spacer

EBI Dbfetch

ID   AM269468; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AM269468;
XX
DT   03-JUN-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens partial HLA-DRB1 gene for MHC class II antigen, HLA-DRB1*03
DE   variant MSC0506 allele, exon 2, isolate MHHZ-00020533
XX
KW   HLA-DRB1 gene; HLA-DRB1*03 variant MSC0506 allele;
KW   major histocompatibility complex; MHC class II antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Blasczyk R.;
RT   ;
RL   Submitted (01-JUN-2006) to the INSDC.
RL   Blasczyk R., Institute for Transfusion Medicine, Hannover Medical School,
RL   Carl-Neuberg-Str. 1, Hannover, 30625, GERMANY.
XX
RN   [2]
RA   Horn P.A., Verboom M., Blasczyk R.;
RT   "A novel HLA-DRB1*03 allele.";
RL   Unpublished.
XX
DR   MD5; 551e2590e3502eadd0d72e25a6e82ceb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="MHHZ-00020533"
FT                   /mol_type="genomic DNA"
FT                   /sex="female"
FT                   /tissue_type="peripheral blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant MSC0506"
FT                   /product="MHC class II antigen"
FT                   /function="antigen presenting molecule"
FT                   /db_xref="GOA:Q1EIR2"
FT                   /db_xref="IMGT/HLA:DRB1*03:30"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q1EIR2"
FT                   /protein_id="CAK29680.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEEFVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant MSC0506"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 98 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer