FT   misc_feature    complement(480346..480384)
FT                   /note="PS00124 Fructose-1-6-bisphosphatase active site."
FT                   /inference="protein motif:Prosite:PS00124"
FT   CDS             481361..482746
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="YE0411"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-m
FT                   eso-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10538"
FT                   /db_xref="GOA:A1JIU7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU7"
FT                   /protein_id="CAL10538.1"
FT                   /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLENQ
FT                   GIDLIQGYDPAQLDPVPDLVIIGNAMTRGNPCVEAVLEQGIPYVSGPQWLHDHVLPGRW
FT                   VLAIAGTHGKTTTAGMVAWILEACGYEPGFVIGGVPGNFDVSARLGNSPFFVIEADEYD
FT                   CAFFDKRSKFVHYSPRTLVMNNLEFDHADIFDDLKAIQKQFHHLVRLVPGAGKIIVPDN
FT                   DNHLKQVMAMGCWSEQELVGETGRWFARKVAVDASVFEVFLDNKLVGEVSWSLVGEHNM
FT                   HNGLMAIAAARHVGVLPAAACRALGDFINARRRLELRGEAHGVTVYDDFAHHPTAILAT
FT                   LAALRSKVGGTARILAVLEPRSNTMKLGMCRNELAPSLGRADEVFLFQPQHISWQVVEV
FT                   AEACIQPAYWSADIDTLVDMVVKTAQPGDHILVMSNGGFGGIHDKLLSALSQKAEYEAQ
FT                   SQE"
FT   sig_peptide     481361..481432
FT                   /gene="mpl"
FT                   /locus_tag="YE0411"
FT                   /note="Signal peptide predicted for YE0411 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.899) with cleavage site
FT                   probability 0.726 between residues 24 and 25"
FT   misc_feature    481472..482269
FT                   /note="Pfam match to entry PF01225 Mur_ligase, Mur ligase
FT                   family, catalytic domain, score 194.4, E-value 1.2e-55"
FT                   /inference="protein motif:PFAM:PF01225"
FT   misc_feature    482291..482563
FT                   /note="Pfam match to entry PF02875 Mur_ligase_C, Mur ligase
FT                   family, glutamate ligase domain, score 72.0,E-value
FT                   8.3e-19"
FT                   /inference="protein motif:PFAM:PF02875"
FT   CDS             complement(483000..483263)
FT                   /transl_table=11
FT                   /locus_tag="YE0412"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10539"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIU8"
FT                   /protein_id="CAL10539.1"
FT                   /translation="MKVKTTIATMSILSALSFGVFAADSISENQAANLQPMGTITVSGL
FT                   NGAPSDIRQALSEKADAMGAKAYKVIEAREENNWHATAEIYK"
FT   sig_peptide     complement(483198..483263)
FT                   /locus_tag="YE0412"
FT                   /note="Signal peptide predicted for YE0412 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.999 between residues 22 and 23"
FT   CDS             complement(483677..484147)
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /gene_synonym="xerA"
FT                   /locus_tag="YE0413"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0413"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10540"
FT                   /db_xref="GOA:A1JIU9"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR024946"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIU9"
FT                   /protein_id="CAL10540.1"
FT                   /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVLALQEEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDYNDSVVVINTSPGA
FT                   AQLIARLLDSLGKAEGILGSIAGDDTIFTTPARGFTVEQLHEAILRLFEQEL"
FT   misc_feature    complement(483695..483907)
FT                   /note="Pfam match to entry PF02863 Arg_repressor_C,Arginine
FT                   repressor, C-terminal domain, score 120.7,E-value 1.7e-33"
FT                   /inference="protein motif:PFAM:PF02863"
FT   misc_feature    complement(483917..484141)
FT                   /note="Pfam match to entry PF01316 Arg_repressor, Arginine
FT                   repressor, DNA binding domain, score 119.0, E-value
FT                   5.8e-33"
FT                   /inference="protein motif:PFAM:PF01316"
FT   CDS             484611..485546
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="YE0414"
FT                   /product="malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10541"
FT                   /db_xref="GOA:A1JIV0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIV0"
FT                   /protein_id="CAL10541.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSDLSLYDIAPVTPGVAVD
FT                   LSHIPTAVNIKGFSGEDATPALKGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQ
FT                   IARTCPKALIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGITTLDTIRSNTFVAELKG
FT                   KQPQDIEVPVIGGHSGVTILPLLSQIPGISFTEQEVIDLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALQGESNVVECSYVEGDGKYARFFAQPILLGKDGVAERKDI
FT                   GKLSAFEQQALENMLDVLHKDIELGEQFVK"
FT   sig_peptide     484611..484661
FT                   /gene="mdh"
FT                   /locus_tag="YE0414"
FT                   /note="Signal peptide predicted for YE0414 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.803) with cleavage site
FT                   probability 0.736 between residues 17 and 18"
FT   misc_feature    484611..485045
FT                   /note="Pfam match to entry PF00056 ldh, lactate/malate
FT                   dehydrogenase, NAD binding domain, score 230.0, E-value
FT                   2.2e-66"
FT                   /inference="protein motif:PFAM:PF00056"
FT   misc_feature    485046..485084
FT                   /note="PS00068 Malate dehydrogenase active site signature."
FT                   /inference="protein motif:Prosite:PS00068"
FT   misc_feature    485049..485540
FT                   /note="Pfam match to entry PF02866 ldh_C, lactate/malate
FT                   dehydrogenase, alpha/beta C-terminal domain, score
FT                   210.2,E-value 2e-60"
FT                   /inference="protein motif:PFAM:PF02866"
FT   CDS             complement(485623..485898)
FT                   /transl_table=11
FT                   /locus_tag="YE0415"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0415"
FT                   /db_xref="EnsemblGenomes-Tr:CCP19174"
FT                   /db_xref="GOA:K8FC75"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:K8FC75"
FT                   /protein_id="CCP19174.1"
FT                   /translation="MILRKSDWHPADIIAALRKKDTTLAAVSRKAGLSSSTLANALTRP
FT                   WPKGEWLIAECLEIHPSEIWPTRYFDSKTGALLDRKVRIRQPITEE"
FT   CDS             join(486028..486057,486061..486429)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="YE0416"
FT                   /product="conserved hypothetical protein (pseudogene)"
FT                   /note="CDS contains a premature stop codon following codon
FT                   10"
FT                   /db_xref="PSEUDO:CAL10542.1"
FT   misc_feature    486103..486240
FT                   /note="Pfam match to entry PF02316 Mu_DNA_bind, Mu
FT                   DNA-binding domain, score 59.0, E-value 2.8e-16"
FT                   /inference="protein motif:PFAM:PF02316"
FT   CDS             complement(486490..487461)
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /gene_synonym="cel"
FT                   /locus_tag="YE0417"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10543"
FT                   /db_xref="GOA:A1JIV2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR017446"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIV2"
FT                   /protein_id="CAL10543.1"
FT                   /translation="MNLEKIIDLTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGK
FT                   RIRPMIAVLVARALGYQGTKHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDYIYTRSFQMMTSLESLRVLTLMSDATNVIAEGEVLQLMNCNNPDITEENY
FT                   MQVIYSKTARLFEAASQSAAVLSDATEEQELALQNYGRYLGTAFQLIDDLLDYSSDGTT
FT                   LGKNTGDDLNEGKPTLPLLHAMHNGTPEQAAMIRQAIEEGNGRHLLEPVLVAMQQCGSL
FT                   DYTRQRAEEEADKAIAALQVLPESDYRLALEGLAHIAVQRSF"
FT   misc_feature    complement(486607..487371)
FT                   /note="Pfam match to entry PF00348
FT                   polyprenyl_synt,Polyprenyl synthetase, score 393.7, E-value
FT                   1.2e-115"
FT                   /inference="protein motif:PFAM:PF00348"
FT   misc_feature    complement(486817..486855)
FT                   /note="PS00444 Polyprenyl synthetases signature 2."
FT                   /inference="protein motif:Prosite:PS00444"
FT   misc_feature    complement(487177..487221)
FT                   /note="PS00723 Polyprenyl synthetases signature 1."
FT                   /inference="protein motif:Prosite:PS00723"
FT   CDS             487721..488032
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="YE0418"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:YE0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10544"
FT                   /db_xref="GOA:A1JIV3"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIV3"
FT                   /protein_id="CAL10544.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGEAVEFDQVLMIANGE
FT                   EINIGAPLVVGGVVKAEVVAHGRGEKIKIVKFRRRKHYRKQQGHRQWFTDVKITGISA"
FT   misc_feature    487721..488008
FT                   /note="Pfam match to entry PF00829 Ribosomal_L21p,Ribosomal
FT                   prokaryotic L21 protein, score 189.1, E-value 4.5e-54"
FT                   /inference="protein motif:PFAM:PF00829"
FT   misc_feature    487934..488002
FT                   /note="PS01169 Ribosomal protein L21 signature."
FT                   /inference="protein motif:Prosite:PS01169"
FT   CDS             488052..488309
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="YE0419"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:YE0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10545"
FT                   /db_xref="GOA:A1JIV4"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIV4"
FT                   /protein_id="CAL10545.1"
FT                   /translation="MAHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTKF
FT                   HAGIDVGCGKDHTLFALKDGKVKFEVKGPKNRKFISIEAE"
FT   misc_feature    488055..488300
FT                   /note="Pfam match to entry PF01016 Ribosomal_L27,Ribosomal
FT                   L27 protein, score 197.7, E-value 1.2e-56"
FT                   /inference="protein motif:PFAM:PF01016"
FT   misc_feature    488151..488195
FT                   /note="PS00831 Ribosomal protein L27 signature."
FT                   /inference="protein motif:Prosite:PS00831"
FT   CDS             488397..489356
FT                   /transl_table=11
FT                   /locus_tag="YE0420"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10546"
FT                   /db_xref="GOA:A1JIV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIV5"
FT                   /protein_id="CAL10546.1"
FT                   /translation="MDTKQQAGLGIFLALTTAVFWGALPIAMKQVLEVMEPYTIVWYRF
FT                   MMAAIGLGIILASRRQLPSLKLFRQRRWLVLLIVATCGLLGNFIFFSSSLQYLSPTTSQ
FT                   VIGQLSPVGMMVASVLILKERMRITQVIGAVMLICGLLLFFNTSLHELFTRMTDYTLGV
FT                   ALGVCAAVVWVSYGVAQKVLLRRMASQQILLLLYTLCAIALFPLAKPAVIFQLNGWQFA
FT                   CLLFCGVNTLVGYGALAEAMARWQAAQVSALVTLTPLFTLFFSILLALAWPDMFAAPSL
FT                   NFVGYAGAFVVVAGAMFSAIGHRWWPRRTEINRVAAQK"
FT   sig_peptide     488397..488462
FT                   /locus_tag="YE0420"
FT                   /note="Signal peptide predicted for YE0420 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.762) with cleavage site
FT                   probability 0.526 between residues 22 and 23"
FT   misc_feature    join(488415..488480,488508..488576,488613..488681,
FT                   488709..488762,488787..488846,488874..488933,
FT                   488970..489038,489048..489113,489147..489215,
FT                   489243..489311)
FT                   /note="10 probable transmembrane helices predicted for
FT                   YE0420 by TMHMM2.0 at aa 7-28, 38-60, 73-95,
FT                   105-122,131-150, 160-179, 192-214, 218-239, 251-273 and
FT                   283-305"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    488451..488834
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 105.9, E-value 5.2e-29"
FT                   /inference="protein motif:PFAM:PF00892"
FT   misc_feature    488907..489299
FT                   /note="Pfam match to entry PF00892 DUF6, Integral membrane
FT                   protein DUF6, score 48.7, E-value 8.5e-12"
FT                   /inference="protein motif:PFAM:PF00892"
FT   CDS             489388..490560
FT                   /transl_table=11
FT                   /locus_tag="YE0421"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10547"
FT                   /db_xref="GOA:A1JIV6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIV6"
FT                   /protein_id="CAL10547.1"
FT                   /translation="MKFVDEATILVVAGDGGNGCVSFRREKYIPNGGPDGGDGGDGGDI
FT                   YLLADENLNTLIDYRFVKSFRAERGENGQSRDCTGKRGKDITIKVPVGTRVLDQGTGEI
FT                   VGDMTRHGQRLMVAKGGFHGLGNTRFKSSVNRAPRQKTMGTEGETRELMLELLLLADVG
FT                   MLGLPNAGKSTFIRAVSAAKPKVADYPFTTLIPSLGVVRMDHEQSFVVADIPGLIEGAS
FT                   DGAGLGIRFLKHLERCRVLLHLVDLAPIDESDPVENAKIIINELQQYSENLAQKPRWLV
FT                   FNKIDLVGPEEAEVRAKAIVEALGWEGKYYMISAANRDNVNALCWDVMNFLNSQPKAMA
FT                   IAESAPEKVEFMWDDYHREQLAEVEAEAESEDDDDWDEEDDDGVEFIYER"
FT   misc_feature    489433..490251
FT                   /note="Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG
FT                   family, score 447.1, E-value 9.9e-132"
FT                   /inference="protein motif:PFAM:PF01018"
FT   misc_feature    489883..489906
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    490024..490065
FT                   /note="PS00905 GTP1/OBG family signature."
