spacer

EBI Dbfetch

ID   AM268430; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   AM268430;
XX
DT   31-MAY-2006 (Rel. 88, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens partial HLA-A gene for MHC class I antigen, HLA-A*24new
DE   allele, exons 2-4
XX
KW   HLA-A gene; HLA-A*24new allele; human leucocyte antigen A;
KW   major histocompatibility complex; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Dormoy A.;
RT   ;
RL   Submitted (30-MAY-2006) to the INSDC.
RL   Dormoy A., Laboratoire HLA, Etablissement Francais du Sang-Alsace, 10 rue
RL   Spielmann, 67000, FRANCE.
XX
RN   [2]
RA   Dormoy A., Chabod J., Froelich N., Weschler B.;
RT   "The new HLA-A*24 allele is identical to the current HLA-A*24020101 allele
RT   except for a substitution at position 539 leading to the change of codon
RT   156 : CAG(Gln) ->CTG(Leu)";
RL   Unpublished.
XX
DR   MD5; e38228cb139a67eee68929c2c13428a6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /PCR_primers="fwd_name: P5' Ala A-1, fwd_seq:
FT                   tgacccagacctgggca, rev_name: P3' Intron 6A, rev_seq:
FT                   cccacagaasatgtggctag"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="MHC class I antigen"
FT                   /function="peptide presentation"
FT                   /db_xref="GOA:Q1EJP6"
FT                   /db_xref="IMGT/HLA:A*24:13:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q1EJP6"
FT                   /protein_id="CAK29511.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 822 BP; 172 A; 250 C; 279 G; 121 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gttctcacac cctccagatg atgtttggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccaa gcgcaagtgg gaggcggccc atgtggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacggaccc ccccaagaca catatgaccc accaccccat ctctgaccat gaggccactc       600
     tgagatgctg ggccctgggc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gggaggacca gacccaggac acggagcttg tggagaccag gcctgcaggg gatggaacct       720
     tccagaagtg ggcagctgtg gtggtacctt ctggagagga gcagagatac acctgccatg       780
     tgcagcatga gggtctgccc aagcccctca ccctgagatg gg                          822
//


spacer
spacer