spacer

EBI Dbfetch

ID   AM286281; SV 1; linear; genomic DNA; STD; HUM; 237 BP.
XX
AC   AM286281;
XX
DT   07-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*01new
DE   allele, exon 2
XX
KW   HLA-DRB1 gene; HLA-DRB1*01new allele; major histocompatibility complex;
KW   MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-237
RA   Norvell B.M.;
RT   ;
RL   Submitted (05-JUL-2006) to the INSDC.
RL   Norvell B.M., Identity Testing Division, Laboratory Corporation of America,
RL   1440 York Ct. Extension, NC, 27215, USA.
XX
RN   [2]
RA   Norvell B.M., Heine U., Shields B.;
RT   "New HLA DRB1*01 Allele";
RL   Unpublished.
XX
DR   MD5; 892ef755ed556ff18019550a13d11ebe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..237
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q14FK8"
FT                   /db_xref="IMGT/HLA:DRB1*01:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q14FK8"
FT                   /protein_id="CAL08014.1"
FT                   /translation="FECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPD
FT                   AEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTV"
FT   exon            1..237
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*01new"
FT                   /number=2
XX
SQ   Sequence 237 BP; 54 A; 52 C; 88 G; 43 T; 0 other;
     tttgaatgtc atttcttcaa tgggacggag cgggtgcggt tgctggaaag atgcatctat        60
     aaccaagagg agtccgtgcg cttcgacagc gacgtggggg agtaccgggc ggtgacggag       120
     ctggggcggc ctgatgccga gtactggaac agccagaagg acctcctgga gcagaagcgg       180
     ggccgggtgg acaactactg cagacacaac tacggggttg gtgagagctt cacagtg          237
//


spacer
spacer