FT                   /inference="protein motif:Prosite:PS00905"
FT   CDS             complement(490664..491725)
FT                   /transl_table=11
FT                   /gene="basS"
FT                   /gene_synonym="pmrB"
FT                   /locus_tag="YE0422"
FT                   /product="two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10548"
FT                   /db_xref="GOA:A1JIV7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIV7"
FT                   /protein_id="CAL10548.1"
FT                   /translation="MVSMRRRLILMLALILLITQLISAFWLWHESQEQISFLVDETLSA
FT                   KVRNERVDTEIAEAIASLLAPSLIMMTITLLLSFWAISWIIRPLDQLQQKLAERSADNL
FT                   TPVVVNSDMQEIVSVTSTLNQLLSRLSNTIAQERLFTADAAHELRTPLAGIRLHLELME
FT                   QQGITESKSLISRIDLLMLTIEQLLMLSRAGQNFASGLYQTLDWIENVVQPLKEELEEM
FT                   CAQRQQSLRWEHPSDAQTQGDATLLRLMLRNLVENAHRYSPVGSQISVKLSSDAQGTLL
FT                   QVMDEGPGIKQEQAGELTQAFRRMDQRYGGSGLGLNIVIRIAQLHQGRLTLENRADRSG
FT                   LKAQCWIPATTHS"
FT   misc_feature    complement(490676..491002)
FT                   /note="Pfam match to entry PF02518 HATPase_c, Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase, score 99.1,
FT                   E-value 5.8e-27"
FT                   /inference="protein motif:PFAM:PF02518"
FT   misc_feature    complement(491138..491320)
FT                   /note="Pfam match to entry PF00512 HisKA, His Kinase A
FT                   (phosphoacceptor) domain, score 47.9, E-value 1.4e-11"
FT                   /inference="protein motif:PFAM:PF00512"
FT   misc_feature    complement(491330..491539)
FT                   /note="Pfam match to entry PF00672 HAMP, HAMP domain ,score
FT                   32.9, E-value 4.9e-07"
FT                   /inference="protein motif:PFAM:PF00672"
FT   misc_feature    complement(join(491468..491536,491639..491707))
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0422 by TMHMM2.0 at aa 7-29 and 64-86"
FT                   /inference="protein motif:TMHMM:2.0"
FT   sig_peptide     complement(491654..491725)
FT                   /gene="basS"
FT                   /gene_synonym="pmrB"
FT                   /locus_tag="YE0422"
FT                   /note="Signal peptide predicted for YE0422 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.993) with cleavage site
FT                   probability 0.628 between residues 24 and 25"
FT   CDS             complement(491725..492384)
FT                   /transl_table=11
FT                   /gene="basR"
FT                   /gene_synonym="pmrA"
FT                   /locus_tag="YE0423"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YE0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10549"
FT                   /db_xref="GOA:A1JIV8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIV8"
FT                   /protein_id="CAL10549.1"
FT                   /translation="MKLLIVEDDELLQRGIAMALTSGGYACDCAGTAAQAHSLLLSSQY
FT                   SMVILDLGLPDQDGAVLLRQWRRQHITLPVLILTARDALEDRVDGLDAGADDYLIKPFA
FT                   LAELLARVRALIRRYQGQSDNLIQQDDLSLNLSTQQVCLQGQALEVTPKEFAILSRLIM
FT                   RAGQTVNRELLQQDLYTWNDDLGSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLEAP"
FT   misc_feature    complement(491746..491949)
FT                   /note="Pfam match to entry PF00486
FT                   trans_reg_C,Transcriptional regulatory protein, C terminal,
FT                   score 73.8, E-value 2.4e-19"
FT                   /inference="protein motif:PFAM:PF00486"
FT   misc_feature    complement(492025..492384)
FT                   /note="Pfam match to entry PF00072 response_reg, Response
FT                   regulator receiver domain, score 133.5, E-value 2.5e-37"
FT                   /inference="protein motif:PFAM:PF00072"
FT   misc_feature    complement(492304..492336)
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(492390..493838)
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="YE0424"
FT                   /product="penicillin-binding protein 4 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10550"
FT                   /db_xref="GOA:A1JIV9"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIV9"
FT                   /protein_id="CAL10550.1"
FT                   /translation="MHFSRIVSGLACAIAINISISNANAAQVENYTQYLPDGANLALVV
FT                   QKIGATTPAIDYHAQQMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTISDGILRG
FT                   NLIARFDGDPTLTRQQLRNMVATLRKSGVKQIAGDLIIDTSVFASHDKAPGWPWNDMTQ
FT                   CFSAPPAAAIVDRNCFSVSLYSAPNPGDMAFIRVASYYPVQMFSEVRTLAKGSPDAQYC
FT                   ELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGSLRR
FT                   QTTPNAAGTVLAQAQSAPLHDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRAGADA
FT                   VRQVLRQKAGVDLGNSIVVDGSGLSRHNLISPATMMQALQYIAQHDQELNFISMLPLSG
FT                   YDGTLRYRGGLHEAGVDGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPE
FT                   DQKNRRAPLVRFESRLYKDIYQNN"
FT   misc_feature    complement(492486..493646)
FT                   /note="Pfam match to entry PF02113
FT                   Peptidase_S13,D-Ala-D-Ala carboxypeptidase 3 (S13) family,
FT                   score 676.7,E-value 7.8e-201"
FT                   /inference="protein motif:PFAM:PF02113"
FT   sig_peptide     complement(493764..493838)
FT                   /gene="dacB"
FT                   /locus_tag="YE0424"
FT                   /note="Signal peptide predicted for YE0424 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 0.948 between residues 25 and 26"
FT   CDS             494097..494573
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="YE0425"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:YE0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10551"
FT                   /db_xref="GOA:A1JIW0"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW0"
FT                   /protein_id="CAL10551.1"
FT                   /translation="MKQIPMTVNGAEKLREELDYLKGVRRPKIIADIATAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEAKLSNAQVIDITKMPNNGRVIFGATVRVLNVVSEEEQQ
FT                   YRIVGDDEADFKQNLISVNSPIARGLIGKEVDDVVVIRTPGGEVEYEILTVDYV"
FT   misc_feature    494097..494318
FT                   /note="Pfam match to entry PF03449 GreA_GreB_N,Prokaryotic
FT                   transcription elongation factor, GreA/GreB,N-terminal
FT                   domain, score 165.0, E-value 8.3e-47"
FT                   /inference="protein motif:PFAM:PF03449"
FT   misc_feature    494115..494240
FT                   /note="PS00829 Prokaryotic transcription elongation factors
FT                   signature 1."
FT                   /inference="protein motif:Prosite:PS00829"
FT   misc_feature    494334..494567
FT                   /note="Pfam match to entry PF01272 GreA_GreB, Prokaryotic
FT                   transcription elongation factor, GreA/GreB, C-terminal
FT                   domain, score 151.8, E-value 7.7e-43"
FT                   /inference="protein motif:PFAM:PF01272"
FT   misc_feature    494457..494507
FT                   /note="PS00830 Prokaryotic transcription elongation factors
FT                   signature 2."
FT                   /inference="protein motif:Prosite:PS00830"
FT   CDS             complement(494702..494995)
FT                   /transl_table=11
FT                   /locus_tag="YE0426"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10552"
FT                   /db_xref="GOA:A1JIW1"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW1"
FT                   /protein_id="CAL10552.1"
FT                   /translation="MNLNNKQKQHLKSLAHPLKPVVMLGNNGLTEGVLAEIEQTLEHHE
FT                   LIKVKITAEERETKALIADAIVRETGAVNVQIIGNILVLYRPAKERKIILPR"
FT   misc_feature    complement(494738..494950)
FT                   /note="Pfam match to entry PF01985 UPF0044,Uncharacterised
FT                   protein family UPF0044, score 28.7,E-value 8.8e-06"
FT                   /inference="protein motif:PFAM:PF01985"
FT   CDS             495142..495771
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /gene_synonym="rrmJ"
FT                   /gene_synonym="mrsF"
FT                   /locus_tag="YE0427"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /db_xref="EnsemblGenomes-Gn:YE0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10553"
FT                   /db_xref="GOA:A1JIW2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIW2"
FT                   /protein_id="CAL10553.1"
FT                   /translation="MSNKKRSASSSRWLQEHFSDKYVIQAQKKGLRSRAWFKLDEIQQS
FT                   DKLFKPGMTVVDLGAAPGGWSQYVVTQIGGKGRVIACDLLPMDPIVGVDFLQGDFRDEL
FT                   VLKALLERVGDKKVQVVMCDMAPNMSGTPAVDIPKSMYLVELALDMCRDVLAPGGSFLV
FT                   KVFQGDGFDEYLREIRSLFTKVKIRKPDASRARSREVYIVATGRKL"
FT   misc_feature    495232..495768
FT                   /note="Pfam match to entry PF01728 FtsJ, FtsJ-like
FT                   methyltransferase, score 274.1, E-value 1.2e-79"
FT                   /inference="protein motif:PFAM:PF01728"
FT   CDS             495828..497762
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /gene_synonym="mrsC"
FT                   /gene_synonym="tolZ"
FT                   /locus_tag="YE0428"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10554"
FT                   /db_xref="GOA:A1JIW3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW3"
FT                   /protein_id="CAL10554.1"
FT                   /translation="MAKNLILWLVIAVVLMSVFQSFGPSESNGRRVDYSTFMSDVTQDQ
FT                   VREARINGREINVSKKDNSKYTTFIPVNDPKLLDTLLTKNVKVVGEPPEEPSLLASIFI
FT                   SWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTSFADVAGCDEAKEE
FT                   VSELVEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFV
FT                   EMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVE
FT                   MDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPL
FT                   DIDIDASVIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERR
FT                   SMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAISAS
FT                   RQKLESQISTLYGGRLAEEIIYGPEKVSTGASNDIKVATSIARNMVTQWGFSEKLGPLL
FT                   YAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKLLIERNYQRARKLLLENMDVLHSMKD
FT                   ALMKYETIDAPQIDDLMNRKEVRPPAGWDDANKTKSTDNDSTPKAPTPVDEPHTPTPGN
FT                   TMSEQLGDK"
FT   sig_peptide     495828..495896
FT                   /gene="ftsH"
FT                   /gene_synonym="hflB"
FT                   /gene_synonym="mrsC"
FT                   /gene_synonym="tolZ"
FT                   /locus_tag="YE0428"
FT                   /note="Signal peptide predicted for YE0428 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.961) with cleavage site
FT                   probability 0.634 between residues 23 and 24"
FT   misc_feature    join(495840..495899,496116..496184)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0428 by TMHMM2.0 at aa 5-24 and 97-119"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    496215..496238
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    496386..496949
FT                   /note="Pfam match to entry PF00004 AAA, ATPase family
FT                   associated with various cellular activities (AAA), score
FT                   332.4, E-value 3.4e-97"
FT                   /inference="protein motif:PFAM:PF00004"
FT   misc_feature    496401..496424
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    496698..496754
FT                   /note="PS00674 AAA-protein family signature."
FT                   /inference="protein motif:Prosite:PS00674"
FT   misc_feature    496965..497603
FT                   /note="Pfam match to entry PF01434 Peptidase_M41,Peptidase
FT                   family M41, score 437.2, E-value 9.5e-129"
FT                   /inference="protein motif:PFAM:PF01434"
FT   CDS             497847..498680
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /gene_synonym="dhpS"
FT                   /locus_tag="YE0429"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10555"
FT                   /db_xref="GOA:A1JIW4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW4"
FT                   /protein_id="CAL10555.1"
FT                   /translation="MHLTARDRVLDLTRPQVMGILNVTPDSFSDGGHHNNLDKALQHAE
FT                   LMLSAGATLIDIGGESTRPGAAHVSEQEELDRVVPVVEALAKRFDVWLSVDTSKAAVIT
FT                   ESARAGAHLINDIRSLQEPDALEAAAKTGLPVCLMHMQGQPQSMQQSPHYDDLMADVNQ
FT                   FFKHHIDRCIAAGIAKSKLLLDPGFGFGKNLAHNYQLLARLAELHHFELPLLVGMSRKS
FT                   MVGQLLNVPPQQRVIGSVACAVIAAMQGAQIVRVHDVKETVEAMRVVEATLSAKG"
FT   misc_feature    497895..497942
FT                   /note="PS00792 Dihydropteroate synthase signature 1."
FT                   /inference="protein motif:Prosite:PS00792"
FT   misc_feature    497904..498629
FT                   /note="Pfam match to entry PF00809 Pterin_bind, Pterin
FT                   binding enzyme, score 400.9, E-value 8.1e-118"
FT                   /inference="protein motif:PFAM:PF00809"
FT   misc_feature    497997..498038
FT                   /note="PS00793 Dihydropteroate synthase signature 2."
FT                   /inference="protein motif:Prosite:PS00793"
FT   CDS             498690..500030
FT                   /transl_table=11
FT                   /gene="mrsA"
FT                   /locus_tag="YE0430"
FT                   /product="probable phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10556"
FT                   /db_xref="GOA:A1JIW5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIW5"
FT                   /protein_id="CAL10556.1"
FT                   /translation="MSDRKYFGTDGIRGKVGDSPITPDFVLKLGWAAGKVLARHGSRKI
FT                   IIGKDTRISGYMLESALEAGLAAAGLSASFTGPMPTPAVAYLTRTFRAEAGIVISASHN
FT                   PFYDNGIKFFSIDGTKLPDDVEEAIEAEMEKPLTCVESAELGKANRIVDAAGRYIEFCK
FT                   GTFPSELSLNELKIVVDCANGATYHIAPSVLRELGATVITIGCEPDGMNINEKCGATDV
FT                   RLLQERVLAEKADVGLAFDGDGDRLMMVDHLGNKVDGDQILYIIAREGLRQGQLKGGAV
FT                   GTLMSNMGLQLALKELGIPFVRAKVGDRYVLEAMQEKGWRIGAENSGHVILLDKTTTGD
FT                   GIVAGLQVLTAMVRNHMTLHDLCSGMKLLPQILVNVRFSGDHNPLKSENVEEVTRQVEK
FT                   ELGDRGRVLLRKSGTEPLIRVMVEGDDAESVIAEMANRIADAVKAAG"
FT   misc_feature    498690..499121
FT                   /note="Pfam match to entry PF02878
FT                   PGM_PMM_I,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain I, score 212.3, E-value 4.6e-61"
FT                   /inference="protein motif:PFAM:PF02878"
FT   misc_feature    498975..499019
FT                   /note="PS00710 Phosphoglucomutase and phosphomannomutase
FT                   phosphoserine signature."
FT                   /inference="protein motif:Prosite:PS00710"
FT   misc_feature    499155..499457
FT                   /note="Pfam match to entry PF02879
FT                   PGM_PMM_II,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II, score 167.6, E-value 1.3e-47"
FT                   /inference="protein motif:PFAM:PF02879"
FT   misc_feature    499461..499796
FT                   /note="Pfam match to entry PF02880
FT                   PGM_PMM_III,Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III, score 143.2, E-value 3e-40"
FT                   /inference="protein motif:PFAM:PF02880"
FT   misc_feature    499806..500021
FT                   /note="Pfam match to entry PF00408
FT                   PGM_PMM,Phosphoglucomutase/phosphomannomutase, C-terminal
FT                   domain ,score 53.0, E-value 4.3e-13"
FT                   /inference="protein motif:PFAM:PF00408"
FT   CDS             500254..500589
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="YE0431"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10557"
FT                   /db_xref="GOA:A1JIW6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW6"
FT                   /protein_id="CAL10557.1"
FT                   /translation="MYEALLVIFLLISIGLVALIMLQQGKGADMGASFGAGASATLFGS
FT                   NGSGNFMTRMTAVLAALFFVISLILGNMSTNQGNKGSEWENLGQPAKAEQTTAPVAPTK
FT                   PSSDIPQ"
FT   sig_peptide     500254..500433
FT                   /gene="secG"
FT                   /locus_tag="YE0431"
FT                   /note="Signal peptide predicted for YE0431 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.897) with cleavage site
FT                   probability 0.404 between residues 60 and 61"
FT   misc_feature    500257..500478
FT                   /note="Pfam match to entry PF03840 SecG, Preprotein
FT                   translocase SecG subunit, score 121.4, E-value 1.1e-33"
FT                   /inference="protein motif:PFAM:PF03840"
FT   misc_feature    join(500266..500319,500404..500463)
FT                   /note="2 probable transmembrane helices predicted for
FT                   YE0431 by TMHMM2.0 at aa 5-22 and 51-70"
FT                   /inference="protein motif:TMHMM:2.0"
FT   tRNA            500681..500767
FT                   /gene="tRNA-Leu (GAG)"
FT                   /product="transfer RNA-Leu (GAG)"
FT   tRNA            500828..500904
FT                   /gene="tRNA-Met (CAT)"
FT                   /product="transfer RNA-Met (CAT)"
FT   CDS             501114..501572
FT                   /transl_table=11
FT                   /locus_tag="YE0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10558"
FT                   /db_xref="GOA:A1JIW7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIW7"
FT                   /protein_id="CAL10558.1"
FT                   /translation="MGLSTLEQKLTEIISAPVEALGYELVGIEFIRGRQSTLRIYIDSD
FT                   DGITVDACADVSHQVSAVLDVEDPITVAYNLEVSSPGLERPMFTAEHYTRYLGEEVTLV
FT                   LRMAMQNRRKWQGIIKAVDGEMITVTVDGKDEVFALSNIQKANLVPHF"
FT   misc_feature    501150..501557
FT                   /note="Pfam match to entry PF02576 DUF150, Uncharacterized
FT                   BCR, YhbC family COG0779, score 260.0, E-value 2.1e-75"
FT                   /inference="protein motif:PFAM:PF02576"
FT   CDS             501594..503081
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="YE0433"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10559"
FT                   /db_xref="GOA:A1JIW8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIW8"
FT                   /protein_id="CAL10559.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEV
FT                   RVSIDRKTGDFDTFRRWVAVDEVTMPTREITLEAAQYEDPSLQLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVEQFRQYLGEIVTGTVKKVNRDSIALDLGNNAEAVIN
FT                   REDMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRPEMLIELFRIEVPEIGEELIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT
FT                   ADDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSSLEELAYVPMKELLEIDGLD
FT                   EDTVEALRDRAKAALTTLALAQEESLGDQKPADDLLNLAGLERSMAFKLAARGVCTLED
FT                   LAEQGIDDLADIEGLSDEQAGELIMAARNICWFGDNA"
FT   misc_feature    501984..502187
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 42.8, E-value 5e-10"
FT                   /inference="protein motif:PFAM:PF00575"
FT   CDS             503106..505784
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /gene_synonym="ssyG"
FT                   /locus_tag="YE0434"
FT                   /product="translation initiation factor IF2-2"
FT                   /db_xref="EnsemblGenomes-Gn:YE0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10560"
FT                   /db_xref="GOA:A1JIW9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIW9"
FT                   /protein_id="CAL10560.1"
FT                   /translation="MTDVTVKSLADEIQTPVDRLVQQFADAGIKKSEVDSVTQQEKETL
FT                   LAHLNREHGSAPNKLTLQRKTRSTLNIPSTGGKSKSVQIEVRKKRTYVNTPEAEQAKAE
FT                   EQAQREAEEQAQREAEAAAQKIAEEKAKRAAEEQAKREAAEKAKRQAAEKEKVTNQQTD
FT                   EKTKPAQTDKARREAEAAELKRSVEEETRRKVEEDAKRVAEEARKMAAENEGKWPEPVA
FT                   EQTESADYHVTTSQHARAAEDENDAKVEGDRRSRTRGGKATKQKKGNKLSESKADREEA
FT                   RAVGRKGKRKPSTLQQSFNKPVVAVNRDVVIGETVTVAELANKMAVKGSQVIKAMMKLG
FT                   AMATINQVIDQETAQLVAEEMGHKVILRRENELEEALMSDRDTGAEAAAEHRAPVVTIM
FT                   GHVDHGKTSLLDYIRSTKVASGEAGGITQHIGAYHVETENGMITFLDTPGHAAFTSMRA
FT                   RGAQATDIVVLVVAADDGVMPQTIEAIQHAKAANVPVVVAVNKIDKPAADPNRVKTELI
FT                   QHGIISEDFGGDVPFIEVSAKVGTGIDDLLQAILLQAEVMELKAVRTGMASGVVIESFL
FT                   DKGRGPVATVLVQQGTLNKGDIVLCGFEYGRVRAMRDELGRDITSAGPSIPVEILGLSS
FT                   VPAAGDEVTVVRDEKKAREVALYRQGKFREVKLARQQKSKLENMFANMTEGEVSELNIV
FT                   IKSDVQGSCEAICDSLEKLSTDEVKVRIVGSGVGGITETDATLAAASGAIILGFNVRAD
FT                   ASARRVVETEGLDLRYYSVIYSLIDEVKQAMSGMLAPEYKQQIIGLAEVRDVFKSPKFG
FT                   AIAGCMVTEGVIKRNNPIRVLRDNVVIYEGELESLRRFKDDVNEVRNGMECGIGVKNYN
FT                   DVRTGDVIEVFEIIEIKRTIA"
FT   misc_feature    504276..504779
FT                   /note="Pfam match to entry PF00009 GTP_EFTU, Elongation
FT                   factor Tu GTP binding domain, score 186.1, E-value 3.7e-53"
FT                   /inference="protein motif:PFAM:PF00009"
FT   misc_feature    504303..504326
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    504810..505037
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 65.2, E-value 8.9e-17"
FT                   /inference="protein motif:PFAM:PF03144"
FT   misc_feature    505512..505745
FT                   /note="Pfam match to entry PF03144 GTP_EFTU_D2, Elongation
FT                   factor Tu domain 2, score 58.4, E-value 1e-14"
FT                   /inference="protein motif:PFAM:PF03144"
FT   misc_feature    505629..505697
FT                   /note="PS01176 Initiation factor 2 signature."
FT                   /inference="protein motif:Prosite:PS01176"
FT   CDS             505851..506261
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /gene_synonym="p15B"
FT                   /locus_tag="YE0435"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10561"
FT                   /db_xref="GOA:A1JIX0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIX0"
FT                   /protein_id="CAL10561.1"
FT                   /translation="MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRD
FT                   LAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDN
FT                   SLIEGMRMSNLVTNVIKNDVERQVNPGSDEEK"
FT   misc_feature    505869..506198
FT                   /note="Pfam match to entry PF02033 RBFA, Ribosome-binding
FT                   factor A, score 182.1, E-value 5.9e-52"
FT                   /inference="protein motif:PFAM:PF02033"
FT   misc_feature    506094..506159
FT                   /note="PS01319 Ribosome-binding factor A signature."
FT                   /inference="protein motif:Prosite:PS01319"
FT   CDS             506261..507250
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /gene_synonym="p35"
FT                   /locus_tag="YE0436"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:YE0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10562"
FT                   /db_xref="GOA:A1JIX1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIX1"
FT                   /protein_id="CAL10562.1"
FT                   /translation="MGRPRRRGRDINGVLLLDKPLGLSSNDVLQKVKRLFSANRAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDSDKRYRVVARLGQRTDTSDAEGALISEREVNVT
FT                   QAQMDAALDSFRGSSQQVPSMYSALKHQGKPLYEYARQGIEVEREARSITVYELLFIRW
FT                   EGNDLELEIHCSKGTYIRTIIDDLGELLGCGAHVSYLRRLQVATYPSDRMVTLEQLTAI
FT                   VETAQAEERSPNAELDALLLPMDSAVLNFPEVNLLPAVAAYVKQGQPVHVAGTPGEGMV
FT                   RITEGEERNFIGIGTIAEDGRVAPKRLVVEHVDGANPVVAGVAAGNTP"
FT   misc_feature    506348..506800
FT                   /note="Pfam match to entry PF01509 TruB_N, TruB family
FT                   pseudouridylate synthase (N terminal domain), score 308.8,
FT                   E-value 4.4e-90"
FT                   /inference="protein motif:PFAM:PF01509"
FT   misc_feature    506705..506746
FT                   /note="PS01109 Ribosomal protein L10 signature."
FT                   /inference="protein motif:Prosite:PS01109"
FT   misc_RNA        507310..507428
FT                   /note="Ribosomal S15 leader (RF00114) as predicted by Rfam,
FT                   score 81.93, positions 1 to 119"
FT   CDS             507372..507641
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /gene_synonym="secC"
FT                   /locus_tag="YE0437"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:YE0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10563"
FT                   /db_xref="GOA:A1JIX2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIX2"
FT                   /protein_id="CAL10563.1"
FT                   /translation="MSLSVEAKAKIVADFGRDANDTGSSEVQVALLTAQINHLQGHFSE
FT                   HKKDHHSRRGLLRMVSTRRKLLDYLKRKDVASYVSLIERLGLRR"
FT   misc_feature    507375..507635
FT                   /note="Pfam match to entry PF00312 Ribosomal_S15,Ribosomal
FT                   protein S15, score 160.0, E-value 2.7e-45"
FT                   /inference="protein motif:PFAM:PF00312"
FT   misc_feature    507486..507578
FT                   /note="PS00362 Ribosomal protein S15 signature."
FT                   /inference="protein motif:Prosite:PS00362"
FT   misc_RNA        complement(507658..507838)
FT                   /note="SraG RNA (RF00082) as predicted by Rfam, score
FT                   69.23, positions 1 to 176"
FT   CDS             507904..510024
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="YE0438"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10564"
FT                   /db_xref="GOA:A1JIX3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIX3"
FT                   /protein_id="CAL10564.1"
FT                   /translation="MLTPIIRKFQYGQHTVTIETGMMARQATAAVMVSMDDTAVFVTVV
FT                   GQKKAKPGQSFFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLTSRLIDRPIRPLFP
FT                   DSFLNEVQVIATVVSVNPQINPDIVALIGASAALSLSGIPFNGPIGAARVGFINDQYVL
FT                   NPTTDELKESRLDLVVAGTAGAVLMVESEADILSEDQMLGAVVFGHEQQQVVIENINAL
FT                   VAEAGKPKWDWHAEPVNEALHARVAELAAARLGDAYRITEKQERYTQVDAIKADVTEAL
FT                   LAQDDTLDAAEIQDILGSVEKDVVRSRVLRGEPRIDGREKDMIRGLDVRTGVLPRTHGS
FT                   ALFTRGETQALVTATLGTARDAQNIDELMGERTDSFLLHYNFPPYSVGETGMVGSPKRR
FT                   EIGHGRLAKRGVLAVMPSPSEFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIK
FT                   AAVAGIAMGLVKEDENFVVLSDILGDEDHLGDMDFKVAGSRDGITALQMDIKIEGITRE
FT                   IMQVALNQAKGARLHILGVMEQAISTPRGDISEFAPRIYTMKINPEKIKDVIGKGGSVI
FT                   RALTDETGTTIEIEDDGTIKIAATDGDKAKHAIRRIEEITAEIEVNRIYAGKVTRIVDF
FT                   GAFVAIGGGKEGLVHISQIADKRVDKVTDYLQMGQEVPVKVIEVDRQGRIRLSMKEATT
FT                   PDAEAPAPEAAE"
FT   misc_feature    507937..508335
FT                   /note="Pfam match to entry PF01138 RNase_PH, 3'
FT                   exoribonuclease family, domain 1, score 157.5, E-value
FT                   1.5e-44"
FT                   /inference="protein motif:PFAM:PF01138"
FT   misc_feature    508342..508536
FT                   /note="Pfam match to entry PF03725 RNase_PH_C, 3'
FT                   exoribonuclease family, domain 2, score 71.3, E-value
FT                   1.3e-18"
FT                   /inference="protein motif:PFAM:PF03725"
FT   misc_feature    508627..508863
FT                   /note="Pfam match to entry PF03726
FT                   PNPase,Polyribonucleotide nucleotidyltransferase, RNA
FT                   binding domain, score 135.3, E-value 6.9e-38"
FT                   /inference="protein motif:PFAM:PF03726"
FT   misc_feature    508870..509271
FT                   /note="Pfam match to entry PF01138 RNase_PH, 3'
FT                   exoribonuclease family, domain 1, score 184.0, E-value
