spacer

EBI Dbfetch

ID   AM279416; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM279416;
XX
DT   13-JUL-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial DQB1 gene for MHC class II antigen, exon 2
XX
KW   DQB1 gene; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   McWhinnie A.J.M.;
RT   ;
RL   Submitted (13-JUN-2006) to the INSDC.
RL   McWhinnie A.J.M., Research Institute, Anthony Nolan Trust, Royal Free
RL   Hospital,Fleet Road,Hampstead,London., NW3 2QG, UNITED KINGDOM.
XX
RN   [2]
RA   McWhinnie A.;
RT   "Exon 2 sequence of a new HLA-DQB1*06 allele DQB1*06xx.";
RL   Unpublished.
XX
DR   MD5; 0ed4e20fca83d977c5a48fd5e6464a25.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="United Kingdom"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..270
FT                   /gene="DQB1"
FT                   /allele="DQB1*06new"
FT   exon            1..270
FT                   /gene="DQB1"
FT                   /allele="DQB1*06new"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DQB1"
FT                   /allele="DQB1*06new"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q14QT3"
FT                   /db_xref="IMGT/HLA:DQB1*06:08:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q14QT3"
FT                   /protein_id="CAK50560.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRHIYNREEYARFDSDVGVYRAV
FT                   TPQGRPVAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRR"
XX
SQ   Sequence 270 BP; 59 A; 65 C; 100 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtaac cagacacatc tataaccgag aggagtacgc gcgcttcgac agcgacgtgg       120
     gggtgtaccg ggcggtgacg ccgcaggggc ggcctgttgc cgagtactgg aacagccaga       180
     aggaagtcct ggaggggacc cgggcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//


spacer
spacer