spacer

EBI Dbfetch

ID   AM285030; SV 2; linear; genomic DNA; STD; HUM; 3043 BP.
XX
AC   AM285030;
XX
DT   30-JUN-2006 (Rel. 88, Created)
DT   22-SEP-2009 (Rel. 102, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, HLA-B*44new allele, exons
DE   1-7
XX
KW   HLA-B gene; HLA-B*44new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Fischer G.F.;
RT   ;
RL   Submitted (29-JUN-2006) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20 A-1090 Vienna, A-1090, AUSTRIA.
XX
RN   [2]
RA   Fae I., Rieger A., Kohrgruber N., Mayr W.R., Fischer G.F.;
RT   "A novel HLA-B allele found in an HIV positive patient";
RL   Unpublished.
XX
RN   [3]
RP   1-3043
RA   Fischer G.F.;
RT   ;
RL   Submitted (07-SEP-2009) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20 A-1090 Vienna, A-1090, AUSTRIA.
XX
DR   MD5; 1088ef8207c18405bc0b180f0226dab0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3043
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Austria:Lower Austria"
FT                   /clone="SJ297/76"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             join(18..90,220..489,733..1005,1581..1856,1961..2077,
FT                   2519..2551,2658..2701)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q14QQ0"
FT                   /db_xref="IMGT/HLA:B*44:138Q"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q14QQ0"
FT                   /protein_id="CAK96163.2"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRT
FT                   ALRYYNQSEAGSHIQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAA
FT                   QITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEA
FT                   TLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYT
FT                   CHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKG
FT                   GSYSQAASSDSAQGSDVSLTA"
FT   exon            <18..90
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   intron          91..219
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=1
FT   exon            220..489
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   intron          490..732
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=2
FT   exon            733..1005
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   intron          1006..1580
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=3
FT   exon            1581..1856
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   intron          1857..1960
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=4
FT   exon            1961..2077
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
FT   intron          2078..2518
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=5
FT   exon            2519..2551
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=6
FT   intron          2552..2657
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=6
FT   exon            2658..>2701
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44new"
FT                   /number=7
XX
SQ   Sequence 3043 BP; 569 A; 871 C; 972 G; 631 T; 0 other;
     tctcctcaga cgccgagatg cgggtcacgg cgccccgaac cctcctcctg ctgctctggg        60
     gggcagtggc cctgaccgag acctgggccg gtgagtgcgg ggtcgggagg gaaatggcct       120
     ctgtggggag gagagagggg accgcaggcg ggggcgcagg acccggggag ccgcgccggg       180
     aggagggtcg ggcgggtctc agcccctcct cgcccccagg ctcccactcc atgaggtatt       240
     tctacaccgc catgtcccgg cccggccgcg gggagccccg cttcatcacc gtgggctacg       300
     tggacgacac gctgttcgtg aggttcgaca gcgacgccac gagtccgagg aaggagccgc       360
     gggcgccatg gatagagcag gaggggccgg agtattggga ccgggagaca cagatctcca       420
     agaccaacac acagacttac cgagagaacc tgcgcaccgc gctccgctac tacaaccaga       480
     gcgaggccgg tgagtgaccc cggcccgggg cgcaggtcac gactccccat cccccacgta       540
     cggcccgggt cgccccgagt ctccgggtcc gagatccgcc cccgaggccg cgggacccgc       600
     ccagaccctc gaccggcgag agccccaggc gcgtttaccc ggtttcattt tcagttgagg       660
     ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg ggggacgggg ctgaccgcgg       720
     ggccggggcc agggtctcac atccagagga tgtacggctg cgacgtgggg ccggacgggc       780
     gcctcctccg cgggtatgac caggacgcct acgacggcaa ggattacatc gccctgaacg       840
     aggacctgag ctcctggacc gcggcggaca ccgcggctca gatcacccag cgcaagtggg       900
     aggcggcccg tgtggcggag caggacagag cctacctgga gggcctgtgc gtggagtcgc       960
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg      1020
     gggagccttc cccatctcct ataggtcgcc ggggatggcc tcccacgaga agaggaggaa      1080
     aatgggatca gcgctagaat gtcgccctcc cttgaatgga gaatggcatg agttttcctg      1140
     agtttcctct gagggccccc tcttctctct aggacaatta agggatgacg tctctgagga      1200
     aatggagggg aagacagtcc ctagaatact gatcaggggt cccctttgac ccctgcagca      1260
     gccttgggaa ccgtgacttt tcctctcagg ccttgttctc tgcctcacac tcagtgtgtt      1320
     tggggctctg attccagcac ttctgagtca ctttacctcc actcagatca ggagcagaag      1380
     tccctgttcc ccgctcagag actcgaactt tccaatgaat aggagattat cccaggtgcc      1440
     tgcgtccagg ctggtgtctg ggttctgtgc cccttcccca ccccaggtgt cctgtccatt      1500
     ctcaggctgg tcacatgggt ggtcctaggg tgtcccatga gagatgcaaa gcgcctgaat      1560
     tttctgactc ttcccatcag accccccaaa gacacatgtg acccaccacc ccatctctga      1620
     ccatgaggcc accctgaggt gctgggccct gggcttctac cctgcggaga tcacactgac      1680
     ctggcagcgg gatggcgagg accaaactca ggacaccgag cttgtggaga ccagaccagc      1740
     aggagataga accttccaga agtgggcagc tgtggtggtg ccttctggag aagagcagag      1800
     atacacatgc catgtacagc atgaggggct gccgaagccc ctcaccctga gatggggtaa      1860
     ggagggggat gaggggtcat atctgttctc agggaaagca ggagcccttc tggagccctt      1920
     cagcagggtc agggcccctc atcttcccct cctttcccag agccatcttc ccagtccacc      1980
     atccccatcg tgggcattgt tgctggcctg gctgtcctag cagttgtggt catcggagct      2040
     gtggtcgcta ctgtgatgtg taggaggaag agctcaggta gggaaggggt gaggggtggg      2100
     gtctgggttt tcttgtccca ctgggggttt caagccccag gtagaagtgt tccctgcctc      2160
     attactggga agcagcatcc acacaggggc taacgcagcc tgggaccctg tgtgccagca      2220
     cttactcttt tgtgcagcac atgtgacaat gaaggacaga tgtatcgcct tgatggttgt      2280
     ggtgttgggg tcctgattcc agcattcatg agtcagggga aggtccctgc taaggacaga      2340
     ccttaggagg gcagttggtc caggacccac acttgctttc ctcgtgtttc ctgatcctgc      2400
     cctgggtctg tagtcatact tctggaaatt ccttttggtt ccaagacgag gaggttcctc      2460
     taagatctca tggtcctgct tcctcccagt cccctcacag gacattttct tcccacaggt      2520
     ggaaaaggag ggagctactc tcaggctgcg tgtaagtggt gggggtggga gtgtggagga      2580
     gctcacccac cccataattc ctcctgtccc acgtctcctg cgggctctga ccaggtcctg      2640
     tttttgttct actccagcca gcgacagtgc ccagggctct gatgtgtctc tcacagcttg      2700
     aaaaggtgag attcttgggg tctagagtgg gtggggtggc gggtctgggg gtgggtgggg      2760
     cagtggggaa aggcctgggt aatggagatt ctttgattgg gatgtttcgc gtgtgtcgtg      2820
     ggctgttcag agtgtcatca cttaccatga ctaaccagaa tttgttcatg actgttgttt      2880
     tctgtagcct gagacagctg tcttgtgagg gactgagatg caggatttct tcacgcctcc      2940
     cctttgtgac ttcaagagcc tctggcatct ctttctgcaa aggcacctga atgtgtctgc      3000
     gtccctgtta gcataatgtg aggaggtgga gagacagccc acc                        3043
//


spacer
spacer