FT                   1.5e-52"
FT                   /inference="protein motif:PFAM:PF01138"
FT   misc_feature    509278..509490
FT                   /note="Pfam match to entry PF03725 RNase_PH_C, 3'
FT                   exoribonuclease family, domain 2, score 83.3, E-value
FT                   3.2e-22"
FT                   /inference="protein motif:PFAM:PF03725"
FT   misc_feature    509572..509712
FT                   /note="Pfam match to entry PF00013 KH, KH domain, score
FT                   47.1, E-value 2.6e-11"
FT                   /inference="protein motif:PFAM:PF00013"
FT   misc_feature    509755..509973
FT                   /note="Pfam match to entry PF00575 S1, S1 RNA binding
FT                   domain, score 100.5, E-value 2.1e-27"
FT                   /inference="protein motif:PFAM:PF00575"
FT   CDS             510147..511031
FT                   /transl_table=11
FT                   /gene="nlpI"
FT                   /locus_tag="YE0439"
FT                   /product="lipoprotein NlpI"
FT                   /db_xref="EnsemblGenomes-Gn:YE0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10565"
FT                   /db_xref="GOA:A1JIX4"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX4"
FT                   /protein_id="CAL10565.1"
FT                   /translation="MKPFLRWCYVVTALMLAGCSNHDWRKDEVLAIPLQPTLQQEVILA
FT                   RMEQILASRALTDDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGI
FT                   YLTQAGNFDAAYEAFDSVLELDPTYNYARLNRGIALYYGGRLPLAQDDLQAFYQDDPND
FT                   PFRSLWLYLVEREIDPKTAAVALQQRYEKSDRGQWGWNIVEFYLGTISEKTLMERLKAD
FT                   ATDNTSLAEHLSETDFYLGKHYLSLGDKDTASALFKLTVANNVHNFVEHRYALLELALL
FT                   GQEQDDLSESDQQ"
FT   misc_feature    510171..510203
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    510330..510431
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   26.1, E-value 5.4e-05"
FT                   /inference="protein motif:PFAM:PF00515"
FT   misc_feature    510432..510533
FT                   /note="Pfam match to entry PF00515 TPR, TPR Domain, score
FT                   32.6, E-value 5.7e-07"
FT                   /inference="protein motif:PFAM:PF00515"
FT   CDS             511217..513190
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /gene_synonym="csdA"
FT                   /gene_synonym="mssB"
FT                   /locus_tag="YE0440"
FT                   /product="cold-shock dead-box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YE0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10566"
FT                   /db_xref="GOA:A1JIX5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR021046"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX5"
FT                   /protein_id="CAL10566.1"
FT                   /translation="MTTELETSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNGR
FT                   DVLGMAQTGSGKTAAFGLPLLHNIDPSLKAPQVLVLAPTRELAIQVAEALSSFSKHMNG
FT                   VNVVALYGGQRYDVQLRALRQGPQVVVGTPGRLLDHLKRGTLNLSNLSGLVLDEADEML
FT                   RMGFIEDVENILAQIPAEHQTALFSATMPEAIRRITRRFMKEPQEVRIQSSMTTRPDIS
FT                   QSYWVVDGVRKNDALVRFLEAEDFDAAIIFVRTKNATLEVAEALERSGYNSAALNGDMN
FT                   QAAREQTLERLKNGRLDILIATDVAARGLDVERISLVVNYDIPMDSESYVHRIGRTGRA
FT                   GRAGRALLFVDRRERRLLQNIERTMKMTIPPVQLPNAELLGERRLAKFAAKVGQQLESS
FT                   DLDMYRALLAKLQPEEEFDIETLAAALLKMAQGERPLILPPEAPRRPQREFNTRDDRGS
FT                   DRGRDRNDSRREPRSDSRDGGERPARRERRDVGEMELYRIEVGRDDGVEVRHIVGAIAN
FT                   EGDISSRYIGNIKLFASHSTIELPKGMPGEMLSHFTRTRILNKPLNMQLLGDAQPHERR
FT                   ERPAGGNGGERRGGGAGRSFGGERRDGAAGAPPRRSFGSDRAPAGAGEQRRGNRDGQRP
FT                   AAPRRDDAAAPAAPARRRFGDA"
FT   misc_feature    511274..511888
FT                   /note="Pfam match to entry PF00270 DEAD, DEAD/DEAH box
FT                   helicase, score 300.5, E-value 1.3e-87"
FT                   /inference="protein motif:PFAM:PF00270"
FT   misc_feature    511367..511390
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    511679..511705
FT                   /note="PS00039 DEAD-box subfamily ATP-dependent helicases
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00039"
FT   misc_feature    512024..512239
FT                   /note="Pfam match to entry PF00271 helicase_C, Helicase
FT                   conserved C-terminal domain, score 121.5, E-value 1e-33"
FT                   /inference="protein motif:PFAM:PF00271"
FT   misc_feature    512666..512920
FT                   /note="Pfam match to entry PF03880 DbpA, DbpA RNA binding
FT                   domain, score 144.0, E-value 1.8e-40"
FT                   /inference="protein motif:PFAM:PF03880"
FT   CDS             513550..513822
FT                   /transl_table=11
FT                   /locus_tag="YE0441"
FT                   /product="putative lipoprotein"
FT                   /note="no significant database hits"
FT                   /db_xref="EnsemblGenomes-Gn:YE0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10567"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX6"
FT                   /protein_id="CAL10567.1"
FT                   /translation="MKAYMLVIPLFSFVLTACSTPVTSLNNEDLCAKLAEGEYFKNNWI
FT                   WDPAFKEYQDRKTKGTISVEQCETIKAQNIASFAKKDAEAEVESD"
FT   misc_feature    513571..513603
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             complement(514238..515260)
FT                   /transl_table=11
FT                   /locus_tag="YE0442"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10568"
FT                   /db_xref="GOA:A1JIX7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX7"
FT                   /protein_id="CAL10568.1"
FT                   /translation="MTDKKTVPLSVLDLSPIAQGNTPQDAFHASLDLAQHAEKWGYHRY
FT                   WLAEHHNMTGIASAATSVLIGYIAGGTSTIRVGSGGVMLPNHSPLVIAEQFGTLASLYP
FT                   GRIDLGLGRAPGTDQRTMMALRRHLSGEVDNFPSDVRELQNYFAEVQPGQAVQAVPGQG
FT                   LHVPLWLLGSSLYSAQLAAAMGLPFAFASHFAPDMLLQALKLYRENFKPSAQWPQPYAI
FT                   VCVNVVAADSERDARFLFTSMQQQFVNLRRGTPGQLPPPVEDMEKICSPAEQFGIDQAL
FT                   RLSIIGDKSKVRHGLQSLLRETQADELMVNGQIFDHQARLYSFEIVASLQQDLQPGEHL
FT                   "
FT   misc_feature    complement(514337..515233)
FT                   /note="Pfam match to entry PF00296
FT                   bac_luciferase,Luciferase-like monooxygenase, score 119.0,
FT                   E-value 6e-33"
FT                   /inference="protein motif:PFAM:PF00296"
FT   CDS             515727..516887
FT                   /transl_table=11
FT                   /locus_tag="YE0443"
FT                   /product="multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10569"
FT                   /db_xref="GOA:A1JIX8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX8"
FT                   /protein_id="CAL10569.1"
FT                   /translation="MRSKIILACLVFTLVACDQSSSPSATPSLKEVGVVTLKTEPVTLS
FT                   SDLSGRTVAVMASEVRPQVDGIIKKRLFTEGAEVSAGQVLYQIDPASYQAAYDTAKAAL
FT                   QNVQVSVKSAKLKAQRYAALAKENGVSQQDADDAQTSYQQALANVAEKTAALETARINL
FT                   AYTQVRAPISGRIGISSVTPGALVTANQTTALATIRNLDPIYVDLTQSSAQLLALRKQQ
FT                   QAGNETVVNAPVQLTLEDGSVYAHEGSLQLAEVAVDEATGAVTLRAEFPNPEHQLLPGM
FT                   FVRASVRNSVNNAAILAPQQGITHDAKGHAIALVVNQQQQVERREVVTERAIDNYWLIN
FT                   SGLVAGERLIVEGTEKVSVGDEVRPVEVSTRLPVVVESATPSTGEK"
FT   sig_peptide     515727..515801
FT                   /locus_tag="YE0443"
FT                   /note="Signal peptide predicted for YE0443 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.391 between residues 25 and 26"
FT   misc_feature    515745..515777
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    515892..516779
FT                   /note="Pfam match to entry PF00529 HlyD, HlyD family
FT                   secretion protein, score 220.7, E-value 1.4e-63"
FT                   /inference="protein motif:PFAM:PF00529"
FT   CDS             516891..520016
FT                   /transl_table=11
FT                   /locus_tag="YE0444"
FT                   /product="multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10570"
FT                   /db_xref="GOA:A1JIX9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIX9"
FT                   /protein_id="CAL10570.1"
FT                   /translation="MFARFFIHRPVFAWVIAIVIMLGGAVAMQTLPIAQYPDVAPPSVS
FT                   IKATYTGASAETLENSVTQVIEQELTGLDGLLYFSSSSSSDGKANIVATFKQGTNADTA
FT                   QVQVQNKVQQALTRLPTEVQSQGVTVTKSQTNFLLIMALYDEKDKHTGTDIADYMVSNL
FT                   QDPLARLEGVGSVQVFGSQYAMRIWLNPTKLAAYSLMPSDIQTAIEAQNTQVSAGKIGA
FT                   LPSGKEQQLTATVMAQSRLKTPEQFNNIIVKSDSTGAVVRLSDVARVELGNEDYSVTTR
FT                   LNGHPAAGIAVMLAPGANALATAERVKAKAAEFELSLPDGYKIAYPKDSTDFIKVSVEE
FT                   VVKTLIEAILLVVIVMYVFLQNIRATLIPAIAVPVVLLGTFGVLAIFGYSINTLTLFGM
FT                   VLSIGLLVDDAIVVVENVERVMREDNLPPREATEKSMGEISSALVGIALVLSAVFLPMA
FT                   FFGGATGVIYRQFSITIVSAMALSVLVALTLTPALCAAFLKPNHKPPSNTGFFGWFNRH
FT                   YDRMQTRYESMVGNVIHRSLRYLLIYAVLIVVMGILFIRLPTGFLPTEDQGDVMVQYTL
FT                   PAGATSGRTMEVSKAVENYFLTQEKDNTKAVFTISGFGFSGSGQNAGMAFIALKNWSER
FT                   PGSENTATAIADRAMKALSIIRDAQIFSMTPPAVDGLGQSNGFTFELQAAGDTSREQLL
FT                   TLRDQLIGNASKDPILTSVRANTLQQMPQLQVDIDNDKAAALGLSISDVNATLSAAWGG
FT                   TYINDFIDRGRVKKVYMQGDVDSRSKPEDINQWFVRGSSDAMTSFSAFATTRWIYGPET
FT                   LSRYNGQASYEIQGQAASGSSSGTAMDRMEKLAAELPGTSYSWSGLSYQERLASGQALS
FT                   LYAISILVVFLCLAALYESWSVPFSVMMVIPLGIIGAVAAATLRGLENDIYFQVALLTT
FT                   LGLASKNAILIVEFAEAAYLRGEPLVAAALQGAATRLRPILMTSLAFVAGVMPLAISTG
FT                   AGANSRISIGSGIIGGTLTATALAVFFVPLFFVLIRRVFSGKSKKTTEHKGV"
FT   sig_peptide     516891..516971
FT                   /locus_tag="YE0444"
FT                   /note="Signal peptide predicted for YE0444 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.990) with cleavage site
FT                   probability 0.690 between residues 27 and 28"
FT   misc_feature    516894..519965
FT                   /note="Pfam match to entry PF00873 ACR_tran,AcrB/AcrD/AcrF
FT                   family, score 1634.1, E-value 0"
FT                   /inference="protein motif:PFAM:PF00873"
FT   misc_feature    join(516903..516971,517911..517970,517989..518057,
FT                   518067..518135,518205..518273,518316..518384,
FT                   518508..518576,518709..518777,519495..519563,
FT                   519573..519641,519798..519866,519894..519962)
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0444 by TMHMM2.0 at aa 5-27, 341-360, 367-389,
FT                   393-415,439-461, 476-498, 540-562, 607-629, 869-891,
FT                   895-917,970-992 and 1002-1024"
FT                   /inference="protein motif:TMHMM:2.0"
FT   CDS             520018..521424
FT                   /transl_table=11
FT                   /gene="ibeB"
FT                   /locus_tag="YE0445"
FT                   /product="probable outer membrane efflux lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10571"
FT                   /db_xref="GOA:A1JIY0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY0"
FT                   /protein_id="CAL10571.1"
FT                   /translation="MFSRILTLLLPVLLAGCISLDPDYQRPAAPVPATLPYSAASSGTA
FT                   ADIPWQETVTEPKLRQVITLALGSNRDLRQAIADIEAARAQYGVQRAAQMPTVNAGVEG
FT                   SRGRSLSDTSDGNNNTAISQSYGAEISVSAFELDLFGKKRSLSRAEFETYLATEEAAKT
FT                   TRITLIADTATAWVTLAADQNQLLLAEETLNSAAQSLKLAQLRQKNGVASRIDVVAMET
FT                   LYQSARADVAQYKTTVAQDKNALDLLVGQPVPTNLLPTAAATLPQVIKAVPVGLSSDVL
FT                   LNRPDVLAAEHKLKSANANIGAARAAFFPSVTLTASGGVGSSALATLLREGAGIWSFAP
FT                   AITLPIFDGGANQAALDYSQAQKNGYIAAYEKAIQTAFKEVADALARKTTIQEQLAAQQ
FT                   AYVAAAQESFELAQKRYKQGIDTYLNMLDAQRTLYSAQASLITVQQTQANNMITLYKVL
FT                   GGGISDASKD"
FT   sig_peptide     520018..520074
FT                   /gene="ibeB"
FT                   /locus_tag="YE0445"
FT                   /note="Signal peptide predicted for YE0445 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.862) with cleavage site
FT                   probability 0.387 between residues 19 and 20"
FT   misc_feature    520036..520068
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   misc_feature    520192..520800
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 150.2, E-value 2.3e-42"
FT                   /inference="protein motif:PFAM:PF02321"
FT   misc_feature    520834..521421
FT                   /note="Pfam match to entry PF02321 OEP, Outer membrane
FT                   efflux protein, score 184.9, E-value 8.2e-53"
FT                   /inference="protein motif:PFAM:PF02321"
FT   CDS             522019..523344
FT                   /transl_table=11
FT                   /locus_tag="YE0447"
FT                   /product="putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10572"
FT                   /db_xref="GOA:A1JIY1"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY1"
