spacer

EBI Dbfetch

ID   AM285029; SV 2; linear; genomic DNA; STD; HUM; 849 BP.
XX
AC   AM285029;
XX
DT   30-JUN-2006 (Rel. 88, Created)
DT   01-NOV-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens partial HLA-C gene for MHC class I antigen, HLA-Cw*new allele,
DE   exons 1-3
XX
KW   HLA-C gene; HLA-Cw*new allele; major histocompatibility complex;
KW   MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   revised by [3]
RA   Fischer G.F.;
RT   ;
RL   Submitted (29-JUN-2006) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20 A-1090 Vienna, A-1090, AUSTRIA.
XX
RN   [2]
RX   DOI; 10.1111/j.1399-0039.2008.01125.x.
RX   PUBMED; 18937795.
RA   Fae I., Rosenmayr A., Mayr W.R., Fischer G.F.;
RT   "A novel HLA-C allele, Cw*0617";
RL   Tissue Antigens 72(5):499-500(2008).
XX
RN   [3]
RP   1-849
RA   Fischer G.F.;
RT   ;
RL   Submitted (03-OCT-2007) to the INSDC.
RL   Fischer G.F., Department for Blood Group Serology, University of Vienna,
RL   Waehringer Guertel 18-20 A-1090 Vienna, A-1090, AUSTRIA.
XX
DR   MD5; 0c918b469b570237d87ffe5f3a36d356.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..849
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /country="Austria:Weinviertel"
FT                   /clone="SJ280/32"
FT                   /cell_type="leukocytes"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..73
FT                   /gene="HLA-C"
FT                   /number=1
FT   CDS             join(<1..73,204..473,574..>849)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*new"
FT                   /product="MHC class I antigen"
FT                   /function="antigen presentation"
FT                   /db_xref="GOA:Q14QQ1"
FT                   /db_xref="IMGT/HLA:C*06:17"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q14QQ1"
FT                   /protein_id="CAK96162.2"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRA"
FT   gap             74..203
FT                   /estimated_length=130
FT   exon            204..473
FT                   /gene="HLA-C"
FT                   /number=2
FT   gap             474..573
FT                   /estimated_length=unknown
FT   exon            574..849
FT                   /gene="HLA-C"
FT                   /number=3
XX
SQ   Sequence 849 BP; 113 A; 198 C; 225 G; 83 T; 230 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nnngctccca ctccatgagg tatttcgaca ccgccgtgtc       240
     ccggcccggc cgcggagagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg aacctgcgga aactgcgcgg ctactacaac cagagcgagg acgnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca caccctccag tggatgtatg       600
     gctgcgacct ggggcccgac gggcgcctcc tccgcgggta tgaccagtcc gcctacgacg       660
     gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg gacacggcgg       720
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagtgg agagcctacc       780
     tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       840
     agcgcgcgg                                                               849
//


spacer
spacer