FT                   /protein_id="CAL10572.1"
FT                   /translation="METAKKNESVILIDSPAAKNANMTEREWQEAIKFDSTDFGWVIMS
FT                   IGMAIGAGIVFLPVQVGLMGLWVFLLSSIIGYPAMYLFQRLFINTLAESPECKDYPSVI
FT                   SGYLGKNWGIVLGALYFIMLVIWMFVYSTAITNDSASYLQTFGVTEGLLSDNPFYGLVL
FT                   ICVLVAISSRGEKLLFKLSSFMVITKLLVVAALGISMVGMWHLYNVGMLPPVGLLIKNA
FT                   IITLPFTLTSILFIQTLSPMVISYRAKEKSLEVARHKALRAMNIAFGILFCTVFFYAVS
FT                   FTLAMGHDEAVKAYEQNISALAIAAKFFPGGWATVVSVILNIFAVMTAFFGVYLGFREA
FT                   TQGIVLNILRRIMPPENINERWVQNGIMVFAVLLAWGAIILNAPVLSFTSICSPIFGMV
FT                   GCLIPAYLVYKVPALHKYKGLSLTVIIITGVLLCISPFLAFS"
FT   misc_feature    join(522133..522201,522214..522282,522355..522423,
FT                   522466..522534,522571..522639,522682..522750,
FT                   522811..522879,522961..523029,523090..523158,
FT                   523171..523239,523276..523335)
FT                   /note="11 probable transmembrane helices predicted for
FT                   YE0447 by TMHMM2.0 at aa 39-61, 66-88, 113-135,
FT                   150-172,185-207, 222-244, 265-287, 315-337, 358-380,
FT                   385-407 and 420-439"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    523189..523221
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             523394..524710
FT                   /transl_table=11
FT                   /locus_tag="YE0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to many proteins of undefined function
FT                   including: Salmonella typhi hypothetical protein Sty3418
FT                   SWALL:Q8Z3K8 (EMBL:AL627278) (436 aa) fasta scores: E():
FT                   1.7e-102, 64.98 38d in 437 aa, Escherichia coli
FT                   hypothetical protein YhaM or b3108/b3109 SWALL:YHAM_ECOLI
FT                   (SWALL:P42626) (437 aa) fasta scores: E(): 1.6e-101,65.36
FT                   38d in 436 aa and Streptococcus pneumoniae L-serine
FT                   dehydratase, iron-sulfur-dependent, alpha subunit sp0105
FT                   SWALL:Q97T50 (EMBL:AE007327) (290 aa) fasta scores: E():
FT                   1.1, 26.87 38d in 227 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10573"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIY2"
FT                   /inference="similar to sequence:INSDC:AL627278"
FT                   /inference="similar to sequence:INSDC:AE007327"
FT                   /inference="similar to sequence:UniProtKB:P42626"
FT                   /protein_id="CAL10573.1"
FT                   /translation="MSNTTDSALWTAFIHVIQRDVQPAVGCTEPIALALASAIAASYLP
FT                   AKAERIEARVSPNLMKNGMGVTVPGTGMVGLPIAAAVGALGGDPDGGLEVLKNLSSQQV
FT                   VEAKAMLDRGDVRVDMQAGDEILFAEATLYHGDQWACVTIAGGHTQVVRIVINGNVLFE
FT                   LAPESPSEQVVCHAHDCLKQATARQVYQFATQVPFEQIAFILQAAKLNGALSQEGLTGN
FT                   YGLHIGASLMRQRGRGLLVKDLLSDIMIRSAAASDARMGGALLPAMSNSGSGNQGIAAT
FT                   MPVVVVAEHVGASEEELARALILSHLMAIYIHNQLPTLSALCAATTAAMGAAAGMAWLL
FT                   EPRYEPVALAIGSMIGDISGIICDGAANSCAMKVSTSVSAAYKAVLMALDSSGVTGNEG
FT                   IVADDVDQSIANLCALACGAMRQTDSQIIEIMAHKCHCD"
FT   CDS             complement(524772..525650)
FT                   /transl_table=11
FT                   /locus_tag="YE0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10574"
FT                   /db_xref="GOA:A1JIY3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY3"
FT                   /protein_id="CAL10574.1"
FT                   /translation="MKYALGAVLYYWPKTDIETFYQAAASSSADIIYLGENVCTKRREM
FT                   KVGDWLALAKDVAASGKQVVISTLALLQAPSELNELKRYVENGEFLLEANDLGAVNMAA
FT                   DRGLPFVAGHALNCYNAYTLRILHRQGMMRWCMPVELSRDWLANVLQQCEELGFRDKFE
FT                   VEVLSYGHLPLAYSARCFTARSEDRAKDECETCCIKYPQGRKVLSQEDQQVFILNGIQT
FT                   QSGYCYNLGNDLISMQGLVDIVRLSPQGMETLDVIDQFRANELGLNPLTLADKADCNGY
FT                   WRRLAGLELVS"
FT   CDS             complement(525662..526657)
FT                   /transl_table=11
FT                   /locus_tag="YE0450"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10575"
FT                   /db_xref="GOA:A1JIY4"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY4"
FT                   /protein_id="CAL10575.1"
FT                   /translation="MELLCPAGNLPALKAAIDNGADAVYIGLKDDTNARHFAGLNFTDK
FT                   KLQEAVNYVHSRKRKLHIAINTFAHPDGYSRWQRAVDMAAQLGADALILADLAMLEYAA
FT                   ERYPQVERHVSVQASATNDEAIRFYQRHFDVARVVLPRVLSMHQVKQLSRTSPVPLEVF
FT                   AFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARFVRWQQTPQGMESRLNEVLIDRYED
FT                   NENAGYPTLCKGRYLVDGQRYHALEEPTSLNTLELLPELFAANIASVKIEGRQRSPAYV
FT                   SQVAKVWRQAIDRYLANPAQFSAKEEWMEQLGAMSEGTQTTLGAYHRKWQ"
FT   misc_feature    complement(525665..526438)
FT                   /note="Pfam match to entry PF01136 Peptidase_U32,Peptidase
FT                   family U32, score 494.4, E-value 5.7e-146"
FT                   /inference="protein motif:PFAM:PF01136"
FT   misc_feature    complement(526121..526177)
FT                   /note="PS01276 Peptidase family U32 signature."
FT                   /inference="protein motif:Prosite:PS01276"
FT   CDS             526864..527385
FT                   /transl_table=11
FT                   /locus_tag="YE0451"
FT                   /product="putative lipid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10576"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR016830"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY5"
FT                   /protein_id="CAL10576.1"
FT                   /translation="MLGELRARLVRQGPALLRGPLKLTPFALQRQVLEQVLGWQFRQAL
FT                   LDGDLEFLESRWLKIEVRDLALQWFMTVENGRLVVSQQAEADVSFSGDANDLILIAARK
FT                   EDPDTLFFQRRLRIEGDTELGLYVKNLMDAIELESMPTLLRVGLQQLAEFIEAGQQEGA
FT                   ASTSRTLASC"
FT   misc_feature    526951..527271
FT                   /note="Pfam match to entry PF02036 SCP2, SCP-2 sterol
FT                   transfer family, score 89.5, E-value 4.4e-24"
FT                   /inference="protein motif:PFAM:PF02036"
FT   CDS             527379..527882
FT                   /transl_table=11
FT                   /locus_tag="YE0452"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10577"
FT                   /db_xref="GOA:A1JIY6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY6"
FT                   /protein_id="CAL10577.1"
FT                   /translation="MLIRVEIPVDAPGIDALLRKAFKGDDEAGLVQQLREDGLLTLGIV
FT                   ATDDEGGVVGYAAFSPVDVGGEDRQWVALAPLAVEESLRRQGLAEKLVYEGLDSLNEFG
FT                   YAAVVVLGDPAYYQRFGFVPAARHQLTCRWPDTEEAFQVYALAEDALTDADGEVVFSAP
FT                   FNRF"
FT   misc_feature    527511..527747
FT                   /note="Pfam match to entry PF00583
FT                   Acetyltransf,Acetyltransferase (GNAT) family, score 49.1,
FT                   E-value 6.2e-12"
FT                   /inference="protein motif:PFAM:PF00583"
FT   CDS             complement(527869..528162)
FT                   /transl_table=11
FT                   /locus_tag="YE0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10578"
FT                   /db_xref="GOA:A1JIY7"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIY7"
FT                   /protein_id="CAL10578.1"
FT                   /translation="MSDSLWHLYLLRTTSGMLYTGITTDVARRLTQHQAGKGAKALRGK
FT                   GELALVFHCEAGDRSTALKLEYRVKQLSKQQKEKLVMNQPSSLVSLLDVRTD"
FT   CDS             complement(528299..529615)
FT                   /transl_table=11
FT                   /locus_tag="YE0454"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:YE0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10579"
FT                   /db_xref="GOA:A1JIY8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="InterPro:IPR027566"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY8"
FT                   /protein_id="CAL10579.1"
FT                   /translation="MSKTNNKMGVVQLTILTAVNMMGSGIIMLPTKLAEVGTISIVSWL
FT                   VTAVGSMALAYAFAQCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGASLLIANIAIAI
FT                   SAVGYGTELLGATLTPLGICIATIGVLWLATVANFGGARITGQISSVTIWGVIIPVVGI
FT                   SIIGWFWFSGSAYAAAWNPHGVPTFEAIGSSISMTLWAFLGLESACANTDAVENPERNV
FT                   PIAVLGGTLGAAVIYIISTNVIAGIVPNMDLANSTAPFGLAFAYMFTPAVGKIIMALMI
FT                   MSCVGSLLGWQFTIAQVFKSSADEGFFPKIFSKVSKADAPIKGMLTIVVIQSVLSLMTI
FT                   SPSLNKQFNVLVNLAVVTNIIPYILSMAALVIIQKTANVPPAKARKANIIAFIGAMYSF
FT                   YALYSSGQEAMTWGAIVTFLGWTLYGLVSPRFEFAAKTK"
FT   misc_feature    complement(528308..529606)
FT                   /note="Pfam match to entry PF00324 aa_permeases, Amino acid
FT                   permease, score -222.1, E-value 0.00023"
FT                   /inference="protein motif:PFAM:PF00324"
FT   misc_feature    complement(join(528332..528391,528404..528457,
FT                   528494..528562,528590..528658,528749..528817,
FT                   528875..528943,529004..529063,529106..529174,
FT                   529193..529261,529289..529357,529442..529510,
FT                   529523..529591))
FT                   /note="12 probable transmembrane helices predicted for
FT                   YE0454 by TMHMM2.0 at aa 9-31, 36-58, 87-109,
FT                   119-141,148-170, 185-204, 225-247, 267-289, 320-342,
FT                   352-374,387-404 and 409-428"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    complement(529370..529393)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   sig_peptide     complement(529514..529615)
FT                   /locus_tag="YE0454"
FT                   /note="Signal peptide predicted for YE0454 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.666) with cleavage site
FT                   probability 0.448 between residues 34 and 35"
FT   CDS             complement(529709..531874)
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="YE0455"
FT                   /product="ornithine decarboxylase, inducible"
FT                   /EC_number="4.1.1.17"
FT                   /note="Similar to Escherichia coli ornithine decarboxylase,
FT                   inducible SpeF or b0693 SWALL:DCOS_ECOLI (SWALL:P24169)
FT                   (732 aa) fasta scores: E(): 0, 71.42 38d in 721 aa and to
FT                   Yersinia pestis ornithine decarboxylase SpeC or Ypo0960
FT                   SWALL:Q8ZHE0 (EMBL:AJ414145) (720 aa) fasta scores: E(): 0,
FT                   76.32 38d in 718 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10580"
FT                   /db_xref="GOA:A1JIY9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027464"
FT                   /db_xref="InterPro:IPR027568"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIY9"
FT                   /inference="similar to sequence:INSDC:AJ414145"
FT                   /inference="similar to sequence:UniProtKB:P24169"
FT                   /protein_id="CAL10580.1"
FT                   /translation="MKKLNIAASTSAMPCFESQREVVDVLHTDFTDVAAVVLSVQDINN
FT                   GVIESIHSLGLDIPIFAAVCCEEELNTDVLPSLNGVFELCGDNTDFYGKQLESAAEKYE
FT                   KELLPPFFSTLKKYVEMGNSTFACPGHQGGQFFRKHPAGRQFFDFYGETIFRSDMCNAD
FT                   VKLGDLLIHEGAPCDAQKHAAKVFNADKTYFVLNGTSASNKVATNALLARGDLVLFDRN
FT                   NHKSNHHGALIQAGATPVYLETARNPFGFIGGIDAHCFEEKYLREQIRSVAPERANEAR
FT                   PFRLAIIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMKDCSPLLLEL
FT                   NENDPGIIVTQSVHKQQAGFSQTSQIHKKDKHIKGQDRYCNHKRFNNAFMLHASTSPFY
FT                   PLFAALDVNAKMHEGKSGQRMWLDCVKTGIEARKMILNTCNMIKPFVPVEVDGKPWQEY
FT                   DTEAMAQDLRFFNFIPGEKWHAFEGYEASQYFVDPCKLLLTTPGIDTNTGEYTASGIPA
FT                   TILANFLRENGIVPEKCDLNSILFLLTPAEDLAKMQHLVAQIARFERFIEEDALLSDVL
FT                   PTVYRNNETRYKGYTIGKLCQEMHDLYVSYDVKQLQKEMFRKQYFPKVMMNPQDANIEF
FT                   VRGHAELVPLCKAEGRIAAEGALPYPPGVLCVVPGEVWGGAAQRYFLALEESINLLPGF
FT                   APELQGVYLQVDEDGWNRAYGYMMKNK"
FT   misc_feature    complement(529748..530149)
FT                   /note="Pfam match to entry PF03711 OKR_DC_1_C, Orn/Lys/Arg
FT                   decarboxylase, C-terminal domain, score 254.6, E-value
FT                   8.8e-74"
FT                   /inference="protein motif:PFAM:PF03711"
FT   misc_feature    complement(530171..531550)
FT                   /note="Pfam match to entry PF01276 OKR_DC_1, Orn/Lys/Arg
FT                   decarboxylase, major domain, score 1003.9, E-value
FT                   2.4e-299"
FT                   /inference="protein motif:PFAM:PF01276"
FT   misc_feature    complement(530627..530650)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    complement(530783..530827)
FT                   /note="PS00703 Orn/Lys/Arg decarboxylases family 1
FT                   pyridoxal-P attachment site."
FT                   /inference="protein motif:Prosite:PS00703"
FT   misc_feature    complement(531470..531511)
FT                   /note="PS00196 Type-1 copper (blue) proteins signature."
FT                   /inference="protein motif:Prosite:PS00196"
FT   misc_feature    complement(531566..531874)
FT                   /note="Pfam match to entry PF03709 OKR_DC_1_N, Orn/Lys/Arg
FT                   decarboxylase, N-terminal domain, score 117.6, E-value
FT                   1.5e-32"
FT                   /inference="protein motif:PFAM:PF03709"
FT   CDS             complement(533021..535045)
FT                   /transl_table=11
FT                   /locus_tag="YE0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10581"
FT                   /db_xref="GOA:A1JIZ0"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ0"
FT                   /protein_id="CAL10581.1"
FT                   /translation="MKQFTDRQMAKIRQRVMQQQGNSVQQSEIIATLIEDNQVVLGSDT
FT                   LVPATGIATWNHYYYCPDHGVKLVWDRYSPTQHRCPIDSHLFNGEPYDGAWWRALNGLN
FT                   AKACNQLGLLWQLTGEIRYFEKVRDILIDYARYYPDYEVHGGIPYNGPGKANAQTLCEA
FT                   NCLLDFALGYDFIAEALSQEQRDCIAGRLLREGAEFLMQHRTRQLHNHEVKISSAIAVI
FT                   GLILAEELYVEFAVNAEYGLRYQLEHGLFNEGFWFEGSVHYHFYALQGFWSFEKLAAGS
FT                   RYSLLALPYYRDMLSFPLKLLMPDGTFPRINDCTAGQEQLNHAHLYEFAFKTYGNDEYA
FT                   AALHHIYRQEPRLNLDALLYGVEELPPPMIDVIPTDTLHAPDCGLTILRQPQSGRALLV
FT                   KHSPYGGEHDHYDRLNLILFEQGQEVLPDLGTTGYGAQLHYGYYKNSATHNTLSINQKN
FT                   QPPAVPVIHHWYQSANFSWLDTEVDWSQKAPMLDSHTRVQWDSEAYRDVKFRRRILWLE
FT                   DAIIDISSIVNPHQQQWDWTLHIDGSVIESIGESTTFCASGPMQYLHQVTAQPLNGVIQ
FT                   CHYQTAARPLTLWLAADATLFQGLAPANPSVRDISYLILRHHQPESRVTCVFDMNNHDP
FT                   LLKVQVDNDGDILSIKLTRQQQVIQVKIPFTASDLPLFS"
FT   CDS             complement(535068..536306)
FT                   /transl_table=11
FT                   /locus_tag="YE0459"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10582"
FT                   /db_xref="GOA:A1JIZ1"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ1"
FT                   /protein_id="CAL10582.1"
FT                   /translation="MMMKMLAEKNLLMAILLGSSPFIYAAQSQPLLLKMDDINYSIEQI
FT                   KQNNPLYEKSYKNLITKADKALKKPLYSVMDKSLLAASGDKHDYYSFPPYWWPDPSKKD
FT                   GMPYLRKDGETNPAANSDATDKKRMNNFSEDVYYLALAYSFTGKPEYADKAREQLVNWF
FT                   VNPNTRMNPNLQYAQAIPGINEGRGIGLIDSRALVDVIDAVELIRPANVLTEADYQAIK
FT                   LWYKDFYQWMTTSQNGFEEDNWHNNHGTYFDMQAASFALFSDQKAAAQKRLEITQLRRI
FT                   PSHFDIQGRQNAELERTRPWHYSNFHLEAYNKLGRLGEVANKDIWNFSLDEHSLKKGYQ
FT                   YVAGFINTDQAWPYKDLDGVQDKKALVNMMTAARAYPTDPDFQQKAQYLMAKYPDAVEI
FT                   LLYPITQPLIAKK"
FT   sig_peptide     complement(536232..536306)
FT                   /locus_tag="YE0459"
FT                   /note="Signal peptide predicted for YE0459 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.999) with cleavage site
FT                   probability 0.849 between residues 25 and 26"
FT   CDS             536867..538180
FT                   /transl_table=11
FT                   /locus_tag="YE0460"
FT                   /product="putative sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10583"
FT                   /db_xref="GOA:A1JIZ2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ2"
FT                   /protein_id="CAL10583.1"
FT                   /translation="MKTKMIMSKVKIKSLLLLTYLAVGIPSLHAAETLQVWIRASNDSK
FT                   NIYKTEAETFEKKTGIKIEYFNATTDFEQRLARAAAGNALPDLIFNDAAAIGQFVQLGI
FT                   VEPIEPKNIIGGADIIDTAWESAQYIDGKYYGVPTSAQTFALFIRKDWREKLGLERPKS
FT                   WEDISTLAKAFTFNDPDGNGKNDTYGFILPASTTRGYASWFISSYLWQAGGDFIRPAGE
FT                   GKFKGSLEEPAAVETLSFIRGMVCDKTVQPGAINATTADAIPSFRSGQSGMFVTGPYHI
FT                   ALFDKDPGKDTFEVIPPPQGPKGQATLAEGTTVFMMKSSQKKAAAQKFIEFMISPEGQQ
FT                   IGMGMGSNNMPVVRLSINKLVDTKAVYNDPRWAMFADLYAEHGRYIPQVPNWTPIRQVT
FT                   AEGFNRILANCEGDIPAELKVVNQKVNDELAKQNVLGQ"
FT   sig_peptide     536867..536956
FT                   /locus_tag="YE0460"
FT                   /note="Signal peptide predicted for YE0460 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 1.000) with cleavage site
FT                   probability 1.000 between residues 30 and 31"
FT   misc_feature    536984..538111
FT                   /note="Pfam match to entry PF01547 SBP_bac_1, Bacterial
FT                   extracellular solute-binding protein, score 174.5,E-value
FT                   1.2e-49"
FT                   /inference="protein motif:PFAM:PF01547"
FT   CDS             538188..539072
FT                   /transl_table=11
FT                   /locus_tag="YE0461"
FT                   /product="sugar transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10584"
FT                   /db_xref="GOA:A1JIZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ3"
FT                   /protein_id="CAL10584.1"
FT                   /translation="MITLTPRLKRNLVPWLFLAPALVIFTWFKFIPMLQGLVMSFYKVN
FT                   FNQPNEWVGFDNFSRAMGDEALHSAVFNTLLYVVVTMVVAAFIAFFLAMLLEGPARHLR
FT                   FIRTAIFLPAVTSAAIVAEMWRILFNPTSNGVVNHLLSWFSIEAQGFLADTDQALWTVM
FT                   LLHIWKAVPYNMVIFIAGLVGISRDLYDASNVDGANWWNRLRYVTLPGMIPALSVVLML
FT                   SFIRGFRVFAEVYATTGGGPSNATEMIMTHIYKLGFEQFDYGYASAVSFLLFAFTVVLT
FT                   ICHLTLKKRIARY"
FT   misc_feature    join(538221..538289,538407..538475,538494..538562,
FT                   538677..538745,538803..538871,538980..539048)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0461 by TMHMM2.0 at aa 12-34, 74-96, 103-125,
FT                   164-186,206-228 and 265-287"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    538728..538949
FT                   /note="Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component, score 49.9, E-value 3.6e-12"
FT                   /inference="protein motif:PFAM:PF00528"
FT   CDS             539091..539930
FT                   /transl_table=11
FT                   /locus_tag="YE0462"
FT                   /product="sugar transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10585"
FT                   /db_xref="GOA:A1JIZ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ4"
FT                   /protein_id="CAL10585.1"
FT                   /translation="MKSKSWNSIGRWIIYGLLLVVFVGPYWGIIATAFSGAPVKPGELL
FT                   AWPNQFSWDNFIFAWMDIGVWQYLLNSIVVVFFGTVLQVSVSALAAYALARKKFVGVSL
FT                   TSLVILSTMMLPEEVIAIPLYMIINWRLPLIDASLYNSYLGMILPVVGWAFSIFVLTEF
FT                   MAAIPKELEEAARIDGASEWQIFFHVILPLVKPALGTVVTFGFIMIWDQYLLPLIVVNQ
FT                   DSLNTIPVILGTLRTDETITPNIFIAITLLAMLPSIIVYLGLQKHFNRGIMSGAVKG"
FT   sig_peptide     539091..539195
FT                   /locus_tag="YE0462"
FT                   /note="Signal peptide predicted for YE0462 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.889) with cleavage site
FT                   probability 0.452 between residues 35 and 36"
FT   misc_feature    join(539124..539192,539304..539372,539406..539474,
FT                   539517..539585,539643..539711,539823..539882)
FT                   /note="6 probable transmembrane helices predicted for
FT                   YE0462 by TMHMM2.0 at aa 12-34, 72-94, 106-128,
FT                   143-165,185-207 and 245-264"
FT                   /inference="protein motif:TMHMM:2.0"
FT   misc_feature    539577..539801
FT                   /note="Pfam match to entry PF00528
FT                   BPD_transp,Binding-protein-dependent transport systems
FT                   inner membrane component, score 70.5, E-value 2.4e-18"
FT                   /inference="protein motif:PFAM:PF00528"
FT   misc_feature    539580..539666
FT                   /note="PS00402 Binding-protein-dependent transport systems
FT                   inner membrane comp. sign."
FT                   /inference="protein motif:Prosite:PS00402"
FT   CDS             539942..541057
FT                   /transl_table=11
FT                   /locus_tag="YE0463"
FT                   /product="putative sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10586"
FT                   /db_xref="GOA:A1JIZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ5"
FT                   /protein_id="CAL10586.1"
FT                   /translation="MGSVVLKNVCKSYGDTHVIRDVSLEIPDGEFCVLVGPSGCGKSTL
FT                   LRMIAGLEEISGGTVGINDKDVTDVEPKMRDIAMVFQSYALYPQMTVRENMGFALKMAK
FT                   MSKADINQKVGSTAELLGLQALLERLPKDLSGGQRQRVAMGRAIVRNPQVFLFDEPLSN
FT                   LDAKLRTQVRGEIRELHQRLKTTSVYVTHDQIEAMTMGQMIVVLRDGRIEQVGSPLDLY
FT                   DRPANLFVAGFIGSPEINQLKGTVVLNTGKTTEQGDEFLLRLEDGSLLTLPAGLQVTDG
FT                   QNVVYAIRPEQVNVVDESHSASALKATITAIENTGSDMQLFCSTGGGRFTSVFKQRLAV
FT                   NAGETVYLQPKLAGIHIFDAATGVRVTCQAA"
FT   misc_feature    540026..540571
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 199.7, E-value 2.9e-57"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    540047..540070
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   misc_feature    540341..540385
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    540836..541012
FT                   /note="Pfam match to entry PF03459 TOBE, TOBE domain ,score
FT                   33.3, E-value 3.6e-07"
FT                   /inference="protein motif:PFAM:PF03459"
FT   CDS             541072..542238
FT                   /transl_table=11
FT                   /locus_tag="YE0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10587"
FT                   /db_xref="GOA:A1JIZ6"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ6"
FT                   /protein_id="CAL10587.1"
FT                   /translation="MTPIKTSATPMKLYTLDVDCLIKAKAVLQQPFSPLQPALRRLLSE
FT                   ADALRDQPPESVTHKTLLPVSGDIHDYYSFGTYWWPNPRKPNGLPYVRRDGHTNPQSQN
FT                   DDTDTQRIERMCDRCLTLGLAYYFTGNSRYAQVAAEQIRCWFLDAKTRMNPHLNYGQAI
FT                   PGIVSGRGTGLIDTRLMWMVIDTIGLILPAKLLDTEDTAVLQQWFRDFNHWMFHSEVGH
FT                   SEYVWHNNHGTWYDVQRAANAMFYGDRGLVSTIIRQGITQRLAAQIAQDGKQWMELERT
FT                   VPFHYSLFNMEAHLLLCRYGEHVEIDRWAWVQDGRNVQQGIDYLLPFIAEPELWPYRDL
FT                   RGIDYDSALRLLLQAARGYPKEAQRYQAVLATLPADTLTSRDRLMWQS"
FT   CDS             542336..542779
FT                   /transl_table=11
FT                   /locus_tag="YE0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10588"
FT                   /db_xref="GOA:A1JIZ7"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1JIZ7"
FT                   /protein_id="CAL10588.1"
FT                   /translation="MNNPDDLIVITRFLRQQHVLTLCAGSGMDMWCANCFYVFDEAKMA
FT                   LYLMTEKHTRHGELMQINPQVVGTIATQPRTVALIKGIQYRGEITELKDDAELIARQHY
FT                   CRRFPVAKVVSAPLWQLNLLEIKMTNNTLDFGKKLYWSRLESQ"
FT   CDS             543286..544275
FT                   /transl_table=11
FT                   /locus_tag="YE0467"
FT                   /product="hypothetical protein"
FT                   /note="Weakly similar to Lactococcus lactis GntR family
FT                   transcriptional regulator BusR or ll1453 SWALL:Q9CFL6
FT                   (EMBL:AE006375) (206 aa) fasta scores: E(): 8.5, 25 38d in
FT                   184 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10589"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ8"
FT                   /inference="similar to sequence:INSDC:AE006375"
FT                   /protein_id="CAL10589.1"
FT                   /translation="MNSEPKKGSAKATFDSKESADLVKNKMVTCTTRFKFYLPKVNGDS
FT                   IEFGFGIESDCVNAADDFKTLFNSWLNKKSLATSSSESCKQVDILSCAVVKNPLEYSMS
FT                   QLQGDLYTIYIVSESANTETFWLFLDKPDKLAVGSTIYANSAANLTIASGSSPEATFGI
FT                   PIQYKLGAKSSNNAVGLNVKVATSQLKDVNIQDVWKATFYDGPEHQAPDLDKADGVANK
FT                   DEINYTDNSFDPDRVIQNSWYPSQTFGILTENGFVGMTWEARPAKTVAIAPKLTFFVTT
FT                   GEYSSNQLADYSTVSNSAQIVNLSDFSGFAATVTYTKDGKWSIKKGRP"
FT   CDS             544967..545596
FT                   /transl_table=11
FT                   /locus_tag="YE0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10590"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:A1JIZ9"
FT                   /protein_id="CAL10590.1"
FT                   /translation="MAKVLLLGASGLVGGELLRLLRLDARVTSIIAPTRKPLPVMNKLI
FT                   NPQGENIGELLKTLDEPVDLVFCCLGTTRQQAGSQAAFRQVDYRLVLAAGETGLRLGAR
FT                   HFLLVSAMGANPNSWLFYNRTKGEAERDLQTQGWPQLTFARPSMLAGQRTKPRLMESLS
FT                   APLFALLPDKWRLIKAKDVAQALLDQAFAPPHAGVTILSSAQMQQH"
FT   misc_feature    544967..545029
FT                   /note="Pfam match to entry PF01118
FT                   Semialdhyde_dh,Semialdehyde dehydrogenase, NAD binding
FT                   domain, score 19.3, E-value 2.9e-06"
FT                   /inference="protein motif:PFAM:PF01118"
FT   CDS             complement(545597..546364)
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="YE0469"
FT                   /product="PhnP protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10591"
FT                   /db_xref="GOA:A1JJ00"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017693"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ00"
FT                   /protein_id="CAL10591.1"
FT                   /translation="MELTLLGTGCAQQVPVFGCQCVICTKARLKPALRRQSCSAMLRYQ
FT                   GETTLIDAGLPALEQLFAGGQIQRFLLTHYHMDHVQGLFPLRWGCGNAIPVYGPPDPDG
FT                   CDDLYKHPGILAFQPPLSAFHPIQFGDLRVTPVPLNHSKITFGYLLQSPNRTIAYLTDT
FT                   IGLPADSALFLASKNIDLLVQDCSHPPHHLSPHRPPPRNHNDVTMALAISELLKPAATL
FT                   LTHISHQLDSWALDNTLPDGVTIAQDNQIISLL"
FT   misc_feature    complement(546116..546271)
FT                   /note="Pfam match to entry PF00753
FT                   lactamase_B,Metallo-beta-lactamase superfamily, score 14.0,
FT                   E-value 0.0003"
FT                   /inference="protein motif:PFAM:PF00753"
FT   CDS             complement(546355..546933)
FT                   /transl_table=11
FT                   /gene="phnN"
FT                   /locus_tag="YE0470"
FT                   /product="PhnN protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10592"
FT                   /db_xref="GOA:A1JJ01"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ01"
FT                   /protein_id="CAL10592.1"
FT                   /translation="MARLIYLMGASGAGKDCLLSALRVAMPTNVMVAHRYITREANAGA
FT                   ENHIALSEQEFLLRAKQGLFALFWQAHQHHYGVGIEIDIWLQHGLDVVVNGSRAYLPQA
FT                   QQRYHHQLLPLCLTVSPAILAQRLLQRGREDSEQIKARLQRAQHYQQQLPVNCQLLCND
FT                   GELHHTLGQLQQLLATPPTTQQEGNQKWN"
FT   misc_feature    complement(546859..546900)
FT                   /note="PS00105 Aminotransferases class-I
FT                   pyridoxal-phosphate attachment site."
FT                   /inference="protein motif:Prosite:PS00105"
FT   CDS             complement(546933..548081)
FT                   /transl_table=11
FT                   /gene="phnM"
FT                   /locus_tag="YE0471"
FT                   /product="PhnM protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10593"
FT                   /db_xref="GOA:A1JJ02"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ02"
FT                   /protein_id="CAL10593.1"
FT                   /translation="MIFNNVNLILEDQVVSGSLEIHQGVIRSYRDRPTQLSAAIDGQNS
FT                   WLLPGLIELHTDNLDKFFTPRPNVDWPAHSAMSSHDALMVACGITTVLDAVAVGDVRDG
FT                   GHRLDNLQKMINAVVESQRSGLNRAEHRIHLRCELPHDSTLPLFEELMMQPELSLVSLM
FT                   DHSPGQRQFASRAKYREYYQGKYHLNDQQMAEFEEEQISLSARWSGQNRQAIAAHCRQR
FT                   GIALASHDDATAEHVAESQALGSVIAEFPTTEVAARASHQHGLQVLMGAPNIVRGGSHS
FT                   GNVAAHQLASLGVLDILSSDYYPASLLDAAFRIAHDESNSFTLAQAVNLVTRNPARALG
FT                   LADRGVIAEGKRADLILARTHEGSHNQHVYVQNVWRQGIQVF"
FT   misc_feature    complement(547011..547118)
FT                   /note="Pfam match to entry PF01685 ATZ_TRZ,Chlorohydrolase,
FT                   score 25.7, E-value 8.7e-08"
FT                   /inference="protein motif:PFAM:PF01685"
FT   CDS             complement(548078..548752)
FT                   /transl_table=11
FT                   /gene="phnL"
FT                   /locus_tag="YE0472"
FT                   /product="phosphonates transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10594"
FT                   /db_xref="GOA:A1JJ03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ03"
FT                   /protein_id="CAL10594.1"
FT                   /translation="MLHHQHGIRLPVLHQTSLEVGSGECVVLHGHSGSGKSTLLRSLYA
FT                   NYLPDSGHIWVKHQGEWLDMVSAQARQIMAVRRHTVGWVSQFLRVIPRISALNVVMQPL
FT                   LELGVDRQICQQRAQDLLTRLNVPPRLWDLAPSTFSGGEQQRVNIARGFIVDYPILLLD
FT                   EPTASLDSTNSAAVVSLIDEAKQRGAAIVGIFHDEKVRNHVSDRLLTMTPPPSHVSTEI
FT                   PS"
FT   misc_feature    complement(548111..548686)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 181.7, E-value 8e-52"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(548294..548338)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(548642..548665)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(548826..549614)
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="YE0473"
FT                   /product="phosphonates transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10595"
FT                   /db_xref="GOA:A1JJ04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ04"
FT                   /protein_id="CAL10595.1"
FT                   /translation="MSKPSAVHPLLSVENLTHLYAPGKGFSDVSFQLYPGEVLGIVGES
FT                   GSGKTTLLKSISARLAPQQGQIIYRPAAQQALDLYQMAESQRRRLLRTEWGVVHQHPLD
FT                   GLRPQVSAGGNIGERLMAIGQRHYGEIRQQAGRWLEDVEIPLSRLDDLPTTFSGGMQQR
FT                   LQIARNLVTHPKLVFMDEPTGGLDVSVQARLLDLLRNLVVEMQLAVVIVTHDLGVARLL
FT                   ANRLLVMKEGQVIESGLTDRVLDDPHHPYTQLLVSSVLQN"
FT   misc_feature    complement(548919..549509)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 201.5, E-value 8.7e-58"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(549105..549149)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   misc_feature    complement(549465..549488)
FT                   /note="PS00017 ATP/GTP-binding site motif A (P-loop)."
FT                   /inference="protein motif:Prosite:PS00017"
FT   CDS             complement(549629..550495)
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="YE0474"
FT                   /product="PhnJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10596"
FT                   /db_xref="GOA:A1JJ05"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ05"
FT                   /protein_id="CAL10596.1"
FT                   /translation="MTEVLTGYNLGYLDEQTKRTLRRALLKAVAIPGYQVPFGGREMPM
FT                   PYGWGTGGIQLTACLIGRYDVLKVIDQGADDTTNAVSIRRFFQRVSGVATTEKTTNATL
FT                   IQTRHRIPETPLTEDQILIYQVPIPEPLRFIEPRETETRKMHALEEYGVMQVKLYEDIA
FT                   RYGHIATTYAYPVKVNDRYVMDPSPIPKFDNPKMHMMPALQLFGAGREKRLYALPPFTK
FT                   VESLDFDDHPFSVQQWNEPCALCGSRHSYLDEVVMDDKGSRMFVCSDTDFCQQQLAQAA
FT                   TQEVNIQ"
FT   CDS             complement(550488..551600)
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="YE0475"
FT                   /product="PhnI protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10597"
FT                   /db_xref="GOA:A1JJ06"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ06"
FT                   /protein_id="CAL10597.1"
FT                   /translation="MYVAVKGGEKAIAAAHQLLEHQRRGDTQIPAIDCEQIEQQLGLAV
FT                   DRVMTEGGIYDRELAALAIKQASGDLVEAIFLLRAYRTTLPRLAVSQPLATGNMRLERR
FT                   ISAIYKDLPGGQVLGPTYDYTHRLLDFTLLAAGEAPHALNRRDISPEAVSQNNCAHVFD
FT                   LLAQEQLAKVEQDDGTPPEDITRNPPVYPCNRSARLQQLVRGDEGFLLALGYSTQRGYG
FT                   RTHPFAAEIRTGELTISIEPEELGFTIDIGEILLTECEMVNGFVSPAAEPPHFTRGYGL
FT                   VFGRGERKAMSMALMDRALQSREYDKNVASPAQDEEFVLSHADNVEAAGFVSHLKLPHY
FT                   VDFQAELELLKRLRREYSSAAAEQQEPRHD"
FT   CDS             complement(551600..552181)
FT                   /transl_table=11
FT                   /gene="phnH"
FT                   /locus_tag="YE0476"
FT                   /product="PhnH protein"
FT                   /note="Similar to Escherichia coli PhnH protein involved in
FT                   phosphonate usage, b4100 SWALL:PHNH_ECOLI (SWALL:P16686)
FT                   (194 aa) fasta scores: E(): 1.4e-38, 54.12 id in 194 aa,
FT                   and to Yersinia pestis PhnH protein or ypo3458 SWALL:Q8ZBF8
FT                   (EMBL:AJ414157) (208 aa) fasta scores: E(): 1.3e-40, 63.46
FT                   38d in 208 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10598"
FT                   /db_xref="GOA:A1JJ07"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ07"
FT                   /inference="similar to sequence:INSDC:AJ414157"
FT                   /inference="similar to sequence:UniProtKB:P16686"
FT                   /protein_id="CAL10598.1"
FT                   /translation="MSLLNHFDQPVDDAQHAFRRILKALSEPGVVVSLPHSSGWQPLNP
FT                   ATTSILLTLVDQETPLYLDEPLNNDAVQQNIRFHCGAPLTTSIKNSLFSLFDNKIKEEV
FT                   LIGCPAGSELSPEHSTTIILQATSLHLGVPLRLRGPGIEHHRTVAPQLPSAVLNYLLNR
FT                   PTAFPAGLDFLLTCGENLMAIPRTTHVEVC"
FT   CDS             complement(552181..552657)
FT                   /transl_table=11
FT                   /gene="phnG"
FT                   /locus_tag="YE0477"
FT                   /product="PhnG protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10599"
FT                   /db_xref="GOA:A1JJ08"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ08"
FT                   /protein_id="CAL10599.1"
FT                   /translation="MESISNTRQGWMSVLAHSQPAQLLAHWQSLNLAPQYQVIRAPEIG
FT                   LSQLQARMGGTGRRFILGDMTLTRAVIKLNHSTDIYGYSYIAGRNKPHAELCALLDALL
FT                   QLSTLNEKPAGLSELLLKTVIHPLAAIQQERRELRARAIATSKVDFFTLVRGED"
FT   CDS             complement(552658..553383)
FT                   /transl_table=11
FT                   /gene="phnF"
FT                   /locus_tag="YE0478"
FT                   /product="probable gntR-family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10600"
FT                   /db_xref="GOA:A1JJ09"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ09"
FT                   /protein_id="CAL10600.1"
FT                   /translation="MHLSRPPTSYPTRYQQIAAQLEQELRGAYRCGDYLPSEQQLAERY
FT                   QVNRHTLRRAVDELVKRGWLQRRQGIGILVLMRPYDYPLHANARFSQNLLDQGSDPTSE
FT                   RLLAVLRPCIEHVAKALSLDEGTTVIHLRTLRRVNGVPVCVIDHYLPELSWWPALQQFN
FT                   SGSLHQFISQHLQQPLSRSQTRISARRAQAKESRLLEIATHAPLLCVRTLNIRVDSQQV
FT                   AEYSVSLTRADMIELTMEH"
FT   misc_feature    complement(553159..553335)
FT                   /note="Pfam match to entry PF00392 gntR, Bacterial
FT                   regulatory proteins, gntR family, score 85.7, E-value
FT                   5.9e-23"
FT                   /inference="protein motif:PFAM:PF00392"
FT   misc_feature    complement(553207..553281)
FT                   /note="PS00043 Bacterial regulatory proteins, gntR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00043"
FT   misc_feature    complement(553213..553278)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1189.000, SD 3.24 at aa 36-57, sequence
FT                   PSEQQLAERYQVNRHTLRRAVD"
FT   CDS             553768..554871
FT                   /transl_table=11
FT                   /locus_tag="YE0479"
FT                   /product="putative lipoprotein"
FT                   /note="Similar to many proteins which are rich in Glycine:
FT                   Ralstonia solanacearum putative hemagglutinin-related
FT                   transmembrane protein Rsp1094 SWALL:Q8XQX4 (EMBL:AL646082)
FT                   (459 aa) fasta scores: E(): 1.3e-22, 35.71 38d in 392 aa
FT                   and to Ralstonia solanacearum putative lipoprotein Rsp0116
FT                   or rs03006 SWALL:Q8XTJ2 (EMBL:AL646076) (427 aa) fasta
FT                   scores: E(): 2e-21, 38.43 38d in 346 aa and to Arabidopsis
FT                   thaliana putative glycine-rich protein f7k2.60 or at4g22480
FT                   SWALL:Q9SUX1 (EMBL:AL033545) (608 aa) fasta scores: E():
FT                   4.8e-07, 31.56 38d in 377 aa. Note the high Glycine content
FT                   of the predicted product of this CDS"
FT                   /db_xref="EnsemblGenomes-Gn:YE0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10601"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ10"
FT                   /inference="similar to sequence:INSDC:AL646082"
FT                   /inference="similar to sequence:INSDC:AL646076"
FT                   /inference="similar to sequence:INSDC:AL033545"
FT                   /protein_id="CAL10601.1"
FT                   /translation="MCPKNISRLSKISLAILLACSLAACSGSGGGSHNSAKNNAGQTTG
FT                   GTGSGGGGDTGSGGGTGGGTDGGTTTNNSAVGNVVSGVGTAVDGVGNTVSGVVSQTPVG
FT                   SLPIVGGGLVTVVDSAGNAVSDVGTGLQNGVGQLGNNPNALGTTAAGVPKAVADVGTGV
FT                   SGLGGTVSGIAANTPLGGVTGTAGGLVDKTGGAVTSIGNGLAQDLQTGTTSKLTTAATG
FT                   IVTPVVGQVQDITQTVGSTTGIGAPVNNLLTAVGGTIVTTGTQVGSSTPTLAGVGQVLQ
FT                   GSGQAVEKAGGLVTPPTSTGGSNGLLAGVMNTLTPTSGGSNSGLLAEVNNTVGGVTGGL
FT                   TAGVSANANASGGLAGGIGGILKPKTN"
FT   sig_peptide     553807..553869
FT                   /locus_tag="YE0479"
FT                   /note="Signal peptide predicted for YE0479 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.985) with cleavage site
FT                   probability 0.492 between residues 21 and 22"
FT   misc_feature    553810..553842
FT                   /note="PS00013 Prokaryotic membrane lipoprotein lipid
FT                   attachment site."
FT                   /inference="protein motif:Prosite:PS00013"
FT   CDS             555105..556841
FT                   /transl_table=11
FT                   /locus_tag="YE0480"
FT                   /product="exported protein"
FT                   /product="putative exported protein"
FT                   /note="Similar to Haemophilus influenzae heme/hemopexin
FT                   utilization protein B precursor HxuB or hi0263
FT                   SWALL:HXB1_HAEIN (SWALL:P44601) (565 aa) fasta scores: E():
FT                   9.8e-06, 17.76 38d in 563 aa and to Ralstonia solanacearum
FT                   probable activation/secretion signal peptide protein
FT                   Rsp1095 or rs02601 SWALL:Q8XQX3 (EMBL:AL646082) (557 aa)
FT                   fasta scores: E(): 5.6e-24, 31.85 38d in 565 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10602"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ11"
FT                   /inference="similar to sequence:INSDC:AL646082"
FT                   /inference="similar to sequence:UniProtKB:P44601"
FT                   /protein_id="CAL10602.1"
FT                   /translation="MNNRVWLLFLFGAGNVWQFSAFANTIPMLIDQNNPSKISRDIARP
FT                   QTPRTVVPPISTPVPEPSSKLTLDTLIDVKHIQFIGGTQYDINILSEPFTPYIGKKVSL
FT                   KTLLLATQSITKMYQQDGYILSYAYLPTDNFANGTLKIGLVEGYIANTRIQSDNAAIGR
FT                   WLTKLSQHIMAEKPLTQQTFERYSILMSRTPDTKVIATAKNPDNIYGATLLDIKADHPR
FT                   NWNVSTALDSRKGVYSGVLNATLSGFTPYAEQLGVATLLPLDSKNRDQYLGVNYQQYLG
FT                   SNGLLLQTRGSYYKQEPKDYTDVLTLFPDNITLSSRTQQTQYTGGVVLSYPLELTRKRQ
FT                   WTVSGGVDYLEKSYNLKSRARFNNFNNTLFDLEEQNQRMRYPAAELALTGYQEYTQSYW
FT                   STRASVRKGINGALASSSVPWGDLGFTRWKLTGDGAYLMAEKWRLSASAEGDWSDNDLP
FT                   EAEHVTFGGLRFGRGYPDGEAAGDYGYGGQVEMRYIHNRENGNWLKTIQPYAVLDTAHT
FT                   WYNSPIFRAQKLASYAVGVTFGDNKHYSLSLEGARPIGDLPSDSTRRDWRFNATLTYNF
FT                   AN"
FT   sig_peptide     555105..555173
FT                   /locus_tag="YE0480"
FT                   /note="Signal peptide predicted for YE0480 by SignalP 2.0
FT                   HMM (Signal peptide probabilty 0.998) with cleavage site
FT                   probability 0.992 between residues 23 and 24"
FT   CDS             complement(556986..557360)
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="YE0481"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10603"
FT                   /db_xref="GOA:A1JJ12"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ12"
FT                   /protein_id="CAL10603.1"
FT                   /translation="MGCYNKSTWRLNSGKPFTQEMEDKIIADLNDSRIRRQGLSLSGGD
FT                   PLHPQNLSAILQLVKRVRQECDGKDIWVWTGYTLAELTADQQQVVDLINVLVDGKFVQD
FT                   LKDPSLIWRGSGNQVIHHLR"
FT   CDS             complement(557696..559834)
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="YE0482"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YE0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10604"
FT                   /db_xref="GOA:A1JJ13"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ13"
FT                   /protein_id="CAL10604.1"
FT                   /translation="MKTVVIKRDGCQVPFDEVRIKEAVERAALAVGVVDADYCATVARV
FT                   VAQTMENQPKVDIRDIQTAVENQLMAGQYKQLARAYIEYRHDRDISREVRGRLNQEIRG
FT                   LVEQSNQALLNENANKDSKVIPTQRDLLAGIVAKHYAKQHILPRDVVLAHERGEIHYHD
FT                   LDYAPFFPMFNCMLIDLNGMLTQGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVTESFNKHKAVAEEWQIPDAAGYAMSRTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWQSRMIQQAILRNRIAGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDANYDIKQLALECATKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEEDGEQIH
FT                   DGRNNLGVISLNLPRIALEAQGDEAKFWRLLDERLLLAKKALMTRIARLEGIKARVAPI
FT                   LYMEGACGVRLQADDNISEIFKNGRASISLGFIGIHETVNALFGHQAHIFDDQKLRAKG
FT                   VAIVERMRQATDSWKEETGYAFSLYSTPSENLCDRFCRLDTAEFGVVEGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKLDFEAPYPPLANGGFICYGEYPNLQHNLRALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGFTGEFSCTSKGFTCPKCGNHEPSKVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRVKHLANGQLG"
FT   misc_feature    complement(557765..558094)
FT                   /note="Pfam match to entry PF01228 Gly_radical, Glycine
FT                   radical, score 187.4, E-value 1.5e-53"
FT                   /inference="protein motif:PFAM:PF01228"
FT   misc_feature    complement(557783..557809)
FT                   /note="PS00850 Glycine radical signature."
FT                   /inference="protein motif:Prosite:PS00850"
FT   misc_feature    complement(559559..559828)
FT                   /note="Pfam match to entry PF03477 ATP-cone, ATP cone
FT                   domain, score 93.9, E-value 2e-25"
FT                   /inference="protein motif:PFAM:PF03477"
FT   CDS             complement(560118..561026)
FT                   /transl_table=11
FT                   /locus_tag="YE0483"
FT                   /product="putative LysR-family transcriptional regulatory
FT                   protein"
FT                   /note="Similar to many proposed transcriptional regulatory
FT                   proteins including: Pseudomonas aeruginosa probable
FT                   transcriptional regulator Pa0181 SWALL:Q9I6V1
FT                   (EMBL:AE004456) (310 aa) fasta scores: E(): 6.8e-32,37.28
FT                   38d in 287 aa and Rhizobium meliloti putative LysR-family
FT                   transcriptional regulator Ra0890 or Sma1632 SWALL:Q92YJ0
FT                   (EMBL:AE007275) (317 aa) fasta scores: E(): 6.8e-28, 32.3
FT                   38d in 291 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10605"
FT                   /db_xref="GOA:A1JJ14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ14"
FT                   /inference="similar to sequence:INSDC:AE004456"
FT                   /inference="similar to sequence:INSDC:AE007275"
FT                   /protein_id="CAL10605.1"
FT                   /translation="MSLPSDIHRLLPAFLSAAQNENFSVAARQLGVTPAAISKNVRVLE
FT                   EKLALRLFQRNTHSVVLTDEGKALLARVAPLWQALSHTLDTVRNDEQHPSGTVRVSLIP
FT                   GFGRQLLMPLIPKFMARYPQIDLDLSLEARVVNLVGEGFDVGIGTHIDPDSRLIARQFY
FT                   PMQMVLAASPAYLARYGTPSNPQHLYQHQCLLHRNPSTGRIVKWLLQHNNEVQSFELSG
FT                   RLVISQPEVLMNAALADMGITYIAQWHAEPHFADGSLVPVLAHHWPAPVPLWLYYASAD
FT                   LPPRVRVWVDFLLEHFRPMKR"
FT   misc_feature    complement(560133..560756)
FT                   /note="Pfam match to entry PF03466 LysR_substrate, LysR
FT                   substrate binding domain, score 180.4, E-value 1.9e-51"
FT                   /inference="protein motif:PFAM:PF03466"
FT   misc_feature    complement(560826..561005)
FT                   /note="Pfam match to entry PF00126 HTH_1, Bacterial
FT                   regulatory helix-turn-helix protein, lysR family, score
FT                   61.8, E-value 9.7e-16"
FT                   /inference="protein motif:PFAM:PF00126"
FT   misc_feature    complement(560871..560963)
FT                   /note="PS00044 Bacterial regulatory proteins, lysR family
FT                   signature."
FT                   /inference="protein motif:Prosite:PS00044"
FT   misc_feature    complement(560901..560966)
FT                   /note="Predicted helix-turn-helix motif with score
FT                   1574.000, SD 4.55 at aa 21-42, sequence
FT                   ENFSVAARQLGVTPAAISKNVR"
FT   CDS             561129..561653
FT                   /transl_table=11
FT                   /locus_tag="YE0484"
FT                   /product="putative oxidoreductase"
FT                   /note="Similar to Bacillus subtilis general stress protein
FT                   14 YwrO SWALL:GS14_BACSU (SWALL:P80871) (175 aa) fasta
FT                   scores: E(): 2.3e-26, 46.83 38d in 158 aa, Bacillus
FT                   subtilis putative NAD(P)H oxidoreductase YrkL
FT                   SWALL:YRKL_BACSU (SWALL:P54439) (174 aa) fasta scores: E():
FT                   5e-23, 39.41 38d in 170 aa, and to Escherichia coli,and
FT                   Escherichia coli O157:H7 putative NAD(P)H oxidoreductase
FT                   YheR or b3351 or z4712 or ecs4202 SWALL:YHER_ECOLI
FT                   (SWALL:P45534) (184 aa) fasta scores: E(): 1.3e-21, 42.33
FT                   38d in 163 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10606"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ15"
FT                   /inference="similar to sequence:UniProtKB:P80871"
FT                   /inference="similar to sequence:UniProtKB:P54439"
FT                   /inference="similar to sequence:UniProtKB:P45534"
FT                   /protein_id="CAL10606.1"
FT                   /translation="MPRILVLTAHRKPDESRINHRLIEAIRPLPNVAVHELIREYPDFQ
FT                   IDVAREQELLQSHDVIVMMFPFYWYSSPAILSEWQDAVLTYGFAYGSRGDKLRGKPLQL
FT                   VVSTGGNEQAYSPQGYNRYPALDLLLPFHAMANMTGMDFLPPYLVQGANAMEEETLERY
FT                   VQGVVGMMKGF"
FT   misc_feature    561132..561644
FT                   /note="Pfam match to entry PF02525
FT                   Flavodoxin_2,Flavodoxin-like fold, score 159.7, E-value
FT                   3.2e-45"
FT                   /inference="protein motif:PFAM:PF02525"
FT   CDS             561756..562025
FT                   /transl_table=11
FT                   /locus_tag="YE0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Erwinia amylovora hypothetical 10.0 kDa
FT                   protein SWALL:Q9ETK7 (EMBL:AF264950) (89 aa) fasta scores:
FT                   E(): 1.3e-17, 60.67 38d in 89 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10607"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ18"
FT                   /inference="similar to sequence:INSDC:AF264950"
FT                   /protein_id="CAL10607.1"
FT                   /translation="MATTMSQKAAREGLGSPELFDGGVFVTKNGVAELFVQPAAEREAE
FT                   IRERHLERQSNALLKLVMLAKQDIKNQQGMSPEETLRKLRAARK"
FT   CDS             562119..562376
FT                   /transl_table=11
FT                   /locus_tag="YE0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar in parts to Erwinia amylovora hypothetical
FT                   protein SWALL:Q9ETQ1 (EMBL:AF264950) (71 aa) fasta scores:
FT                   E(): 2.6e-14, 56.33 38d in 71 aa and to Yersinia pestis
FT                   hypothetical protein Y1074 or ypmt1.69 SWALL:Q9ZGZ3
FT                   (EMBL:AF074611) (108 aa) fasta scores: E(): 8.8, 33.33 38d
FT                   in 42 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10608"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ19"
FT                   /inference="similar to sequence:INSDC:AF264950"
FT                   /inference="similar to sequence:INSDC:AF074611"
FT                   /protein_id="CAL10608.1"
FT                   /translation="MGPVKAGEFVDNLLISSITAISEDPIRYRFNSMLSDSGVLLRERL
FT                   DPDSEYRVIYDYDGQTVEILAFVSMKQDLERVLYRYLMFR"
FT   CDS             complement(562432..563148)
FT                   /transl_table=11
FT                   /locus_tag="YE0487"
FT                   /product="putative ABC transporter, ATP-binding protein"
FT                   /note="Similar to Yersinia pestis putative ABC transporter,
FT                   ATP-binding protein Ypo3453 SWALL:Q8ZBG3 (EMBL:AJ414157)
FT                   (233 aa) fasta scores: E(): 3.4e-69, 89.7 id in 233 aa and
FT                   Agrobacterium tumefaciens ABC transporter, nucleotide
FT                   binding/ATPase protein dppf or atu4620 or agr_l_526
FT                   SWALL:Q8U736 (EMBL:AE009390) (245 aa) fasta scores: E():
FT                   2.7e-36, 51.28 38d in 234 aa"
FT                   /db_xref="EnsemblGenomes-Gn:YE0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10609"
FT                   /db_xref="GOA:A1JJ20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1JJ20"
FT                   /inference="similar to sequence:INSDC:AJ414157"
FT                   /inference="similar to sequence:INSDC:AE009390"
FT                   /protein_id="CAL10609.1"
FT                   /translation="MALIEVKNLQVNFAQKNQVKTAVESVSFAVEAGETFSLIGASGCG
FT                   KSTVLRTLAGLQREWQGEITLLGQPLQPGQRFIGQLRKDVQMVFQDPYASLHPQHNIQR
FT                   TLGEPLKIHGEQNIQQRIDQALKQVGLPAAAAQRYPHQFSGGQRQRIAIARALLLRPKL
FT                   LLLDEPTSALDMSVQAEILNLLNHLKREHGMTYLLVSHDSDVVAHMSERAAMMESGKIV
FT                   REFARRDLELAEHFMG"
FT   misc_feature    complement(562492..562992)
FT                   /note="Pfam match to entry PF00005 ABC_tran, ABC
FT                   transporter, score 140.1, E-value 2.5e-39"
FT                   /inference="protein motif:PFAM:PF00005"
FT   misc_feature    complement(562678..562722)
FT                   /note="PS00211 ABC transporters family signature."
FT                   /inference="protein motif:Prosite:PS00211"
FT   CDS             complement(563135..564013)
FT                   /transl_table=11
FT                   /locus_tag="YE0488"
FT                   /product="putative ABC transporter transporter,ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YE0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAL10610"
FT                   /db_xref="GOA:A1JJ21"
FT                   /db_xref="InterP